7P76A

Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
247
structure length
247
Chain Sequence
LKASSLRALKLMDLSTLNGDYTDEKVIALCHQAKTPVGNTAAISIYPRSIPIARKTLKEQGTPEIRIATVTNFPHGNDDIEIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIESGELKDEALIRKASEISIKAGADFIKTSTGLVAVNATPESARIMMEVIRDMGVEKSVGFKVTGGARTAEDAQKYLAIADELFGADWADARHYRFGASGLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Unlocking Asymmetric Michael Additions in an Archetypical Class I Aldolase by Directed Evolution
doi rcsb
source organism Escherichia coli 909945-2
total genus 102
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2021-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...