7RQ811

Crystal structure of the wild-type thermus thermophilus 70s ribosome in complex with iboxamycin, mrna, deacylated a- and e-site trnas, and aminoacylated p-site trna at 2.50a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/rna
molecule keywords 23S Ribosomal RNA
publication title A synthetic antibiotic scaffold effective against multidrug-resistant bacterial pathogens
rcsb
source organism Escherichia coli
total genus 17
structure length 97
sequence length 97
chains with identical sequence 21
ec nomenclature
pdb deposition date 2021-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
11 PF00830 Ribosomal_L28 Ribosomal L28 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...