7NQAA

Complex of nucleoporin-98 and nanobody ms98-27 solved at 1.85a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
152
structure length
152
Chain Sequence
SHPAGIILTRDSYYTIPSMEELARSVDENGECIVNGFTIGREGFGSIYFEGIVNLTNLDLDSIVHIRRKEVIVYVDDQNKPPLGEGLNRPAQVTLDEVWPIDKTSRCMITSPERLSEMNYKSKLENASRKQGAQFVDYRPESGSWVFKVNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords Nuclear pore complex protein Nup96
publication title Crystal structure of Nucleoporin-98 nanobody MS98-6 complex solved at 2.2A resolution
rcsb
source organism Xenopus tropicalis
total genus 42
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-03-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...