7VFUD

Human n-type voltage gated calcium channel cav2.2-alpha2/delta1-beta1 complex, bound to ziconotide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
186
structure length
163
Chain Sequence
PSMRPIILVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Voltage-dependent N-type calcium channel subunit alpha-1B
publication title Closed-state inactivation and pore-blocker modulation mechanisms of human CaV2.2.
doi rcsb
source organism Homo sapiens
total genus 52
structure length 163
sequence length 186
ec nomenclature
pdb deposition date 2021-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00625 Guanylate_kin Guanylate kinase
D PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...