7PMNK

S. cerevisiae replisome-scf(dia2) complex bound to double-stranded dna (conformation ii)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
190
structure length
137
Chain Sequence
SNVVLVSGEGERFTVDKKIAERSLLLKNYLIVMPVPNVRSSVLQKVIEWAEHHRDSNFPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism for regulating replisome disassembly in eukaryotes.
pubmed doi rcsb
molecule tags Replication
source organism Saccharomyces cerevisiae
molecule keywords DNA replication licensing factor MCM2
total genus 45
structure length 137
sequence length 190
ec nomenclature
pdb deposition date 2021-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...