7NQLBF

55s mammalian mitochondrial ribosome with ict1 and p site trnamet
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
250
structure length
250
Chain Sequence
PPVLRKCELPVPAHRRPVQAWIESLRGYEQERVGLTELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLELPTADPQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVPAVGLNVHSMLKHQTLVLTLPTVAFLEEKLLWHNSRYTPLYPFRLPYCDFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Mitochondrial ribosomal protein L34
publication title Release, rescue and recycling: termination of translation in mammalian mitochondria
rcsb
source organism Sus scrofa
total genus 53
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2021-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BF PF00573 Ribosomal_L4 Ribosomal protein L4/L1 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...