7OH9M

Nucleosome with tbp and tfiia bound at shl -6
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
104
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDQSVISVDKLRIVACNSKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Histone H3.2
publication title Structures and implications of TBP-nucleosome complexes
doi rcsb
source organism Xenopus laevis
total genus 27
structure length 104
sequence length 117
ec nomenclature
pdb deposition date 2021-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
M PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...