7NF1A

Structure of t. atroviride variant tafdcv in complex with prfmn-butynoic acid adduct
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
497
structure length
497
Chain Sequence
EPPHLSFRSFVNALRQDGDLVDINEPVDPDLEAAAITRLVCETDDKAPLFNNVIGAKDGLWRILGAPASLRSSPKERFGRLARHLALPPTASAKDILDKMLSANSIPPIEPVIVPTGPVKENSIEGENIDLEALPAPMVHQSDGGKYIQTYGMHVIQSPDGCWTNWSIARAMVSGKRTLAGLVISPQHIRKIQDQWRAIGQEEIPWALAFGVPPTAIMASSMPIPDGVSEAGYVGAIAGEPIKLVKCDTNNLYVPANSEIVLEGTLSTTKMAPEGPFGEMHGYVYPGESHPAPVYTVNKITYRNNAILPMSACGRLTDETQTMIGTLAAAEIRQLCQRAGLPITDAFAPFVGQATWVALKVDTHRLRAMKTNGKAFAKRVGDVVFTQKVGYMIHRLILVGDDIDVYDDKDVMWAFATRCRPGTDEVFFDDVPGFWLIPYMSHGNAEAIKGGKVVSDALLTAEYTTGKDWESADFKNSYPKSIQDKVLNSWERLGFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Ferulic acid decarboxylase 1
publication title Directed evolution of prenylated FMN-dependent Fdc supports efficient in vivo isobutene production.
pubmed doi rcsb
source organism Hypocrea atroviridis (strain atcc 20476 / imi 206040)
total genus 163
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature ec 4.1.1.102: Phenacrylate decarboxylase.
pdb deposition date 2021-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01977 UbiD 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...