7WZEA

Structure of transcriptional regulator from bacillus subtilis (strain 168)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
161
Chain Sequence
ELKHLPKYKHITEHAETYANIDAGSLELFLSLFDISKKMNHVMEHYFAGRGLSEGKFKILMLLFDAKDHRLSPTELAKRSNVTKATITGLLDGLARDGFVSRRHHRKISIELTTEGKARLEQFLPGHFSKISAVMENYSDEEKDMFVKMLGDLFERLSVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based molecular characterization of the YetL transcription factor from Bacillus subtilis.
pubmed doi rcsb
molecule tags Transcription
source organism Bacillus subtilis subsp. subtilis str. 168
molecule keywords Uncharacterized HTH-type transcriptional regulator YetL
total genus 43
structure length 161
sequence length 165
chains with identical sequence Y
ec nomenclature
pdb deposition date 2022-02-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...