7V8BA

Local refinement of sars-cov-2 s-delta variant (b.1.617.2) rbd and angiotensin-converting enzyme 2 (ace2) ectodomain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
201
structure length
201
Chain Sequence
PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Spike glycoprotein
publication title Local refinement of SARS-CoV-2 S-Delta variant (B.1.617.2) RBD and Angiotensin-converting enzyme 2 (ACE2) ectodomain
rcsb
source organism Severe acute respiratory syndrome coronavirus 2
total genus 26
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2021-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09408 bCoV_S1_RBD Betacoronavirus spike glycoprotein S1, receptor binding
A PF16451 bCoV_S1_N Betacoronavirus-like spike glycoprotein S1, N-terminal
A PF16451 bCoV_S1_N Betacoronavirus-like spike glycoprotein S1, N-terminal
A PF19209 CoV_S1_C Coronavirus spike glycoprotein S1, C-terminal
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...