7NQHAf

55s mammalian mitochondrial ribosome with mtrf1a and p-site trnamet
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
99
structure length
99
Chain Sequence
VESFASMLRHSPLTQMGPAKNKLVIGQIFHIVEDDLYIDFGGKFHCVCKRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTILEADAVLLGLQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Mitochondrial ribosomal protein L12
publication title Release, rescue and recycling: termination of translation in mammalian mitochondria
rcsb
source organism Homo sapiens
total genus 11
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2021-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Af PF10246 MRP-S35 Mitochondrial ribosomal protein MRP-S35
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...