7O62A

Crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
135
Chain Sequence
SFRPKLYLAAPLFNEAEKESNRNIRDSLIDCCDVFLPQEDLGTPLKVAEKSIYEADISAMKNADILLAVLDGACIDDGVAFELGYAKAINKVCLGFQTDVRRQAPTGNNPMIECSCEEIFSDLGSLKKWLQQKYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Chains: A,B,C,D
publication title Biochemical and structural studies of two tetrameric nucleoside 2'-deoxyribosyltransferases from psychrophilic and mesophilic bacteria: Insights into cold-adaptation.
pubmed doi rcsb
source organism Desulfotalea psychrophila (strain lsv54 / dsm 12343)
total genus 47
structure length 135
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2021-04-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...