7NQLBx

55s mammalian mitochondrial ribosome with ict1 and p site trnamet
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
162
structure length
162
Chain Sequence
b'FREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPKLPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDNVSYSGRPLLLYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ribosomal protein L34
publication title Release, rescue and recycling: termination of translation in mammalian mitochondria
rcsb
source organism Sus scrofa
molecule tags Translation
total genus 19
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2021-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Bx PF01084 Ribosomal_S18 Ribosomal protein S18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...