7MPLA

Bartonella henselae nrnc bound to pgg
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
206
structure length
206
Chain Sequence
MTEIRVHQGDLPNLDNYRIDAVAVDTETLGLQPHRDRLCVVQLSSGDGTADVIQIAKGQKSAPNLVRLLSDRDITKIFHFGRFDLAILAHTFGVMPDVVFCTKIASKLTRTYTDRHGLKEICGELLNVNISKQQQSSDWAAETLSRAQIEYAASDVLYLHRLKDIFEERLKREERESVAKACFQFLPMRANLDLLGWSEIDIFAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords NanoRNase C
publication title Structural characterization of NrnC identifies unifying features of dinucleotidases.
pubmed doi rcsb
source organism Bartonella henselae
total genus 64
structure length 206
sequence length 206
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2021-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...