7NLJB

Complex of rice blast (magnaporthe oryzae) effector protein apikl2a with host target shma25 from setaria italica
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
NEYLDAKKHGIDLSRERAPNFVDHPGIPPSDCFWFLYKNYVRQDAGVCQSDWSFDMKIGQYWVTIHTDEGCRLSGIIPAGWLILGIKRLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords sHMA25
publication title A single amino acid polymorphism in a conserved effector of the multihost blast fungus pathogen expands host-target binding spectrum
rcsb
source organism Setaria italica
total genus 16
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2021-02-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...