7PLQA

Crystal structure of the parp domain of wheat sro1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
182
structure length
178
Chain Sequence
VDSAVRKLLLEGAGQPFSEENIIGIYRTPLVDQQGRARFNLFQKELEATKMHRGNANVRYAWLPCSKDTMEEMMMRGVLEVTKPVYGIGTHLAPANCAQTCASYSDIDENGIMRMMLCRVIMGNVEVVLPGSKQFQPTNERFDSGVDDLQKPKHYIIWDANVHRHIYAEYAVVIKAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords SIMILAR TO RCD1 (SRO1)
publication title The superior salinity tolerance of wheat cultivar Shanrong No. 3 cannot be attributed to elevated Ta-sro1 poly(ADP-ribose) polymerase activity
doi rcsb
source organism Triticum aestivum
total genus 36
structure length 178
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-09-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...