7N7HA

X-ray crystal structure of viperin-like enzyme from nematostella vectensis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
289
structure length
289
Chain Sequence
MTVPVSVNYHFTRQCNYQCGFCFHTAKTSFVLPIEEAKKGLLMLMKAGMEKVNFSGGEPFLHDRGKFVGELVRYCKQELELPSVSIVSNGSLIRDNWFNKYGECLDILAISCDSFDEETNVLIGRRQKGKNHVEALRRVRDMCQQYKVAFKLNTVVNTYNKQEDMTSHIQELCPVRWKVFQCLVIAGENSGEDALRDAEQFLVSNHEFDQFISRHASLECLVPESNEKMQNSYLILDEYMRFLDCTGGSKSPSKSILDVGVDQAMKFSGFDEKMFLKRGGKYVWSKADM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords VIPERIN-LIKE ENZYME
publication title Structural Insight into the Substrate Scope of Viperin and Viperin-like Enzymes from Three Domains of Life
rcsb
source organism Nematostella vectensis
total genus 110
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2021-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...