7YASA

Hydroxynitrile lyase, low temperature native structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 7yasA00
5LZ5A 1TKRA 3WMRA 3WA7A 2PU5A 4M0FA 2C5GA 2FJ0A 3AIOA 2XUKA 3WKAA 4KACA 4QLAA 2Z5GA 4B84A 1MJ5A 4X85A 2HDWA 1UT6A 4MEAA 3HEAA 1AZWA 1HL7A 4N8SA 1FFDA 3B3QA 2XLCA 4BC0A 5JASA 3CCBA 5DYTA 1SCKA 2PKYX 5LKAA 1P0QA 4ZGBA 1JFRA 1TRHA 2QVBA 2WG1A 2HHAA 3IUQA 1O6GA 2FX5A 4G9GA 3W9BA 1ZD2P 3STTA 1CR6A 3FVRA 1XZJA 2XLBA 2H9YA 2QJWA 4EUSA 2GYWA 2YYSA 1Q0RA 4YX9A 1EH5A 3WZMA 2VAXA 2H7CA 2OCIA 3ESDA 2ZYSA 2OCKA 2BJHA 1UKBA 4AMYA 3R41A 3DOHA 4FNMA 1XQXA 3G9XA 4P9NA 2O7RA 3FOBA 5IKXA 5JZ9A 4GI1A 2PSFA 3RKSA 5CH3A 1PFQA 4BCDA 3FYUA 1XZGA 1A88A 3F96A 4JEIA 4X95A 2FJPA 4LIPD 2RAUA 5HF9A 1XRQA 4FOLA 3CN7A 1QTRA 1N8SA 4FWBA 2W6CX 5ALDA 1ODTC 2OAEA 4J0IA 3I2KA 4H35A 2HU8A 1JMKC 1GPKA 3I6ZA 3JW8A 5CT8A 3BJMA 5AKEA 3WI7A 3WWEA 5T4FA 2I78A 5HF6A 1EA5A 4ITVA 2ONCA 3L1JA 3O4HA 2HA5A 1K4YA 4GW3A 3R3XA 3WLAA 2HA2A 1IZ7A 2ACKA 4X94A 1MNAA 1ACJA 3M3DA 3HC7A 3ANTA 3WIBA 3WL7A 3DDUA 4GECA 2P8SA 4QEKA 2O2HA 2AJCA 2XMDA 4W1SA 4JUIA 5DLPA 3VJLA 1DQZA 1PJAA 2PSHA 3FAKA 2WKWA 1W75A 5IVDA 3BL8A 2GZRA 2OLEA 2YH2A 4IHAA 1UOOA 3NUZA 4QNNA 2AJDA 1JI3A 3OURA 2EEPA 1IMJA 4Q34A 2WIJA 4OD0A 3WL6A 1XLVA 3EQ9A 4GDMA 5AM2A 1K8QA 4PV7A 3BF7A 1DT3A 1WHSA 1W4LA 4DMKA 3R40A 3DYVA 4HVTA 4FMPA 4XVCA 4Y7DA 1HPLA 1VZ3A 2ZVDA 1LGYA 3QH4A 3FBWA 2XMBA 4F5ZA 3QYJA 4GEGA 4P93A 5K3DA 4Q3KA 3VVMA 1QE3A 5JADA 5T4HA 4G1FA 3H0CA 3WK9A 4MYSA 4C4ZA 1XZKA 1G66A 2HRQA 1FJ2A 2Z3WA 4TVKA 3STWA 3ZWQA 3WJ2A 4EB0A 4H0CA 1H2XA 3H1BA 3F97A 4O08A 4ARBA 3KD2A 1NU6A 3WKBA 2DCMA 5FLKA 5JZBA 3ZLTA 3SK0A 5DYWA 3FNBA 4BAGA 3H18A 4K6GA 3G0GA 4WFJA 1VZ2A 3R3VA 1K6EA 4DNOA 1ZD5A 1B41A 2VA9A 4BYMA 1QIFA 1Q83A 2WFLB 2CMFA 5JZSA 4C4XA 4L9AA 1XKLA 1ZI8A 2QR5A 1ZD3A 3CN9A 1CUHA 2HU5A 1R4ZA 4RGYA 2VJAA 2VF2A 4W63A 3QMWA 5K5EA 2HA7A 2C7BA 1YCDA 4UHCA 3PUIA 4JYMA 4HAIA 5A6VA 4WY8A 3IDAA 3QPDA 5ALQA 4IH9A 4B0PA 4LXGA 2EDAA 5K3AA 2PVSA 4FKBA 1P0PA 1CUWA 5A2GA 3BXPA 4HXEB 1VA4A 3BE8A 5EHZA 1T2NA 4Y2JA 5HFNA 1EDBA 3B12A 5FXMA 4EHBA 1A8UA 4QLOA 1GQSA 1ZI9A 4MQMA 1KU0A 2PU7A 4BC1A 3GFFA 3DJYA 4KAAA 3H2KA 1QIIA 3EF3A 2WG2A 3I2JA 1SCQA 1KEZA 3D2BA 4Q05A 5CBKA 5AI9A 5AOAA 5LZ4A 4BVJA 1CQZA 5ALFA 5LZ2A 3BJRA 1JKMA 1EVQA 4I19A 3IUNA 3PE6A 4DMHA 1XZAA 4B6GA 5T4EA 3A2LA 5JYCA 4HXGA 5HFAA 5AM5A 1ODCA 4RE5A 4MYDA 2WTMA 3LLCA 4IO0A 4CFSA 2QJRA 3T52A 2QKYA 2AXEA 2HRRA 5LYYA 4FFWA 1L7QA 1UOQA 4U2CA 3D2AA 3L1IA 5JIBA 5ALJA 1XFDA 3GBSA 1BEZA 3WZLA 1TQHA 4H7EA 1ZIYA 4TGLA 4AXBA 3S2ZA 5AKIA 5AKHA 1UK7A 2XUOA 5ESRA 4P92A 3FCYA 3NWOA 5AIBA 5HF8A 2G4LA 1LNSA 1F0PA 2IX9A 2O2GA 2AJ8A 4WCVA 2G63A 4FTWA 3FLAA 3O4JA 4W1PA 4PO3X 4UHFA 2VSQA 1YAHA 3I2GA 1MAHA 1Y7IA 2CB9A 2I3ZA 2O7VA 4W1RA 4C01A 1H2YA 5JD4A 2O2IA 1AGYA 1WCYA 2DFPA 4OB6A 4B83A 3WQHA 3RK4A 1QONA 4X3CA 4GXNA 1QIKA 3ZLVA 5I7UA 2J3DA 5FV4A 1QIGA 2C0PA 1YB7A 1UFOA 4IH1A 1E3QA 1W76A 2VJBA 2ZSIA 1A8SA 3R3YA 3VISA 5SYNA 3A2MA 4CCYA 3IIIA 4AB1A 3QMVA 4KE7A 2ES4A 1QLWA 3HACA 1DWQA 1LPBB 2PX6A 5JAHA 4ZRDA 2WHPA 1ZOIA 1BCRA 1LPMA 3LS2A 3BIXA 3AIMA 3A2NA 2UZ0A 4E11A 1WPXA 3V1KA 3DS8A 4H7JA 4LYEA 3EIOA 3W9UA 5DJ5A 1LPAB 1R50A 5KWIA 3HI4A 1BS9A 2XQIA 3DOIA 5ALUA 4ZV7A 3C8HA 3H2JA 1ETHA 3IVMA 3MUOA 1LLFA 3G8YA 4WJLA 3M81A 5CURA 3UUEA 1BROA 3FLEA 5ISMA 4L72A 1EK2A 1AUOA 2I03A 3W2TA 1IVYA 4J7AA 1UKCA 1E8NA 3G0BA 3A70A 1CQWA 3WK4A 5E2IA 2WUFA 3LIIA 4AZ0A 5HCUA 2QRUA 4F21A 1IUNA 4K5QA 5AI0A 2JBWA 5F4ZA 1C7JA 4MJ3A 4U2GA 2VATA 3PFCA 3ANSA 3E1GA 2XB6A 2HA0A 5A7GA 4G4JA 2WFLA 5KBYA 4MEBA 3ED1A 2RI6A 3FYUB 4J0GA 3ZPXA 3D7RA 2QM0A 4X7BA 5JATA 1BRTA 2HU7A 1TIBA 1G42A 1RP1A 2XUFA 1OILA 1I6WA 2VT6A 2CKMA 2HADA 5J3JA 1VKHA 2JEZA 1M33A 5AIAA 3HLKA 2HA4A 4FFVA 1CUBA 3FLBA 4E46A 1BE0A 1R1DA 1CUDA 5JAUA 1QZ3A 1A7UA 1ZD4A 4NMWA 2OGZA 3WK6A 4DM7A 3FYTA 3HZOA 3FWHA 3IA2A 4U2DA 3ICWA 1AKNA 4UHHA 4BB0A 4HRYA 4KRXA 2PL5A 4RE6A 2JIDA 4N5IX 5AK3A 4GBGA 5ALXA 4KE8A 5JD5A 2C58A 5LZ9A 1N5MA 2WHPB 3G02A 5KREA 4N8DA 1N1MA 4CI9A 3WYNA 3S8YA 1DX6A 1XRPA 1LPNA 1GT6A 4FBMA 2WHRA 5EIEA 3FSGD 3PF8A 2PUHA 4CG2A 4NS4A 1CRLA 1P0IA 5AM0A 2VQ6A 3I6MA 5AH0A 5DNUA 3C8DA 3GZJA 1G5FA 5E4JA 2J4CA 5DTIA 2OQIA 5C8VA 3KOOA 3WWPA 4WY5A 4KRYA 4Z49A 4PSUA 2GZSA 1WB4A 3G0DA 3F67A 3F9CA 2XT0A 4KE9A 2XUIA 4B82A 2AJBA 1DU4A 2Q0XA 1EHYA 5K3BA 1XRMA 2DQYA 5AKKA 4DSZA 1CUGA 2QS9A 3FCXA 3C70A 3IB3A 2HL6A 