7RD5A

Crystal structure of tspan15 large extracellular loop (tspan15 lel) in complex with 1c12 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
220
Chain Sequence
DIQMQQSPSSLSASLGDTITITCHASQNINAWLSWYQQKPGNIPKLLIYKASNLYTGVPSRFSGSGSGTRFTLTISSLQPEDIATYYCQQGQSSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECLEVLFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1C12 Fab Light Chain
publication title Crystal structure of the Tspan15 LEL domain reveals a conserved ADAM10 binding site
rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 43
structure length 220
sequence length 220
chains with identical sequence C
ec nomenclature
pdb deposition date 2021-07-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...