7RDRA

Circular tandem repeat protein with novel repeat topology and enhanced subunit contact surfaces
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
456
structure length
456
Chain Sequence
SELAARCLIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELACRILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Circular tendon repeat protein
publication title Design and functionalization of circular tandem repeat proteins with novel repeat topologies and enhanced subunit contact surfaces
rcsb
source organism Unidentified
total genus 241
structure length 456
sequence length 456
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2021-07-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...