7PIOt

70s ribosome with p-site trna in pseudouridimycin-treated mycoplasma pneumoniae cells
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
111
structure length
111
Chain Sequence
MQRIKKGDKVVVITGKNKGGSGIVLKIMPARQQAIVEGLNKVTRHKKKDQTTKRAAKQSTGKVQQEAPIFLSKLALFDQKAKQQTIGKIKYVMDPKTNKKTRVFKKSNNTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing translation dynamics at atomic detail inside a bacterial cell.
pubmed doi rcsb
molecule tags Translation
molecule keywords 50S ribosomal protein L34
total genus 8
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2021-08-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...