7RTOA

Cryo-em structure of bluetongue virus capsid protein vp5 at low endosomal ph intermediate state 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
454
structure length
270
Chain Sequence
TGESYGESVKQAVLLNVLGSGEEIPDPLSPGERGIQAKLKELEDEQRNELVRLKYNDKIKEKFGKELEEVYNFMNIKNEILPRFKKAMDEEKEICGIEDKVIHPKVMMKFKIPRAQQPQIHVYSAPWDSDDVFFFHCISHHHANESFFLGFDLSIDLVHYEDLTAHWHALGAAQTAAGRTLTEAYREFLNLAISNAFGTQMHTRRLVRSKTVHPIYLGSLHYDISFSDLRGNAQRIVYDDELQMHILRGPIHFQRRAILGALKFGCKVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Outer capsid protein VP5
publication title Bluetongue virus capsid protein VP5 perforates membranes at low endosomal pH during viral entry
doi rcsb
total genus 70
structure length 270
sequence length 454
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2021-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00901 Orbi_VP5 Orbivirus outer capsid protein VP5
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...