7O0TA

Crystal structure of chloroflexus aggregans ene-reductase caoye holoenzyme
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
354
structure length
354
Chain Sequence
MQPHLFTPLTIGSVTLRNRIGMSPMCQYSAVDGFPTDWHLMHLGARAAGGVGLIILEATAVSPEGRISPFDLGIWSDDHIAALSRIVKLIESLGAVAGIQLAHAGRKASVGRPWEGGKPIAPANGGWPVVGPTAEPFAPGYPTPIPLDAAGIARVVADFATATKRARAAGFRWIEIHAAHGYLLHNFLSPLGNDRNDEYGGDLRGRVRLLSEVTAAVRAEWPSDLPLAVRLSCSDWTPEGLTIADTVEVARMLREQGVDLIDCSSGGIAPGITIPVGEGYQVPFAAQVRREANIATAAVGLITRPEHADAIVRNGDADLVLLGRELLRDPHWPLRAARALGHDLAPPPQYLRAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH:flavin oxidoreductase/NADH oxidase
publication title A New Thermophilic Ene-Reductase from the Filamentous Anoxygenic Phototrophic Bacterium Chloroflexus aggregans
doi rcsb
source organism Chloroflexus aggregans (strain md-66 / dsm 9485)
total genus 122
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2021-03-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...