7NDRA

Crystal structure of tphc in an open conformation
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
294
structure length
294
Chain Sequence
NQPLKIVVPFSAGGTADVLPRLVAEKIRADYAGGVIIENKPGAGGNIGADLVFRAPPDGMTVLASPPGPIAINHNLYQKLSFDPTRWVPVTILATVPNVLVINPKLPVKSLGEFIAYAKANPKKVTVATQGDGSTSHLTAAMFMQLTGTELTVIPYKGTAPALIDLIGGNVDVFFDNISSSATYHQAGKVRILAVADEQRSQILPQVPTFAEQQWPAMQAVTFFSVVAPPGTSAEIAQKLQKQMALALSSNDIRKHFQEQGAVPCGWDPSKTAQFIRQETEKWKKVLKAANVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Tripartite tricarboxylate transporter substrate binding protein
publication title Structural basis of terephthalate recognition by solute binding protein TphC
rcsb
source organism Comamonas sp.
total genus 91
structure length 294
sequence length 294
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2021-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03401 TctC Tripartite tricarboxylate transporter family receptor
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...