7O6Y6

Cryo-em structure of respiratory complex i under turnover
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
183
structure length
134
Chain Sequence
MYLTYYFIEITIFLAILCTFIISAKNPMVSILYMIALFVIAAMYLYLIGLGIFSLLYIMIYIGAIAVLFLFIITLLDNDYNTIITQDWFNIENTTLLTTIGNVLLTNNAFILLVLAIVLLLGIIGPISITMKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure and dynamics of mitochondrial complex I-Insights into the proton pumping mechanism.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Subunit NUAM of NADH:Ubiquinone Oxidoreductase (Complex I)
total genus 42
structure length 134
sequence length 183
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2021-04-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...