1XZCA 3KSRA 3D0KA 3Q0TA 3WKEA 2Z3ZA 5AKXA 1FFCA 1WB5A 4PQEA 5K3FB 4QDTA 1EI9A 2OGSA 3DD5A 4X6UA 4XIIA 4BZWA 3KWJA 5ALSA 2D0DA 1LBTA 2BUAA 4Y9SA 2XQGA 3JYHA 1XQVA 1LPSA 4G9EA 5ALNA 5CH8A 4KYVA 3ESCA 2QZPA 5JARA 4UBJA 3MVEA 4X90A 1J07A 2BGRA 2DHDA 2CBGA 4W1QA 5LLSA 3WKDA 3E4DA 4UFNA 5BWCA 2V97A 3OM8A 1J2EA 3MUNA 1IZ8A 3FVTA 3D3NA 2QT9A 2HA3A 1JU3A 4OSEA 1SFRA 5D3KA 2AJLI 3O95A 5E4TA 4PSDA 2VJCA 3HSSA 4UBIA 1NU8A 4Y2PA 1YA8A 4H7IA 3PDCA 5ALPA 1F6WA 1MN6A 2HFJA 3V48A 4CG1A 4ZI5A 3G9ZA 4UHEA 3WL8A 3SC2A 1MPXA 1EINA 2XUPA 3D59A 3E3AA 1X70A 2WSLA 5E4YA 4X92A 2B20A 3H19A 5A71A 2XUQA 3BWXA 1H23A 5HF5A 4XWGA 1OXMA 1UOPA 3VJKA 4KR0A 4UFPA 1JJBA 5YASA 1X2BA 1VE7A 3QITA 5KWJA 3AUKA 1YA4A 1H22A 4BCCA 1DINA 1DTEA 5D3ZA 3PICA 2NW6A 5AM3A 4OPMA 1UXOA 4PW0A 3PUHA 1GPLA 2B61A 3M82A 5ALWA 4OCZA 5CXUA 2WFZA 4OU4A 1XLUA 2IIVA 3C5WP 4DMFA 3HJUA 4ETWA 2JGLA 4I4CA 2BUBA 1EK1A 3WA6A 4J0JA 4OYYA 7YASA 4QDXA 1UWCA 2D5LA 1Q84A 3AZPA 1OCEA 2BKLA 4QA9A 3WJ1A 3DNMA 1CUUA 4J0HA 4HXFB 1DQYA 3HYSA 4S0XA 2W22A 4DNPA 4J0KA 4BDTA 3STYA 2QOEA 3K9BA 4EY6A 4KAJA 1H2WA 3DL4A 2XI4A 4DNFA 4AX4A 3L1HA 2HFKA 1LPPA 3F8SA 1XRLA 2C0QA 4K6HA 2ZYRA 4H7HA 2PUJA 1CUAA 4UPDA 3WK7A 4MQLA 2JGJA 1R9MA 5EHNA 5CH5A 4IQ4A 2X76A 1CUZA 4LXHA 2XQJA 2OG1A 1USWA 1P0MA 5AKLA 3WWDA 1ZJ4A 3G0IA 3YASA 3H04A 3DL7A 3O4IA 2RIPA 5T4BA 1MX5A 1BCSA 2PSEA 3C6ZA 3U0VA 4G4IA 3DKRA 5EFZA 4MWTA 3OOSA 5D6OA 3GELA 1ZGCA 2XUGA 4AMZA 3R0VA 3QM1A 3C5VA 1UK6A 1TAHA 2JEYA 3STVA 4A16A 4A23A 3TJMA 1B6GA 2H1IA 3KXPA 3T4UA 3AFIA 2Y6VA 4H7DA 1R3DA 1XKTA 1YS1X 2WM2A 4GLBA 4QE3A 1MO2A 2BFNA 4X93A 4J0DA 4Q3OA 5FDFA 1Z68A 2RHTA 2WJ3A 4J0CA 2C5FA 3IULA 3VDXA 2HM7A 4DLNA 3GUUA 3QMMA 6YASA 1TK3A 5FPQA 4AN0A 1HQDA 2WJ6A 1QO9A 3W06A 4F60A 1QO7A 2J4FA 3AIKA 4OU5A 2PSJA 3ZI7A 4B7ZA 2K2QB 5DTJA 4BTLA 3I2HA 3IUJA 1H2ZA 3B5EA 1AX9A 1BU8A 1C4XA 4QWMA 3CXUA 1TCCA 4Q82A 3G7NA 2G5PA 4JNCA 1CVLA 2Z8ZA 5ALVA 1XROA 3ILSA 5DWDA 2Y2UA 5IVHA 3IBTA 5JD6A 4BVLA 1RWQA 2JGIA 3X3HA 4DMCA 2JGEA 4WDRA 1E5TA 5AK5A 1WM1A 5HZGA 4Y2SA 3STUA 4J3JA 3AZQA 4ZREA 5FPPA 1XRNA 4LKOA 4BP8A 5LIPA 1THTA 5A62A 2WIKA 1YAJA 4LHEA 4RNCA 5AOCA 4OYLA 1MNQA 4AO8A 5A7FA 5LZ7A 1XQWA 5AK6A 1L7RA 2XQKA 4E15A 3QVMA 3STXA 1YB6A 4PF1A 4DGQA 1EDEA 5BWBA 1EDDA 1THGA 2XDWA 4J03A 5ALYA 5HKAA 3TGLA 2XUHA 5FRDA 3P2MA 3WYDA 1HBJA 3AILA 2VT7A 3V9AA 1XZHA 2WU3A 4QDUA 4IH4A 3WKCA 1F8UA 1XQYA 4UHDA 3DYIA 1XZIA 4KJXA 3BF8A 1BN7A 3ESAA 4LXIA 3R3ZA 3JWEA 1QOZA 3G0CA 5A7HA 1CUVA 5CW2A 2CEKA 4BAZA 4FLEA 3WK8A 1EB9A 4OUKX 3WWCA 5AKJA 2GYVA 3HXKA 4DSAA 4X6XA 3VXKA 2VTVA 1E8DA 2J3QA 5K3FA 4W9RA 3KWFA 4A5SA 1AQLA 3UMJA 1Y37A 1AC5A 2VAVA 4AO6A 3EBLA 1QIJA 1L7AA 1ZICA 3C6XA 1ODSA 4UBLA 3I28A 3KDAA 1GQRA 5ALMA 2QUAA 1E8MA 5AKZA 4EY7A 2BCEA 3OTQA 3W04A 3CCCA 2XMSA 3GROA 2WUEA 3Q8WA 5AICA 4EY8A 4DIUA 2XUJA 5JANA 4PSCA 4H18A 4C6HA 3I1YA 5H3HA 5IVIA 3PI6A 1CIJA 2Y6UA 1SC9A 5ALRA 4BBZA 5K3CA 2R8BA 2GBGA 5IH7A 1CFJA 1ISPA 4QDOA 1WOMA 1MX9A 1K63A 3HRHA 3FSGA 4BRSA 5EIHA 1C7IA 5AK4A 2XMZA 4OB7A 3W05A 2X5XA 2XE4A 1D07A 5EI5A 3VKFA 1BEEA 1F0NA 1GZ7A 3F98A 1DX4A 5EHQA 2JGKA 4X00A 2H7YA 1UZAA 2WILA 4D9JA 1WHTA 1KU6A 5EHXA 1LPOA 4JH0A 2WHQA 3OG9A 4WDQA 2WIDA 4G8BA 3O0DA 4FLMA 4M0EA 1GXSA 4G8DA 3WIOA 4N8EA 2ORYA 5CT5A 1K5PA 4CCYB 1JJIA 4XX1A 1VLQA 2ECFA 4U2BA 3PF9A 3DEAA 3RARA 3TRDA 2VJDA 4CCWA 5AKYA 3VVLA 4H77A 4ZV9A 5CT6A 1HDEA 1IUPA 2GYUA 1GPNA 2OCGA 4B9EA 1X2EA 1QIDA 4NVRA 3QPAA 3I2IA 3FYUC 3NGMA 3E0XA 2DQZA 4JYPA 1CPYA 2YASA 4EA6A 3V1MA 4UFOA 2OAGA 3V1NA 1TCBA 4EY4A 1QFSA 1XZFA 5ALGA 4AQDA 2RGUA 4Y2VA 1QTIA 2BAGA 1XLWA 1CLEA 3NOXA 1G4HA 4G8CA 4B85A 1UK9A 4RPCA 5ALLA 4CIBA 4H7KA 1J06A 1QGED 2VEOA 1WB6A 4DTCA 2OGTA 5FKJA 3N2ZB 1ZI6A 2E3JA 5IVKA 5DNWA 3O9VA 4I3FA 1JT2A 5AJHA 3UUFA 4X97A 5CRIA 1Y7HA 5HQ3A 1FFBA 4V2IA 1GKKA 1NX9A 4QZVA 4EBBA 5FOQA 5ALZA 5EGNA 3U1TA 1ZGBA 1EXWA 3OPMA 2GBCA 5ALOA 1EX9A 4MWSA 4BAUA 2RHWA 1R88A 4G5XA 2HA6A 1LBSA 1VXRA 1CEXA 4Y2XA 4HZGA 5CT4A 1MU0A 1XZDA 2I3DA 2DHEA 2XQFA 2OXEA 3C45A 2JGMA 3O9MA 3H2GA 1CV2A 4B81A 3PFBA 3R3UA 1O6FA 4C89A 3D4LA 2DR0A 2WQZA 1XZEA 4X91A 4UUQA 2WFMA 4ZWNA 2B9VA 4M0MA 5DYYA 4ARAA 4U2FA 5C7YA 3H1AA 2XMRA 1QIEA 2WLSA 1AURA 2V96A 1MX1A 2PSDA 3K6KA 2QTBA 5C8XA 4Y2QA 3QBJA 2BUCA 2QXTA 3DKKA 1E66A 3I6YA 1S8OA 5CTAA 4BP9A 5AKGA 4Y2TA 3C87A 2QMQA 4X71A 3AJAA 4PNZA 4FHZA 2ACEA 1WPRA 1DWOA 5AOBA 1N5RA 2G5TA 5I8PA 1LZKA 