7UM0d

Structure of the phage ar9 non-virion rna polymerase holoenzyme in complex with two dna oligonucleotides containing the ar9 p077 promoter as determined by cryo-em
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
426
structure length
426
Chain Sequence
MGKKLSLIDFNEIYNEENLITRANPIENHEFSDDGIYSERIFGSYNEDDDDKDIDTIGWINIEPYYIINPILFTIIKKCIPSINKIINYQQSIDQNGENIDLTEEIGEDDYIGLVKFKDNFDDLLEKYTDKKKYQKEYDFLIENHDKIFINKLPVFSHKLRPATLLTGSKGKVLAFDEINNYYNFVIEYINQINEGVVSDDSIDLLLLPLLYNMQFYANNILTRIISEYLRGKKGFLRKNIMGSRINFSARNVITPLIGHPIDEVAMPYKTFAELYKFQLINLISKVKGINYNEALKFWEKGILGFNQELYNYMEELITKTKGGCTFLLNRNPTISIGSILYLKIGLIKKDYKDLTLGISNNLLSALSGDYDGDVLNIIPVFDNKMKEHFSLLSPQNFLVDRNNGRFNGDFDLQKDQILGIFILNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of template strand deoxyuridine promoter recognition by a viral RNA polymerase.
pubmed doi rcsb
molecule tags Transcription
source organism Bacillus phage ar9
molecule keywords DNA-directed RNA polymerase subunit
total genus 63
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2022-04-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...