7V2BA

Crystal structure of vpsr display novel dimeric architecture and c-di-gmp binding: mechanistic implications in oligomerization, atpase activity and dna binding.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
375
structure length
375
Chain Sequence
DSVPGSLVVVGGTYEPWLPVLEKVGWRCTQVADLRKPDALFVETGPCIGIVDLSHDEFSLNGIANLVSSHKQVRWLAFIREAQLSSDTICQFIVNFCIDFFTAPIPDAQLLSTIGHQLGMLKLEKKVWPHFGSAGNMGLIGESMPMKRLRDQIKRIGPTDVSILIYGESGTGKETVAKAIHKTSSRAQKPFISVNCRAMSEKRLESELFGLGETEEGQQPFLLQADGGTLLLNDILTLPKSQQLNLLRFLQEGTVETRQGVRAVDVRILAANSSDIEKALIDGDFNEELYHYINVLRINVPSLKERASDIVLLAKHFLQEYSKEYNAQARSFSDDAVRGLTRYHWPGNVRELMNQIKRVVLMSDTVVLDESQLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of VpsR Revealed Novel Dimeric Architecture and c-di-GMP Binding Site: Mechanistic Implications in Oligomerization, ATPase Activity and DNA Binding.
pubmed doi rcsb
molecule tags Transcription
source organism Vibrio cholerae
molecule keywords VpsR
total genus 96
structure length 375
sequence length 375
chains with identical sequence D
ec nomenclature
pdb deposition date 2021-08-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...