5LZ8A 3GA7A 1UKAA 3G9TA 4EY5A 2CZQA 2GBIA 1MT3A 2FUKA 4C87A 4Y2YA 1IUOA 4B0OA 2RONA 1W6RA 3MGAA 4X6YA 3LIPA 2C4HA 1CUSA 2Y2VA 4FLFA 2DHCA 1BN6A 5LP1A 5BV7A 2QUBA 4KEAA 1CUCA 5CT9A 1DT5A 4L0CA 5DNVA 1PV1A 2WUGA 3RLIA 4C4YA 4CIAA 5HQ3B 1EB8A 5EIAA 4Y2UA 1GGVA 1LZLA 2X8BA 5AI4A 1FFAA 3O4GA 4GHWA 1QJ4A 1R9NA 3K2IA 1TCAA 3WK5A 3BDVA 4LYDA 4U2EA 2H7XA 2XMGA 4TPKA 3M83A 4KE6A 3LCRA 3I2FA 2B4KA 4Q1VA 5LKRA 5CMLA 2ZYHA 4FDMA 5AM1A 4AO7A 3C6YA 2XUAA 1YSCA 2WIGA 2HIHA 3C43A 4OB8A 2V98A 3RM3A 2XMQA 1ORVA 3OC0A 1ACLA 2YXPX 5HK8A 5ALEA 3G9UA 1CUIA 5AO9A 2XUDA 1MTZA 1VJ5A 5JAPA 4NZZA 2XMCA 3N0TA 1CUJA 3WL5A 1QIMA 3HABA 1FSSA 4QWWA 1MAAA 3WWOA 2PBLA 2WTNA 1JJFA 1U65A 4UHBA 5AI6A 4K6KA 1VOTA 5AHXA 4UBNA 2OPHA 4HRXA 4KAFA 4BDSA 1ZJ5A 5AI8A 4AZ3A 1FFEA 3IUMA 4ZXFA 4E14A 2GBFA 1VA5A 1ORWA 4BE9A 5SYMA 3EQ8A 3A6ZA 2PM8A 4FNGA 4H7FA 3D2CA 1HLGA 2ZJ7A 4Q3LA 4BE4A 2WJ4A 2OCLA 2R11A 3D5EA 2JGFA 1CUXA 2Z8XA 1YR2A 1E89A 1SCIA 1CUEA 2ROQA 2LIPA 5AP9A 1XZMA 4WFIA 3R3WA 1VE6A 5K3EA 3H17A 3H2HA 2JF0A 2CJPA 4F0JA 4P08A 4HTAA 5ALHA 4XJVA 4BTVA 4C88A 4YPVA 1CUFA 1JMYA 5I9IA 2WU4A 1U4NA 5HKBA 5D7BA 2V9ZA 3I1IA 4UBMA 3C6BA 3DQZA 3QZUA 4AN1A 1XZBA 5FUMA 3EQ7A 3SX4A 4INZA 1U8EA 1SOMA 1AMNA 2WG0A 4N5HX 1VXOA 1YS2X 5C81A 1GKLA 1JU4A 4DNQA 1QFMA 1DWPA 3DCNA 4BCBA 5ALTA 2WUDA 2ZJ6A 1EVEA 2ZYIA 4DYHA 3ESBA 4BATA 2PPLA 4FBLA 3LP5A 4YASA 4MXDA 4L3WA 5ALIA 5JALA 3H2IA 2ZSHA 3VJMA 4BZZA 1W52X 3DLTA 3SWWA 1Q0ZA 4YK7A 5JAOA 1ZIXA 1RYYA 3V1LA 1U2EA 3IURA 4G4GA 3QPCA 2QXUA 3ZV7A 1W1IA 4UBKA 4ROTA 4K2AA 2ZJFA 1A8QA 1QIHA 1HKHA 1YASA 4WFKA 2OQVA 4BVKA 4EZIA 4HS9A 5AI5A 1XZLA 3TEJA 2BGNA 4QDZA 1XRRA 2DSNA 4B9AA 5FP0A 1CUYA 2WIFA 2CUTA 3AINA 1T4MA 3ICVA 4BRZA 1UK8A 1J1IA 5AM4A 5HK9A 4B80A 3AZOA 4UBOA 5CXXA 5C8ZA 3BIWA 4GWLA 5ALKA 4Y2RA 4CG3A 2IITA 3ZLUA 5BOVA 3BDIA 2EDCA 2Y1KA
chains in the Genus database with same CATH superfamily
4QNMA 5J2UB 4AMVA 5LZ5A 3KHUA 2B94A 3JALB 4M0FA 3HKDB 3A0UA 2J5BA 2POQX 1Z6YA 1M2WA 2QZ9A 4Z1MA 1C9NA 2CMDA 2G5GX 3GGGA 3RU3A 2WSMA 3X2FA 4ESHA 2ISCA 1YNOA 3AIOA 2WVGA 4IIDA 1E3IA 3BXXA 1TF2A 4YP7A 3VR0A 4JLPA 4CJXA 4EGJA 5L3SA 4A0FA 1P4SA 3A1SA 3NI2A 5CDGA 5C37A 3LKZA 2E4UA 3OUTA 2Z5GA 3QP9A 5CA1B 1N2ZA 4DRZA 4TRJA 3BTOA 2D6FA 4X85A 2HDWA 2AQKA 4RSGA 3INYA 1B8VA 4TSRA 5EZYB 5K1ZA 4MEAA 1KYVA 3TGWA 1D4AA 3DMPA 5BT9A 1Z18A 2CLKB 2WP0A 4M8NE 1QU3A 3A9VA 5DCYA 1KK2A 5A5DA 2C7PA 1GIAA 3OH8A 4F85A 4BC0A 3I5MA 4CQJA 3HCNA 3R5KA 1U5BA 4OOEA 4WLVA 5IMSA 5DYTA 5HW0A 2IIPA 1SCKA 2PKYX 4M1EA 5LKAA 1JAIA 3KT6A 1Q2UA 3G9QA 3GFPA 1FU4A 3M3PA 3QYFA 4N7JA 4I4NA 1H8HA 5C5EA 2QVBA 1Y82A 1IZ0A 1O6GA 3K9GA 2B83A 1ZD2P 2XNDA 3MTQA 4TMWA 2ZW9A 4TV9A 3K53A 5IFLA 5T64A 4M55A 2H9YA 5HQJA 3T0IA 2H2WA 4R3UC 2YVUA 1GNVA 2DFNA 2GYWA 1OFUA 1T9HA 2D4AA 2PAFA 2YYSA 1UFVA 3HRKA 2B2XA 4I2VA 4LI3X 4HO1X 3ID6C 4BQQA 1OBFO 2ZRKA 1U1FA 2K6GA 2ADFA 4DCVA 3CZ4A 1DDIA 4L85A 4C05A 1IQPA 3FPSA 3FM9A 3GFGA 4B4KA 3D3EA 4BNGA 2UYCA 2LRHA 2GDZA 3Q7QA 3QVSA 4IY1A 5FTKA 3C7CB 2XIJA 4ZT7A 1YXMA 1SVMA 3ENZA 2OCKA 4RZHA 3RU9A 3UT6A 4WBNF 1UDRA 1XTRA 5LOVF 3X1XA 4FZVA 4U6NA 2DUNA 1DSSG 3KYBA 4TSFD 4L22A 2PH5A 4ZPXA 4GI2A 2NQ8A 4IX9A 1PX2A 1B73A 1F4PA 2RBGA 1NJSA 3VUFA 5FTLA 3W77A 2REXB 4DE5A 1HYQA 2R85A 4RV4A 3NBQA 3CLHA 4AKGA 3VC3A 4KPFC 5H9WA 4XSHA 5JCZA 1NNI1 3KR9A 4IZHA 2DHRA 1D6MA 2GN2A 2W7TA 3QKIA 1L5WA 1R8QA 2ECOA 1Z5ZA 4KLAA 2GVZC 2W6MA 4F91B 2HBRA 4H1HA 1JKFA 3EZ9A 3HN6A 4LJ8A 2F3PA 5JZ9A 1WDLA 4IR7A 5HX7A 5KUTA 4EUEA 1EK5A 3RKSA 5CH3A 4BY9E 4RHUA 4BCDA 3JAWB 3AY7A 2RGYA 3EXEB 1E0JA 1GZ4A 3O8DA 1XZGA 3O47A 1WOYA 1A88A 2EKQA 4HWTA 1U1IA 3HA5A 1ZMOA 4JEIA 4KIWA 4LYAA 4QOJA 3UAZA 4ENSA 5JAMA 1KHTA 4RYDA 4QELA 2RAUA 4XGNA 5FA6A 3SZOA 2OBMA 3H4MA 3INNA 3P9XA 3S6JA 4JLUA 4XDZA 2CE2X 4QATA 1YDFA 3FOWA 3NHLA 1Z3IX 4M6WA 5BNZA 5K8IA 1QTRA 3A9UA 1J0BA 1ZCBA 3DZBA 2RH9B 5IP5A 4UU7A 1KE1A 1Q20A 3DMTA 2YJTD 3LPLA 2R8XA 3I2KA 4H35A 4UMEA 1PW7A 2ZRFA 2BGLA 3UWKA 2HF9A 3L0CA 3I6ZA 1P31A 4O63O 1KEEA 3OWXA 1MC1A 4DIBA 2YVKA 3QKSB 2GH1A 4L9WA 1ZW6A 1L3CA 4I6JA 2EEZA 1TO6A 2GMWA 1DBVO 1IHPA 3UH0A 4C4AA 5K51A 2I78A 1V43A 3FUXA 1EA5A 1MB2A 2ZYTX 2P7IA 3HCWA 4ITVA 1UQTA 4WKPA 1IHYA 1Q1ZA 1S01A 3L1JA 2OZVA 1OH5A 3FTPA 1KORA 2Q46A 2I99A 3VSCA 1UL1X 2V5VA 1GTRA 1TZBA 3GOQA 3KZCA 3R3XA 4W9NA 2O50A 3X1YA 4BQFA 1I4OA 3L9XA 1IZ7A 6NULA 5I9LA 4J94A 5H02A 3LE8A 3NBZC 1ACJA 3M3DA 2IY7A 