7R7NH

Sars-cov-2 spike in complex with the s2d106 neutralizing antibody fab fragment (local refinement of the rbd and s2d106)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
122
structure length
109
Chain Sequence
VQLVQSGAEKVSCKASGGPFSSSAISWVRQAPGQGLEWMGGIIPMVGTANYAQRVTITADESTSTAYMELSSRSEDTAVYYCARDSRYCSGGSCYSVWFDPWGQGTLVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords S2D106 FAB heavy chain
publication title SARS-CoV-2 RBD antibodies that maximize breadth and resistance to escape
doi rcsb
source organism Homo sapiens
total genus 16
structure length 109
sequence length 122
ec nomenclature
pdb deposition date 2021-06-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...