The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
59
|
sequence length |
257
|
structure length |
257
|
Chain Sequence |
YHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPRRRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSAYYAGGLLYATPERAESLL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid.
pubmed doi rcsb |
| molecule tags |
Photosynthetic reaction center
|
| molecule keywords |
PHOTOSYNTHETIC REACTION CENTER
|
| total genus |
59
|
| structure length |
257
|
| sequence length |
257
|
| ec nomenclature | |
| pdb deposition date | 1997-08-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| H | PF03967 | PRCH | Photosynthetic reaction centre, H-chain N-terminal region |
| H | PF05239 | PRC | PRC-barrel domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Photosynthetic Reaction Center; Chain H, domain 2 | Photosynthetic Reaction Center, subunit H, domain 2 | ||
| Few Secondary Structures | Irregular | Photosynthetic Reaction Center; Chain H, domain 1 | Photosynthetic reaction centre, H subunit, N-terminal domain |
#chains in the Genus database with same CATH superfamily 3DTS H; 1E14 H; 4HBJ H; 1RQK H; 1FNQ H; 1L9J H; 1RZH H; 1E6D H; 2J8C H; 1M3X H; 2HIT H; 2JIY H; 1JGY H; 5LRI H; 4HBH H; 2X5V H; 1PST H; 2J8D H; 3PRC H; 2HHK H; 2BNP C; 2UWW H; 6PRC H; 3T6D H; 1EYS H; 1RG5 H; 1FNP H; 1PRC H; 1RVJ H; 2UXL H; 4LWY H; 1DV6 H; 2WJM H; 2PRC H; 7PRC H; 4IN6 H; 1MPS H; 4CAS D; 5LSE H; 1L9B H; 1DXR H; 1R2C H; 1YST H; 1RZZ H; 1DS8 H; 2UXK H; 2GMR H; 1JGW H; 1OGV H; 1PSS H; 2JBL H; 2GNU H; 2UWS H; 4H9L H; 1JH0 H; 4N7L H; 2UX4 H; 2UWV H; 3G7F H; 2UXM H; 3DTR H; 3D38 H; 2WX5 H; 2UWU H; 4N7K H; 3T6E H; 2RCR H; 3DU3 H; 2HH1 H; 2UXJ H; 2BOZ H; 1QOV H; 2JJ0 H; 2UX3 H; 3DSY H; 2BNS C; 3I4D H; 2HG9 H; 3DU2 H; 1DV3 H; 2I5N H; 4H99 H; 2HG3 H; 1VRN H; 1PCR H; 2UX5 H; 3V3Z H; 2HJ6 H; 3V3Y H; 4IN7 H; 1UMX H; 1JGZ H; 1YF6 H; 4RCR H; 1K6N H; 1RGN H; 3ZUM H; 1AIG H; 1S00 H; 3DTA H; 3DUQ H; 5PRC H; 3WMM H; 2UWT H; 2X5U H; 4TQQ H; 4IN5 H; 3ZUW H; 2WJN H; 1AIJ H; 1KBY H; 1JGX H; 1K6L H; 1RY5 H; 1F6N H; #chains in the Genus database with same CATH topology 3DTS H; 1E14 H; 4HBJ H; 1RQK H; 1FNQ H; 1L9J H; 1RZH H; 1E6D H; 2J8C H; 1M3X H; 2HIT H; 2JIY H; 1JGY H; 5LRI H; 4HBH H; 2X5V H; 1PST H; 2J8D H; 3PRC H; 2HHK H; 2BNP C; 2UWW H; 6PRC H; 3T6D H; 1EYS H; 1RG5 H; 1FNP H; 1PRC H; 1RVJ H; 2UXL H; 4LWY H; 1DV6 H; 2WJM H; 2PRC H; 7PRC H; 4IN6 H; 1MPS H; 4CAS D; 5LSE H; 1L9B H; 1DXR H; 1R2C H; 1YST H; 1RZZ H; 1DS8 H; 2UXK H; 2GMR H; 1JGW H; 1OGV H; 1PSS H; 2JBL H; 2GNU H; 2UWS H; 4H9L H; 1JH0 H; 4N7L H; 2UX4 H; 2UWV H; 3G7F H; 2UXM H; 3DTR H; 3D38 H; 2WX5 H; 2UWU H; 4N7K H; 3T6E H; 2RCR H; 3DU3 H; 2HH1 H; 2UXJ H; 2BOZ H; 1QOV H; 2JJ0 H; 2UX3 H; 3DSY H; 2BNS C; 3I4D H; 2HG9 H; 3DU2 H; 1DV3 H; 2I5N H; 4H99 H; 2HG3 H; 1VRN H; 1PCR H; 2UX5 H; 3V3Z H; 2HJ6 H; 3V3Y H; 4IN7 H; 1UMX H; 1JGZ H; 1YF6 H; 4RCR H; 1K6N H; 1RGN H; 3ZUM H; 1AIG H; 1S00 H; 3DTA H; 3DUQ H; 5PRC H; 3WMM H; 2UWT H; 2X5U H; 4TQQ H; 4IN5 H; 3ZUW H; 2WJN H; 1AIJ H; 1KBY H; 1JGX H; 1K6L H; 1RY5 H; 1F6N H; #chains in the Genus database with same CATH homology 3DTS H; 1E14 H; 4HBJ H; 1RQK H; 1FNQ H; 1L9J H; 1RZH H; 1E6D H; 2J8C H; 1M3X H; 2HIT H; 2JIY H; 1JGY H; 5LRI H; 4HBH H; 2X5V H; 1PST H; 2J8D H; 3PRC H; 2HHK H; 2BNP C; 2UWW H; 6PRC H; 3T6D H; 1EYS H; 1RG5 H; 1FNP H; 1PRC H; 1RVJ H; 2UXL H; 4LWY H; 1DV6 H; 2WJM H; 2PRC H; 7PRC H; 4IN6 H; 1MPS H; 4CAS D; 5LSE H; 1L9B H; 1DXR H; 1R2C H; 1YST H; 1RZZ H; 1DS8 H; 2UXK H; 2GMR H; 1JGW H; 1OGV H; 1PSS H; 2JBL H; 2GNU H; 2UWS H; 4H9L H; 1JH0 H; 4N7L H; 2UX4 H; 2UWV H; 3G7F H; 2UXM H; 3DTR H; 3D38 H; 2WX5 H; 2UWU H; 4N7K H; 3T6E H; 2RCR H; 3DU3 H; 2HH1 H; 2UXJ H; 2BOZ H; 1QOV H; 2JJ0 H; 2UX3 H; 3DSY H; 2BNS C; 3I4D H; 2HG9 H; 3DU2 H; 1DV3 H; 2I5N H; 4H99 H; 2HG3 H; 1VRN H; 1PCR H; 2UX5 H; 3V3Z H; 2HJ6 H; 3V3Y H; 4IN7 H; 1UMX H; 1JGZ H; 1YF6 H; 4RCR H; 1K6N H; 1RGN H; 3ZUM H; 1AIG H; 1S00 H; 3DTA H; 3DUQ H; 5PRC H; 3WMM H; 2UWT H; 2X5U H; 4TQQ H; 4IN5 H; 3ZUW H; 2WJN H; 1AIJ H; 1KBY H; 1JGX H; 1K6L H; 1RY5 H; 1F6N H;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