3ZBTA 5CAEA 3U39A 4EA7A 2WLTA 2NZYA 4M8SA 4KO3S 3HKEB 3JQ9C 3R8XA 3WIBA 3WL7A 1DE0A 1NLMA 2OYSA 2ENUA 3LLMA 4GVPA 2AJCA 5C34B 3GRVA 1L5HA 2XMPA 2XMDA 1C3OB 1NW8A 3BBLA 2P4EA 3D4OA 4GR5A 3Q88A 2WKWA 1X1DA 2D1TA 1D03A 4CHTA 3UIEA 1OYYA 4MULA 3V32A 2Q6OA 2M32A 3OU7A 4IW3B 3OA0A 1XCJA 1Z2DA 1H0SA 1L5KA 3ZXUB 3MPUA 1FDSA 2YFKA 6PFKA 5AVTA 5JEEA 1H4SA 2J0VA 4IHAA 1I10A 1YOVB 3NUZA 4HRAA 5AJUA 4ZYXA 2AJDA 1C5KA 1JI3A 2REOA 2XNCA 4GLOA 5SZKB 3F5SA 3GHYA 4IZIA 4CT4B 4B73A 1IMJA 1FK8A 5B36A 4KPEC 1FYVA 1E1MA 2L19A 3DEKA 1U3CA 1FUIA 1MUUA 2OORA 2FH5B 2PH3A 3HA7A 5MFPA 1O0BA 1NBME 2G72A 3QA9A 3HUTA 4J9VA 3GYBA 1D2HA 4BZQA 3ECCA 3QEJA 3Q3JB 4MWEA 3P71T 1PT7A 4DQKA 1HE2A 3DONA 3RIMA 3W1WA 4L07A 4ZAYA 1T8SA 4C0JA 4RTJA 4Y0VA 1AF7A 2C96A 4RV9A 4UDXX 3VDMA 4TS3A 2ZRIA 1JVSA 5K0TA 2HY7A 4S12A 5EIBC 2J31A 4DQDA 4MVJF 3TRIA 3EZ6A 4FMPA 4G63A 4XVCA 2QX6A 3JQBC 4XSVA 5BQ3A 4G1VA 1SUDA 2RGCA 4Z0PA 3AEKA 3QH4A 1LGYA 2FEWB 3PL1A 2I7XA 3FBWA 2EQ5A 4W99A 3TE6A 3WRVA 2XMBA 3RIYA 3ZOKA 4IM7A 3R5XA 3QYJA 4Y98A 2ZATA 4P7FA 2RKWA 3T9BA 5KOHB 4G56A 3C85A 2PD4A 4HB4A 4OAPA 5K3DA 4Q3KA 2G0NA 1SUBA 2BF7A 1QO0A 4YV0A 1LXCA 1QE3A 1FUEA 2J5KA 3KKEA 3WMGA 3LC2O 4BMYA 2VXYA 2WHEA 1TYBE 3RSLA 1JBEA 3PS9A 3WLEA 4MYSA 1QTQA 1FP7A 5HSGA 1MDBA 5B1YA 3V1TC 3WSVA 4C4ZA 1XZKA 3CLUD 1I80A 5H3CA 4BGDA 1JQ5A 4GXTA 4QVIA 4B5KA 2D13A 2B7BA 1BG6A 2YY7A 3QVWA 2Z8YA 3WNQA 4KQ2A 4QT4A 1M67A 1N4AA 4FGLA 3D7KA 1DMRA 2CNOA 3ZIDA 1QZUA 5J2TF 1A4XA 3TJRA 4F93B 3EA5A 3H1BA 2BOVA 1XCLA 3F0TA 2GFHA 1DKMA 4IUYA 5BURA 1GFZA 1ZOSA 2H9AA 2VDWB 3DXFA 3LWDA 4O5AA 3S2UA 3R9XB 2GVDC 2I54A 2K2WA 1CF9A 2C8KA 2OBXA 1N1GA 1X3SA 3ABRB 5JFOA 1RI3A 1BVRA 2ONYA 3MOGA 4YUVA 1U2GC 5BWLA 1U6KA 4GKKB 1YC5A 1M1UA 2J9XB 3P20A 1X0XA 3DO5A 2JCBA 4NCXA 4OHUA 4BAGA 4LG1A 3IH5A 3HO8A 4JU8A 1QLJA 3B60A 1LJ8A 1P74A 3LF1A 4WESB 4YJGA 5JCPA 1AQUA 5LC1A 3D64A 5KNDH 2O3QA 4NEQA 1E6LA 2E2WA 3B6EA 3LPNA 4L4UA 4PZZA 5EIFA 2H6EA 2R00A 4LSMA 2JFUA 5I8ZA 2PE5A 4LZWA 4RZXA 4AS3A 1F3OA 3N0WA 1K6EA 3ZXSA 3ZCVA 1NJ2A 2VHQA 2YW2A 3AFNA 4DNOA 2X5NA 3BFPA 1F8FA 2ZP1A 3OLQA 3H75A 4V0NA 3RSGA 1T5IA 5TXGA 3ZY2A 4BLTA 4PN3A 1B41A 4B87A 1RRVA 4BEJA 3VPSA 4KVZA 1DI0A 2PG3A 1Q83A 1SN7A 1FRVA 3QVJA 4PANA 3WQQA 3RSQA 4BNWA 4EUKA 1Z17A 1TE2A 1MV8A 2Z6QA 3GFSA 2ZUUA 2BM1A 1QQTA 3KQYA 4TTPA 5ECYA 3TQSA 3TIGA 2ZFUA 3ZW8A 4BUJA 4EMTA 4ZQGA 5I7VA 4HDCA 3GRYA 1KOJA 1QQ5A 4MP6A 5CDUA 5L95A 2E6UX 2CMFA 4DWOA 2FZ4A 2JJ8A 1FNMA 1UBCA 3ZX5A 1PD1A 4CU2A 1M6YA 1Z4QA 2QR5A 2WI8A 3HMKA 3UZUA 4MGEA 2JAWA 3L5KA 2J0QA 5IHPA 1CUHA 2BHNA 1SUFA 2HU5A 1WQ4A 4S0ZA 5AHWA 1G2OA 4O25A 4QYTA 2ZSDA 2EZUA 1PZEA 4F9FA 1HDIA 1NR7A 4LCEA 2VYCA 4XUDA 3QX9A 1DJMA 1GAEO 3PEVA 4XE5A 4PN7A 4WKOA 5TQ0B 5DMXA 3IJRA 4A10A 4BRUA 4F8YA 5K5EA 1A96A 1YCDA 2FQXA 1GAXA 1UODA 4UHCA 4UNSA 1TO2E 3PUIA 2QAGC 2UZ1B 4ZHQA 1F7VA 3M6MD 4NHOA 1XDWA 4G01B 4LECA 2X0NA 5REQA 1DDGA 4Q4LA 4ZVSA 3QPDA 5JNUA 1LRLA 4KR9A 4LXGA 4W5WA 1OJLA 1J4AA 5EPUA 2JLXA 2WTXA 3WYEA 2PVSA 3OLYA 1U1EA 2P6NA 4FKBA 1VBNA 2Q4EA 4YJKA 3OQVA 4EJSC 1JDUA 4EFLA 5G0TA 1Z29A 1EP9A 4RXUA 3V4OA 5DBFA 3CRQA 1E1DA 7ABPA 4MVCA 3BE8A 4MA0A 4BGUA 4Q7EA 2CE7A 2I1VB 2P77A 3X1JA 3ZNQA 1L3IA 2E6KA 2O0MA 3Q0EA 4YYZA 5HFNA 1SIWA 4LI0A 1KMNA 2HIMA 3MFQA 3PRHA 2EW1A 5FXMA 5EWJB 2NZ8A 3CRW1 2FEAA 1C9KA 3FYHA 2VJYA 4BC1A 2I2BA 3ZW9A 1W87A 3K6RA 3FSRA 2VP4A 4G0NA 2WKPA 3LY5A 2QTMA 3EF3A 2Z30A 4ZO7A 1CDZA 1X0VA 1KEZA 3D2BA 3OPYI 2XVMA 4MUGA 1NUUA 1N7HA 1XPOA 4ND1A 4EO7A 3M2TA 1SH7A 1F20A 2WAAA 3MAGA 5TEWA 4OFWA 2WTUA 5AI9A 5B6PA 1WD7A 2RH5A 3HZHA 5C46F 4RH1A 1OH6A 3VHXA 4CDGA 3TAHA 2J8ZA 3DC7A 5TDHA 5AOAA 1AVTA 4CNQA 1CQZA 4Y0NA 3FDFA 1CETA 3UJ9A 4LJ5A 4D4GA 1EFTA 4O0MA 4DM3A 1C0EA 3EEIA 1JKMA 1L7MA 5B1IA 1COWA 5A4KA 5K7SA 1H3NA 4MLCA 4U9IS 4PBRA 3OQBA 4DLRA 2A9KA 5FTWA 2PZJA 3H86A 5FA8A 3PT5A 3V4LA 3LF2A 1ODJA 2MSWA 2XTMA 5B7NA 1FP1D 1Q7GA 2J46A 2QD4A 4A2PA 3TRJA 1TJ4A 4EUFA 4GZ5A 4RVUA 3L7IA 4D98A 2IOFK 2JPDA 4RPKA 4UDYX 5H3LA 1QRSA 3MMXA 4RQUA 4Z9BA 3A2LA 4IGKA 4Q6WA 3KIPA 3OFVA 2P9ZA 1W48A 3GARA 1T2EA 1UUFA 5JYDA 1RU3A 4B2LA 1ZH0A 2IQ5A 3MB8A 3AKYA 5JYCA 4G0VA 3JQQA 1TK2A 1QUEA 4LZLA 5IS2A 1NC1A 1WCIB 1L8XA 2NUBA 1NNSA 5FWXA 5HFAA 1ODCA 4NATA 3MWLA 2G6TA 2GFIA 2P41A 4ZAXA 2Z6UA 2JLSA 3SZUA 5DBEX 1MQ8B 4RE5A 4EGCB 1YL5A 3V4FA 4Z7NB 5KJEA 5F9HA 1CWUA 1JE0A 1P44A 3UWSA 1EA7A 1JL3A 3HBAA 4F1KA 2C97A 1X15A 3H9GA 