7RX1A

Crystal structure of the tir domain from the grapevine disease resistance protein run1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
174
structure length
174
Chain Sequence
ARTITYDVFLSFRGEDTRFNFTDHLYSALGRRGIRTFRDDKLRRGEAIAPELLKAIEESRSSVIVFSENYARSRWCLDELVKIMECHKDKKDPGHAVFPIFYHVDPSHVRKQEGSFGEAFAGYGENLKDKIPRWRTALTEAANLSGWPLQDGYESNQIKEITDSIFRRLKCKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Disease resistance protein RUN1
publication title Self-association configures the NAD + -binding site of plant NLR TIR domains
doi rcsb
source organism Vitis rotundifolia
total genus 70
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature ec 3.2.2.6: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase.
pdb deposition date 2021-08-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...