7OW9A

Crystal structure of a staphylococcal orthologue of cyp134a1 (cypx) in complex with cyclo-l-leucyl-l-leucine
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
397
structure length
393
Chain Sequence
KVYNSIFDQAYEIDPIPYFNFLRKHDPVHYEESIDAYFVSKYKDVKYILKNNDIFNTKTLAKRAEPVMKDRVLAQMSGQEHKSKKKAILKGMTGKYLENLMPILEKRTNDIINKHIEKKEIDIVNDFGKVFAVQSSMDLLGINLENYEKIREWHNGIAKFITSFNLNDEEIKYSLECSDKLENYLMPLIKDRKKSTKDDLISILLEYKNDENSISDTEILALSLNVLLAATEPVDKTLAYLFYNLLKNPEQFESVKNNPKLIKNAIIETLRYNSPVQLIPRQVSKPFIFNNTELQAGDTVICMIGSANRDPEAYSNPDEFNIHRSSDNTSHSQNLSFGTGVHTCVGASFSLIQLEMVAILLLKRLKNIKLKTMEITEHGIYTRGPKSMVISFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords CYPX
publication title Crystal structure of a staphylococcal orthologue of CYP134A1 (CYPX) in complex with Cyclo-L-leucyl-L-leucine
rcsb
source organism Staphylococcus aureus
total genus 145
structure length 393
sequence length 397
ec nomenclature
pdb deposition date 2021-06-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...