3SD7A 3BMNB 4F3TA 1N2XA 2IODA 4O2BF 3CUEF 3O1JC 1ZJ6A 4I5DA 4BB6A 3HNRA 2QJRA 2C84A 4I8DA 4G09A 1ZSVA 1EWQA 5I3ZA 1IEXA 2YJ3A 1W25A 4E03A 5KHOC 3UHOA 3JSXA 3PRKE 1PHPA 3LWZA 3DBIA 2V5UA 3NTOA 3ZHBA 5BNTA 3JD0A 1X1RA 5K6RA 3CG4A 4N6OA 3BWBA 1LK0A 1A2KC 1UOQA 3A1WA 4U2CA 3TLKA 1JFFB 4CBVA 1EHIA 2P5YA 2AYXA 1YRBA 2AVNA 3GBSA 1BEZA 1AS3A 1MEJA 1QR2A 4CIYA 1GCAA 3RYFA 3R74A 3S2ZA 2QT0A 2ZJ5A 1XMPA 4Q24A 1Z35A 3IV6A 4JJKA 5E4FA 1UK7A 5LQJA 2R6R1 3BC1A 3M70A 4UXIA 1KA9H 3QUCA 3PPWA 3FCYA 1UKVY 1E9DA 3LXMA 3Q2KA 1OZGA 2Q49A 4U8GA 2BFEA 2Q6KA 2QYSA 4TLCA 4AY5A 3HB5X 3VR2A 5A9SA 2PLAA 2QX4A 2B5VA 2FWIA 3INRA 2I7VA 3ELWA 5EP1A 5HF8A 4F6LA 1EFRA 4EKEA 3AKCA 3KG2A 2OXIA 1APBA 2WY2D 5JMTA 1H6BA 1FF9A 5CM9C 4EKNB 3GRKA 4HN4B 1T3HA 3EUWA 4MS3B 2PA3A 1GCGA 2XTNA 4YRKA 2H1HA 3BHMA 5COAA 5KQSA 4OI0A 1SKBA 3WB0A 4QG7A 3HDQA 2IC5A 1T9BA 3GEMA 1ZFNA 3AIIA 3PE3A 3VOSA 4ZHQF 3W7BA 2BM0A 3QIVA 1IPEA 2IPAB 4Q9HA 1EFHA 1KS9A 1U9JA 4RIGA 3I2GA 2V7XA 2UVQA 3QE4A 1RXSA 4JGBA 4QVGA 3RRYA 2BZGA 1MAHA 2CB9A 3AXTA 4REMA 3RVQA 5FBWB 4AJ2A 3T5PA 1UM9A 4Z0NA 5JD4A 2CVZA 2O2IA 3RIGA 1WKBA 1R0RE 2IDKA 1WCYA 2DFPA 2D2FA 1WW2A 3P9QA 3V4VB 3V8QA 4YWHA 3WOHA 1H2BA 4BJ5A 3WQHA 3G1TA 4DG5A 3RK4A 2HHHB 1KJ9A 5FH9A 1JIQA 1EJ0A 1W4AA 2ZREA 4X3CA 4GXNA 3PG5A 1AU9A 3B1XA 1FNCA 5EOVA 2QSZA 2ZR0A 4J07A 3ZLVA 5IM4F 2ZWMA 4DLWA 2PZBA 4IAOA 1JWBB 4UQOA 3ZVMA 3I8SA 4G5RA 4H6PA 5CK5A 2PKXA 2VJBA 3G3EA 2ZSIA 3CXRA 3GFTA 4MB2A 1TA9A 1GSOA 4J1TA 5EZSA 4IIEA 3A2MA 3KSZO 5SYNA 3IIIA 2AFRA 2HYDA 3I0NA 1DUVG 4HKTA 3WL4A 2EFYA 5M29A 1NASA 2ES4A 3PC8A 1SQSA 1C7EA 2F1RA 4I6EA 4BLVA 4JXZA 2BFPA 2PX6A 5JBQA 1IEWA 5JAHA 2XAUA 4LE0A 4YRZA 5IT4A 3E2MA 3FGNA 1SXHA 1ZOIA 3ZJVA 2VUUA 5F51A 1QDLB 2FX3A 3L43A 3NG1A 2QK4A 2QSJA 3LS2A 2I71A 3M5PA 4GI3A 3BIXA 4DLXA 2BWJA 3C41J 3A2NA 4WBXC 5J59A 2O8FB 1QYVA 3VHLB 4DG9A 3DS8A 5AJXA 3K30A 4LYEA 3EIOA 3COWA 4NYJR 4B40A 4MUEA 1IN6A 3BB4A 1EG2A 2PEYA 2V7PA 4WACA 3RVOA 4FGJA 4X66B 1EVYA 3GNLA 2A5FA 2NSLA 1V7QA 1MPTA 3EHDA 4F2HA 4C29A 3CF6R 1E2KA 1BJTA 1BS9A 3CW9A 4JKYA 3I9V6 5ALUA 2C2WA 4CR8A 4UHKA 1UEIA 4QUBA 2KI5A 4ZZ3A 4JL5A 1O57A 4DLTA 3A3KA 1Y48E 3B78A 3DDWA 4O02B 4QOFA 2XZDA 5GIPE 4EW1A 1LLFA 1SA0A 4O4JF 1D0SA 1MB3A 4J0EA 1N92A 1LU9A 2A84A 5FQNA 3MWJA 1P9RA 4LDQA 5TSDA 4BLPA 2BEVB 2IF0A 4WJLA 2RK3A 5EMHA 2C9ZA 3PNSA 1AD2A 3QVOA 5JNTA 4L72A 1I3NA 2I8LA 1O9HA 3KT0A 5MDHA 2ZDQA 1X8LA 3LQ4A 2FPUA 3PGKA 4MUKA 4EVIA 3GOHA 5IJAA 1PF7E 1UKCA 3G0BA 3F5DA 5FR1A 3MYYA 4QIHA 3FIJA 4IIYA 3A70A 3EZFA 3HH8A 4CLOA 1UQRA 1MO3A 2CNWD 1M6HA 2K4MA 2V65A 1IG3A 2ERXA 3BL6A 3OFNA 4FS8A 5E2IA 5E7QA 5FJJA 4D1YA 1N2JA 3LIIA 4JEUA 2F55A 4F21A 2GD2A 4PIMA 1FFWA 2VTBA 5GGYA 1DJNA 1H6CA 4CL0A 1PFGA 4MAMA 5JNVA 4H3VA 4TXJA 1NKVA 2WJPA 2X6TA 1XDSA 3FR8A 4GMXA 4NYIR 4RPIA 2XA2A 4AX8A 4ENVA 4BECA 1T5SA 5JT1A 4XKJA 1N9ZA 4MVJD 3K1ZA 5DW0A 3TECE 2FR8C 4WK0B 4PPQA 1X8KA 3GG2A 3G89A 2PS3A 3E1GA 3OECA 2XB6A 1ZUD1 3KT8A 2EX0A 3OI7A 4ZO4A 1M34E 2ASEA 3HCDA 5A7GA 1A5BB 3DEZA 3UOWA 1CDEA 1JA0A 2I6FA 3QEKA 4G4JA 1EDZA 4G0QA 3N86A 1RAHA 3GQBB 2VF5X 1YOVA 2BKUA 2HXGA 5KBYA 1OIXA 2VDKB 4MEBA 1L4FA 2R8YA 5FOWA 3GRAA 3JAWA 3ZPXA 1J9GA 2QM0A 3GU3A 3PXAA 3JAMA 4QQNA 4FKMA 1DGQA 5IUNC 4BKUA 3U4GA 4YCLA 4CM6A 1ND6A 2A3NA 3AVQA 2YR0A 2HU7A 2GAOA 4OBBA 4H1VA 5KINB 1T13A 3S2GA 5AW5A 4ZYZA 1OILA 1I6WA 3DKPA 4RJKA 4J1QA 2G8LA 2WOJA 1RYFA 2GEKA 5D3MB 4F6CA 2X3UA 1GNRA 1ZX1A 4YY3B 2IYVA 1JALA 1E2DA 1M33A 4DPMA 4RDXA 3I9LA 3OFJA 1P1FA 2HA4A 2HQBA 4PNHA 2WPDD 3FLBA 1NUQA 3AFMA 3TR6A 3U4HA 4OUDB 1BE0A 3NDRA 4C7MA 3LAWA 2CXXA 1EPUA 5CLGA 3OTOB 4K05A 5EFOA 4M9UA 1QZ3A 1ZNYA 2QUKA 1ID8A 3AOGA 2Z5LA 4WJKB 1AV7A 1DC7A 5I5GA 1QAQA 3HB9A 1G291 2OO5C 3FWNA 5KMGA 3QI7A 4QHYA 2RG7A 3IQXA 4G65A 4JFAA 1TVCA 5E9WA 3SC3A 3ZZTA 4DY4A 2O19A 1NWHA 1P1RA 3GLTA 3NETA 3OMXA 1DOZA 5DRYA 2GRAA 5B2ZA 4D96A 4ER6A 1BMDA 1NRJB 3FYTA 4UQPA 1T0IA 1X1TA 3AERB 3SQMA 3OKFA 2ODAA 3SYRA 4I08A 1D4FA 1CG6A 2G9NA 3CVOA 3EFOB 4PG5A 5BYJA 1T4CA 3B3AA 4KQ9A 4WERA 5G0SA 1AKNA 1ZUHA 3DVAB 3SKXA 2C1ZA 3QLEA 2XA9A 3UAWA 2CJXA 4KZPA 4ROSA 3TCNA 3CEHA 3OPNA 5ERYA 4D97A 2W8BA 5HCIA 3GWZA 4M7RA 5AK3A 4GBGA 4KE8A 1T8PA 2FWJA 1JYFA 4HQ6A 3F6CA 8GPBA 5LZ9A 3JYNA 1FXUA 3T7DA 1WB9A 1OX6A 4R1MA 2ZJBA 3AL0C 1SVIA 1BXRA 5JYEA 3QFTA 3VR5A 4BNNA 2HBYA 1NUAA 1UFRA 3BGOS 2A4MA 2AFIE 4BBJA 3QVTA 1QK5A 1II8A 1TA0A 3SJBA 4NMHA 4Z86A 4CI9A 