7NTLA

Aa9 lytic polysaccharide monooxygenase (lpmo) from malbranchea cinnamomea
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
219
Chain Sequence
HGYVSSIQAGQTYPGADPHNPNPESPGWQAENTDLGFVEPSAFSTPAIACHKNARAPPAHATVQAGSTIKLTWNTWPESHHGPVLDYIAPCNGDCSSASAGSLNFVKIAEKGLISGSNPGFWAADELIQNGNSWEVTIPANLAPGKYVLRHEIIALHSAGNPNGAQAYPQCINLEVTGGGSATPSGQPATSFYSPNDPGILFNLYQSFDSYPIPGPAVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords LPMO9F
publication title Structure of a C1/C4-oxidizing AA9 lytic polysaccharide monooxygenase from the thermophilic fungus Malbranchea cinnamomea.
pubmed doi rcsb
source organism Malbranchea cinnamomea
total genus 51
structure length 219
sequence length 220
ec nomenclature
pdb deposition date 2021-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03443 Glyco_hydro_61 Glycosyl hydrolase family 61
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...