7NZMC

Cryo-em structure of pre-dephosphorylation complex of phosphorylated eif2alpha with trapped holophosphatase (pp1a_d64a/ppp1r15a/g-actin/dnase i)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
EKVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQEELSPCLTPAARARAWAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Eukaryotic translation initiation factor 2 subunit 1
publication title Higher order phosphatase-substrate contacts terminate the Integrated Stress Response
rcsb
source organism Homo sapiens
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2021-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...