1MXFA 1M8KA 4NF2A 1CZHA 1JILA 1L7PA 1JDJA 3JATB 3S2IA 5TVGA 3KFLA 2E48A 2RH4A 4K9RA 4V0SA 2FHSA 4H3KB 2VHTA 1GT6A 1GPWB 4G24A 2JHPA 3GMIA 4FBMA 4C30A 5HUHA 4KN6A 4Z9AA 4ARIA 3FDJA 5IAGA 4B43A 1O3YA 3VPFA 1KTVA 4MJ7A 5EIEA 3MA0A 1NJ1A 4J1SA 2EZ8A 1G5IA 1XVUA 1SU4A 4EJ2A 5IXSA 1RHUA 3FD8A 1PWEA 4C21A 4O4HA 4NS4A 5EY5B 4CG2A 1IZ9A 5CFLA 4BWGA 2IGBA 4JROA 5AM0A 1OZAA 2VQ6A 2I1QA 4MVJI 2FJUA 4XLTA 1HDRA 5AH0A 3UJNA 2A4KA 2JCGA 3KYDA 4PX9A 4QPCA 2JIPA 1L7XA 3IDOA 4CGZA 3LPAA 2PQ0A 1GRNA 3Q6NA 4K6FA 3CTMA 2VTBB 3WAKA 2J59A 3FCAA 3IPLA 4HDNA 1JGTA 4KRYA 1MGPA 1K66A 1GNQA 2VDRB 3O3NB 4Q0MA 2GZSA 1E2PA 1S6YA 3T7RA 5AOVA 4I1YA 1SVOA 4HWKA 5DHSA 1ZLYA 5EQFA 3KJQA 3JQAD 1IDOA 1V8DA 4MO2A 2BGMA 3F6BX 1Z0KA 1VL1A 2PZGA 3QBDA 4OYRA 4B82A 5IWAB 3IAFA 2QPOA 4URWR 2VDQB 3SN6A 1DO2A 4AF8A 1N2CE 3ZC3A 5JQGB 2Z04A 2Y92A 3PNQA 3V7WA 1Q17A 2R62A 1VJRA 3C3WA 1DXHA 4WZ6A 4HAOA 1UXKA 4TL6A 2KM1A 4Y2VA 3BQ9A 4BXOB 1AB5A 2W2QA 1XRMA 2DQYA 3BCRA 3PQEA 4ZTZB 1P9LA 5LSAA 3WAGA 1CNEA 4DT1B 4RAOA 3A4TA 3C70A 1U3TA 3KSRA 5CA1A 3AF1A 4C5CA 1B8NA 4KVAA 1P2TA 3NBUA 4XX0A 1KJZA 3BSFA 4J9UE 2D7JA 3KKNA 1A95A 4OJMX 5K2MA 1GPYA 3EGOA 3WIUA 5K3FB 4D9IA 5DX8A 1EI9A 2Q6LA 4MV7A 1K86A 1WXQA 1GU1A 5CP8A 3SQXA 4GZMA 4L8LA 2ZWVA 4Z4HA 1Z62A 4XIIA 2NSHA 1U3UA 3GBPA 4O4HB 1FYDA 1P3Y1 2HCFA 1WA5A 3DZFA 5KHLB 3BXEA 4HJXA 1UAYA 1PUIA 2Z1MA 3JYHA 1LPSA 3LT4A 1Z15A 4GR9A 3ADKA 1O6ZA 3LL7A 3LY7A 1AHIA 1ZR4A 3A8TA 2X1VA 4OMUA 4AT1A 3NEYA 3N7UA 2JRCA 3ESCA 3EVZA 3SC4A 1XIVA 1Y8CA 1U9IC 4C3OB 3QELB 3C1UA 5B4VA 1DTWB 2DF8A 4UBJA 4RA9A 2DBYA 3LY9A 5J58A 2I87A 2A1UA 2OXFA 4QUAA 2WTAA 2CVPA 2H4ZA 3ADOA 4Q48A 2QPTA 3ANYB 3HN2A 4PM4A 5PNTA 3SDSA 2JFZA 1DQSA 5IXJA 3FHOA 5LLSA 3DUWA 4CMHA 4D8VA 1TVMA 4FZRA 4R1LA 1F9EA 2PIAA 2GBLC 3ND7A 2X0KA 3MS2A 4HRVA 1J33A 3NIFB 3GVCA 2MR6A 2YL2A 4A8JA 2BR3A 2JD1A 4N65A 1NE7A 3K1AB 4HQFA 1J2EA 2V7WA 3MUNA 4MRMA 4BWVA 2GPNA 2J3EA 2CNNA 4KODA 2HCBA 3QHAA 1GD1O 2PGNA 3TE7A 3DT9A 3ZNNA 1C1XB 1JHZA 1MA3A 1H9AA 1KAMA 1T0PA 2G70A 3IP5A 3SDBA 4BJ1A 5A4JA 2IOQA 2YN2A 5D3KA 4O1HA 3PQ2A 3T8YA 2NVOA 4KR2A 4CF4A 1N9KA 2XYPA 4GBJA 2WIAA 2ZB8A 2ZB4A 1SD5A 1NOJA 4PSDA 5F2OA 2FE4A 4ALJA 3HR7A 2PR2A 3S2EA 3F3KA 1HFKA 1CP3A 1L4GA 2OVBA 3CPEA 3OY2A 1YA8A 1U1GA 3P9IA 2ZAIA 4UVDA 4BMVA 4KYIB 4TXLA 4YMGA 4PRLA 1BW9B 1JG6A 2XZTA 3EDMA 4WEOA 4QEDA 5IJ9A 5DGHA 3M3HA 1F2DA 2I29A 3PDCA 2C3PA 2W2VA 3LVBA 3NR2A 4IXTA 4CG1A 2QP3A 5I6DA 3MHTA 1YRYE 4RJ2A 3T5AA 2OKCA 4DC1A 4TYYA 3BHIA 1TMGE 3E3AA 4PO8A 3UNXA 4CE6A 3OCUA 3UJ6A 2OD9A 5E4YA 2WQ6A 1TF7A 3C5HA 4K03A 4PZPA 2F64A 3SIPA 5IKMA 3KJXA 2PT9A 2D1QA 2B20A 3H19A 1P3DA 3IILA 3TI7A 3FNGA 1P17A 4KXNA 4U7PB 2Y1FA 3KETA 3RTCA 2QZJA 2V7EA 4EJMA 2GB4A 1IE3A 1FFXB 3QUSA 3OOYA 3A4IA 2YNMA 3L5OA 4AKSA 3FHLA 5AUQA 2ZXUA 4TRMA 2ETVA 5CX4A 4ALNA 3VJKA 3NJ8A 2QAIA 5EJ9A 4HY3A 4GR4A 4EI8A 1X8JA 3VH1A 1SUCA 1X2BA 4JB2A 2JNWA 3N9IA 2RGEA 5DYNA 3KEMA 5JG7A 4D3XA 2VHUA 4RABA 2BJWA 3NAMA 3UV7A 2YUIA 5K8CA 1YI1A 5KX5A 2NO5A 5KAMA 1KY2A 1TYZA 3DHYA 4LRQA 1RYMA 2CLFB 2O48X 1UXOA 4PW0A 1TUGA 4KFTA 4BFCA 5CR9A 3SBXA 2V7TA 1BSVA 3PUHA 4MVWA 4CNBA 3M82A 3DE4X 4OCZA 4Y18A 1UPTA 1KQ3A 3C5WP 3G6WA 4DMFA 4IFBA 4J49A 3A9SA 1UMCB 4WZAB 3AUUA 4ETWA 3SVTA 5JRDS 2V7QA 4L5CA 4YJ3B 2PX5A 3DTVB 4HB3A 2C9OA 4GYWA 2O8CA 1GDTA 4I4CA 2Z8YM 2W6JA 4QOSA 4A26A 1BS1A 1QYIA 2IXTA 2YQ5A 7YASA 1GQYA 1NKSA 3Q7RA 4MS3A 4RZ3A 5HPYB 1H6DA 3Q7IA 1E3MA 3VR5H 5EE1A 5EJ2A 1AG9A 3O7MA 3X1ZA 1HGXA 2O5EA 4IGFA 4MKFA 4P36A 4CQMB 2BFCA 2I3GA 5EUMA 1WXXA 3E7FA 1DO0A 2VPTA 1RZRD 1U8ZA 2HF2A 2ORWA 4K9OA 1FW8A 4N6GA 3RS3A 3A1CA 1FFXA 1P7PA 3DNMA 4J0HA 3VH4A 2RBEA 4MCJA 1L4KA 4N3NA 4GPD1 4BEVA 5KB3A 2OGWA 3KKPA 1B6RA 4M1YA 4I1OA 4Q3BA 2C57A 5KHAA 8ATCA 4Z3OA 2C61A 1S96A 4XYBA 1N77A 1I5OA 4HLDA 4LE1A 2VQSA 5I7EA 2SKEA 5IJWA 1BOFA 2PGJA 4BDTA 3R20A 1SM4A 1NI4A 3C15C 4UUAA 1M83A 3UHAA 1P91A 3H1PA 1CR2A 5BNFA 1W4ZA 2V7VA 4IIUA 4Y1GA 5BW5A 2OOKA 2CDCA 2XI4A 1JG4A 5BN3A 1SBYA 3ZE6A 2HFKA 1XVLA 2D2VA 5EHGA 2W2XA 1JDNA 3WGYA 4NG4A 3EH1A 4P31A 2ZYRA 4FU0A 1M6VA 2C2YA 3ISJA 3KP1A 4TOIA 4BVAA 1E98A 4EI2A 2O8BB 1CUAA 3O2QB 4JK3A 1YK0A 1GZ3A 3WK7A 2IS1A 4AN4A 4P33A 2BMDA 4MQLA 1M2OB 3ONWA 2JGJA 2R60A 4U6QA 1PR3A 4HH4A 1VMDA 2XDYA 5CH5A 4LJRA 3EB9A 3B1KA 2OV8A 2R7AA 3LHKA 3Q9UA 2YWEA 5TPWB 3JAKB 3N1UA 2DKOA 3AU9A 4PRYA 1PDWA 1MRNA 1YJCA 1YQEA 1HZJA 2P62A 1RLIA 2WNIA 2P0EA 