7OPEj

Rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
37
structure length
37
Chain Sequence
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RqcH and RqcP catalyze processive poly-alanine synthesis in a reconstituted ribosome-associated quality control system.
pubmed doi rcsb
molecule keywords 23S rRNA
molecule tags Ribosome
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 6
structure length 37
sequence length 37
ec nomenclature
pdb deposition date 2021-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00444 Ribosomal_L36 Ribosomal protein L36
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...