7NKDD

Mycobacterium smegmatis atp synthase b-delta state 1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
75
structure length
39
Chain Sequence
KTAGRVVRIVDVEFPRGSVPEQHLGDSLVRCVRGVEVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha
publication title Structure of the ATP synthase from Mycobacterium smegmatis
rcsb
source organism Mycolicibacterium smegmatis (strain atcc 700084 / mc(2)155)
total genus 4
structure length 39
sequence length 75
chains with identical sequence E, F
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2021-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain
D PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...