2XQJA 5HDQA 3Q5EA 4EYEA 4E5UA 4ND8B 5LOVA 1P0MA 2FOLA 1AQ6A 3HFRA 3UB2A 5E3HA 3THYA 2BYTA 2W43A 4E1BA 4K0KB 2D62A 1E92A 1HV8A 2JAUA 4ZCTA 1Z4NA 4Z4IA 4UASA 3T3GA 3UCEA 1RKUA 2PUFA 2RIPA 2PUDA 3CEAA 4RJLA 1W9HA 2EERA 4H2DA 1SR8A 4JYAB 3VA7A 3COYA 3R0XA 3V8PA 1XEWY 4WCDA 5E6UB 4Q7LA 3WRXA 5KNCD 3IQWA 1A8HA 2F48A 3U0VA 1GDHA 3FETA 3QOFA 4XRRA 2PRIA 4BFZA 4M1MA 2ODWA 3BHNA 3ETNA 1AF4A 2FSHA 3KTAB 4LX8A 5KTSA 2Y93A 4Z9FA 4ZVLA 2LV8A 1WU8A 4FYIA 5CXSA 4C4OA 2A9FA 5HZHA 4TZ0A 3ER8A 3UXEA 2B92A 3OQIB 3SEFA 1WUKS 3T1HB 3VKWA 1KO4A 4XRGA 3LM8A 1HYEA 2R84A 4NWIA 4YRTA 2CL5A 3CMCO 2PTHA 2JKVA 1ZGCA 3SC2B 4AMZA 3IAHA 1P72A 4YIHA 2FP4A 2F8TA 1X7XA 4EG3A 5JS8A 1ZC3A 3LO8A 1GSIA 3WGMA 1C8LA 1A4UA 1Q1GA 1WTAA 3L8EA 4EW6A 1FRNA 3AEQB 1EUDB 3I5AA 3JRXA 3Q7TA 4ND6A 3PL5A 3CLSD 1D2EA 1YE5A 4BU1A 2C7OA 2HT6A 4MP8A 1E64A 2QTNA 5G3ZA 1GPAA 3RCBA 3OU6A 4YCJA 5BSWA 2H1IA 2WJWA 3HJAA 3AFIA 1GUZA 1PJBA 2Y6VA 4JYCA 4H7DA 1R3DA 2CL7X 3W8FA 5FPSA 3D4BA 2BSAA 3AR5A 2M6KA 3M33A 3TLGA 1YS1X 1CVRA 5TE9A 1E5XA 1G17A 5D5HA 5L53A 4GLBA 3LBAA 4GOLD 2ZBRA 3DPUA 3K5PA 4JJIA 4OJKA 5LYJA 3R9IA 9LDTA 4YR9A 3V7NA 4A8JC 3B70A 3KE9A 5K99A 4CF6A 5KEIA 4FYHA 1BCSB 3HZZA 4U7GA 2YS7A 2QN2A 4J0DA 3ZGZA 2F1HA 1J56A 1LS1A 4YAKA 2RHTA 4JZYA 3N8NA 1AN9A 3TZHA 1T6YA 3IULA 3DL0A 2CSUA 2HM7A 4NNOA 4UTZA 4DIDA 4AJPA 1TQ6A 3EG5A 4NJOA 4DPKA 4PCUA 2ANCA 1V6AA 3GUUA 3QMMA 4BFSA 4I8XA 1L5ZA 1TK3A 4L1KA 3LOQA 4NY1A 3DCIA 1PJRA 1JLLA 3DMNA 4YJHA 2WJ6A 1QO9A 1U80A 1W8DA 3K9CA 3W06A 1Z5PA 2J4FA 4YUZA 1W34A 2Q5JA 3AIKA 1PGPA 2J08A 3IS3A 2VK2A 2AEMA 2ZI9A 5IBRA 3MSXA 3KQWA 3QLTA 3TVTA 1VGQA 5H8WA 4BTLA 2H0RA 3RE1A 2X41A 3N5KA 4WZBA 4JYZA 2FV8A 4HNGA 1L5FA 5KYYA 3A36A 4H4DA 1H2ZA 4AJEA 1PEDA 1K3UB 3U7QB 2G06A 3ZQUA 1JG2A 5CIWA 5LWQA 1ECPA 2PT7A 1P1CA 2Y71A 2NTNA 4Q37A 4YP0A 4QTYA 2QMEA 2ZRDA 3RANA 4BBAA 1REQA 3EXIB 5HHTA 1OLOA 4KFCA 3OE7A 1I4DD 1XDUA 4UKDA 2Z8ZA 4YJ2B 4KPYA 4DM4A 1EESA 3NHZA 3CISA 2QJFA 5DWDA 2Y2UA 4QPJC 3PVCA 2GZ1A 5KTOA 4AUMA 1KBZA 4XVHA 2JHFA 4QXAA 5L7TA 5CVUA 4G41A 4M9CA 3H11B 3M4JA 3NTXA 3HVJA 2LNDA 4C7KA 5JD6A 1UC9A 2JFPA 2P4SA 3X3HA 4CYMA 1ENOA 4BNVA 1NQAO 2JGEA 2WYWA 2ZQYA 3OTIA 3TZQA 4DJTA 3LQ2A 1E5TA 3I3OA 4KQFA 3IUSA 4LRYA 121PA 1WHTB 3C6QA 1RZVA 2DECA 2ZUSA 1V2HE 3IUPA 4J6EA 4KUGA 4M8KA 1PFUA 4N40A 1E2IA 4TTAA 5HZGA 4MHTA 1KWGA 5MF6A 3OKCA 4G0XA 4MV0A 2YRXA 1KYWA 2OWEA 4M38A 2R7LA 4EHJA 4QU9A 3S81A 3GLRA 2OHXA 2QN7A 1UBKS 4Z8XA 3AQ4A 3RYFB 1TZKA 3I9V1 5DI3A 1MBZA 1KSFX 1OYVA 3I64A 4F8JA 8ABPA 1R4MB 1THTA 2PEZA 3T7EA 3D0OA 4WOKA 5SZIA 4BQRA 3NCTA 4ZVUA 2YDYA 5JNWA 3PZBA 4ZAWA 2HIGA 2ZBDA 2G0TA 5H9VA 5INTA 2QTTA 4RNCA 3WG9A 5AOCA 3M9XA 1CZOA 5FI0B 2QRQA 3IXLA 4WBNB 1U2GA 4FDUA 5A7FA 3KSAC 5DWQA 4TVBA 1E62A 2GUGA 2J33A 1RKXA 4OI2A 5EZYA 1W5TA 1DOHA 2OAQ1 2QAGB 2QF7A 3X1KA 4ZN6A 3PGMA 1GPUA 3FYSA 1RCUA 1YB6A 1NFFA 2R3SA 2ZS7A 3MBOA 4OQZA 4PF1A 3FB4A 1V8OA 4GBMA 2PBZA 2Y67A 1JEEA 4HGPA 1THGA 3CKLA 4J03A 1JSRA 4X60A 1SD1A 3KB1A 2I6TA 1A9RA 3FVQA 5FRDA 3VTFA 1RMYA 4G4SP 2CLHB 3A1NA 1ZRNA 3IB6A 3BTSA 3CKYA 1SQ0A 3V9AA 5DBOA 2CMGA 3IVAA 1SMKA 4Y2HA 2WABA 3L2OB 1XBTA 4QDUA 1TD1A 3ITDA 3T9AA 1G3MA 3AUFA 3OQPA 4R9UC 4MI1A 1JEYB 3UT5B 1F1JA 1ZRSA 4PS1A 2YV5A 3PLRA 3JASA 4DF3A 3ETGA 4AY2A 4RCYA 4H59A 1Q92A 2EFGA 3V6MA 3N8DA 3KEOA 4KJXA 1BN7A 1JIVA 4K6MA 4Q01A 4YXFA 2OHJA 1P4RA 2JW5A 2QVXX 2OP0A 4GOJA 4MS1A 2X9NA 4LXIA 3R3ZA 1W5EA 2ZCUA 1FQKA 4N7BA 1K4KA 3QPWA 5EMKA 5JD3A 1ZD8A 4E22A 1F2VA 2DUUA 3HHEA 4QDJA 1JQDA 4G36A 3QEAZ 5CW2A 4AXXA 5WRFA 3ZW7A 3M7IA 2CEKA 4RTPA 2XD4A 3WWCA 1EB9A 3K0AB 2P6MA 1KGDA 5AKJA 3FTEA 1VI6A 5KCMA 5LYJF 1OU0A 4EGSA 1JHRA 2NTVA 5A5FA 4MRRA 4X44A 3HXKA 1VE1A 1CK4A 4DSAA 2BH9A 2Y9PB 3U4AA 1ECGA 2ZEJA 3H2YA 1HDYA 2P2YA 7AT1A 1NFRA 2PO7A 3IAS6 1U1DA 2XGGA 3BA6A 3VR6D 5IZCA 1IBMB 1NYRA 3DYBA 4HLUA 1FW6A 1C2YA 2GJAA 4OF4A 2BEWB 3VVCA 8AT1A 3B7GA 2Q3CA 3LRPA 3OBIA 2K7FA 2AEJA 5DCWA 4G0WA 2YY5A 1GZDA 2EW2A 2BPOA 5EJ8A 1VIAA 3KJFA 5G53C 3S68A 4UARA 1AQIA 1IHOA 3HDYA 3W34A 3U49A 1E6EA 1VG1A 4FT2A 2JJ1D 2UUOA 1ODSA 2JK0A 3M6FA 4GFDA 2QJOA 1KP9A 1Q1QA 4TV9B 5HGJA 1OGJA 2V45A 4DCJA 2V8OA 1R4NA 1URPA 2HBQA 3D3WB 4NLLA 3T38A 4R2XA 3OPQA 3DOJA 1E8MA 5JV5A 3FVWA 2HRBA 3NVAA 2I1LA 5AKZA 3V5NA 3HU5A 4X1IB 5G1PA 1B93A 3IAS1 3MC1A 5HBRA 3W04A 2JLZA 5REQB 2BMEA 1H42A 1M6WA 3EXIA 5FBQB 4KN5A 3C4VA 1Z5UA 3Q8WA 3RBZA 1GFWA 3SJUA 2HQRA 3UJ3X 1D4ZA 4GQAA 4F72A 2A5JA 5KQMA 2XR1A 4EY8A 3AMVA 1TKAA 1XN1A 3BKXA 3ED5A 3I9MA 3IEUA 2Z95A 4KRFA 1PJQA 1SUIA 2G4CA 4H31A 4JWTA 4XGKA 3R09A 3C8ZA 4E70A 9LDBA 5EZYF 3UMYA 3D7MA 4EUNA 3H5VA 3RSZA 1WV1A 3T7JA 4YPOA 2IDJA 5DOZA 1YQUA 4JBIA 2FLKA 3RYHB 1QHGA 3GDHA 4KV7A 4RS4A 3I1YA 5IVIA 1Z2PX 3UFXB 2IUFA 3PI6A 3BOSA 1MIHA 5TT1A 2Y6UA 3K6SB 4MRVA 4BBZA 5JUWA 1A71A 3B1VA 1VM6A 8ADHA 2GCPA 1R12A 3RTEA 4JI4B 1ZZEA 2BR5A 3EHEA 5JE8A 3SOPA 2ZSAA 4BASA 4YMVA 2ZRQA 1B15A 3MYRA 2BFEB 1W36B 3IIMA 1CFJA 2J9GA 1B6TA 4WQMA 2OP1A 1A04A 1ISPA 4MWDA 3NBKA 1QGAA 1WOMA 2F62A 4JBYA 3ACBA 3KYCA 4EHDA 1IXSB 4TQGA 2BV3A 5IJZA 4C43A 1R4NB 4ZICA 3HRHA 3FSGA 3ZXYA 4BX0A 1GUDA 3EFBA 3U4MA 1OWNA 3CX6A 5AK4A 4NOJA 2V3CC 1YVRA 1ZM7A 4MVYA 2BP7A 3U7IA 3SQNA 2EG5A 2ZZMA 4RTKA 2FG6C 2G1UA 2QN1A 3L04A 4PRKA 3E7WA 1HDZA 3V7YA 2W4IA 4ZA2A 1RYNA 2XE4A 4A8PA 4CM1A 2ZUCA 1PI3A 1R6VA 1WVIA 5IMBA 5DNYB 3TD6A 1YS6A 3L9WA 3VR4H 3KEQA 3BB3A 3DFFA 2Z6AA 1ND5A 1JEQB 5CLFA 3C3YA 5KTYA 3PYLA 3RYIB 3LXRA 4RVDA 4TV8A 1QKIA 3O0TA 4D8YA 1Q3TA 4KAXA 5EGSA 4ENPA 3IKTA 3LT2A 4IIBA 5I7AA 3L4BA 5K8UA 4D6YA 2ANBA 3KAKA 2XCOA 5EHQA 2H7YA 2WILA 1KMHA 1ZM9A 4P58A 3N8IA 3ZJYA 4KIFA 4DKXA 5EHXA 3FDXA 4BO5A 2XKAA 2O0LA 3IR6A 2LR0A 4RJTA 3CF4A 5KOJA 3OLXA 4WDQA 3W5IA 4DR3B 1WWKA 10MHA 1HEUA 4AYTA 3O90A 4Q15A 1ZNXA 5ESDA 2Q4TA 3WIOA 4IOLA 2ORYA 4JKOA 4NOMA 3T3OA 1KO1A 5GOZA 5HMMA 2X1HA 2GPTA 3GNSA 4PG7A 5B7PA 1K5PA 3CRZA 4D99A 1RT9A 4XTCS 1YDEA 1G5HA 1E3LA 3EW7A 4GOND 3ZHVA 4N03A 1NONA 2AQHA 4Q21A 4R9RA 3MQ2A 2DZDA 1H0RA 4AIRA 1XNHA 5CNJA 4ML3A 1MVLA 1Y6QA 1T5OA 1V1JA 5BUQA 2NVBA 4U2BA 3FKQA 3CMMA 1R16A 4KXVA 3TSWA 4LF9B 1FMJA 2C8JA 3NJ4A 1XVAA 4UEJA 2VP5A 3TRDA 2VJDA 3TO5A 3CH4B 2QL6A 3PR1A 4B79A 2DQKA 1OXXK 1BXKA 2PKQP 3UYKA 5KYXB 1DJLA 2A59A 4X20B 1Z06A 5AUOB 1NW5A 5F4BA 3SC2A 1RWKA 1RE1A 4CGYA 2I9KA 4DRXB 2DPLA 2YWCA 4KU4A 4ZT4A 1N5DA 3IT0A 2CLCX 2I22A 2AE1A 2CFTA 3E82A 1Z33A 3O6VA 5TARA 3QXSA 4OA5A 1D0VA 5F21A 1WLSA 4IO1A 1QH1B 1P1KA 4LZNA 4XJXA 5BSVA 2RJ3A 5TGTA 1TEHA 1IEVA 3VDQA 1EUCB 3C3MA 5A1TA 2HB6A 4C2BA 1UFKA 1I8TA 2ZCVA 3AY6A 2F2TA 1I1NA 3AFHA 3E05A 3FYUC 3ZUGA 3CVXA 1RXVA 3KR1A 4DHEA 1I7LA 2BF4A 4DY6A 1H1TA 5F1PA 3SQOA 5BUSA 4EA6A 2I2DA 1JVNA 2GKSA 4BNDA 3WQSB 1U8FO 2EZ4A 3D7NA 3LYAA 4G23A 2IIQA 3UN1A 3UWMA 2OAGA 1KSHA 1GNLA 4YDSA 1T3TA 3V1NA 4EY4A 4ZI2A 3DZIA 3EVDA 5KYVA 3K96A 4IJVA 5G4LA 4PWYA 4BNJA 4GSKA 2VK4A 3EEQA 4P0TA 3CX4A 1Z36A 1E9SA 3UHFA 1G9SA 3CKMA 2FPWA 4FUTA 4K0RA 4DMMA 2VQFB 1XLWA 2FUNB 2OAP1 4RTOA 4S2UA 3AG5A 1M5UA 3NOXA 3MQFA 2AKEA 2YICA 3AT1A 1R6TA 4WUTA 3HUFA 4RPCA 2H16A 4OFZA 1R0LA 4PC1A 2GCNA 2FDRA 1QB7A 2GX6A 4DVGA 3OIFA 5HIMA 1YR7A 1DXQA 2PLNA 2XWQA 2ZQZA 1W5BA 1HTBA 1JIJA 2QYHA 4EP1A 1QMGA 1QANA 3KLPX 1ISJA 1Y0BA 4BFVA 2DSTA 2E3JA 1TCVA 1UMCA 2O3SA 3PHGA 2FW1A 1X7YA 2J1LA 3N3AC 1D9XA 1TYAE 4JC0A 3ZHSA 4C9BA 2G83A 5GADl 4NDAA 2XB2A 2VHXA 2C83A 3EVNA 3T3NA 1B3BA 1YZQA 2VWGA 1GA6A 2P35A 4GRDA 3EEBA 1FNNA 2BFWA 2VVTA 3PJEA 4ZU1X 3OQIA 3EIEA 3SLRA 1G64A 1BHSA 1AS2A 1SVUA 2ZI5A 5HQ3A 1MLDA 1D1PA 1N2EA 3DNPA 4KPUA 4GKAA 3PHHA 5EL0A 1EFKA 1DADA 1M8FA 4G5QA 4WINA 1B0ZA 1FFBA 1SIUA 1C3XA 2JAPA 2AZTA 2O6HA 1WZUA 4V2IA 1FS5A 3SM3A 4EAQA 5BV8A 5JWOA 2H2AA 3JYLA 2GCIA 5BYKA 4EL0A 1Z2EA 1SXJE 2O0KA 3N8GA 2JFQA 4IBOA 1YCGA 5DLQC 5K0CA 3U1TA 4Z2AA 3IXMA 1JMVA 3P8ZA 1ONSA 3EDRA 4DV2B 4DDHA 1EXWA 1YZGA 3QE3A 4S24A 4HWOA 5F33A 5J4KA 3L7NA 5DM70 2GBCA 3UB3A 3IQDB 2A30A 4AJHA 5I4BA 4MWSA 3GWGA 5DE3A 2WWTA 2QN9A 2SNIE 4E3WA 2FR8A 4X8HA 1SC4A 1ORRA 1XB2A 3ZNPA 3OQMA 5BN5B 4B6FA 1QP8A 1LBSA 5F3RA 3C8MA 4Z7JA 2O5CA 3VKVA 1U0RA 2V6IA 3W9SA 1UMBB 1CEXA 4EF4A 1YHNA 3OZAA 1KVSA 1E5QA 3IT3A 4G07A 4Y2XA 3VMMA 1B1AA 1I4LD 5FPYA 1CNMA 3BAZA 1DP4A 2WC1A 3FOAA 3RJTA 3RRZA 4PYOA 2WK1A 3UK7A 3QU7A 1KYQA 5LXTB 2YMPA 2DHEA 1CY0A 2XQFA 1IOLA 3UMFA 3I9NA 4BN5A 2ZANA 3C45A 2YV2A 4HMPA 1QGUB 1ZCZA 2GM4A 2FSIA 3H2GA 4MCIA 4QU8A 4CMIA 1G5TA 4IOMA 4GBED 5ECWA 3TL2A 3GAFA 5CEFA 3F6SA 2R47A 3MMSA 1IMOA 4B81A 3C3BA 4UNIA 4BU0A 4DCGA 1A50B 1QV6A 2MSNA 2W4QA 4JQOA 4XDGA 5FL3A 1HL3A 1AKRA 5L3ZA 5KWEA 5KOYA 4RESA 2WHYA 1E4EB 5LB2A 5COQA 4XWKA 5DN6A 4K9NA 4YP5A 4J76A 2WU8A 2Z2KA 1YZNA 2RKOA 1V16B 3LVFO 3NWPA 3PFIA 3Q72A 3ZHQA 1KJIA 4X9XA 2ISQA 5TV2A 1ECBA 4M0MA 3RBXA 3AR6A 3JS5A 4Z4GA 3F7MA 2Q2WA 1TUBB 1EE1A 3LLSA 4V1CA 1MW9X 3K0KA 3M4XA 4XGRA 4KTTE 4B4UA 1KXJA 2XKBA 3GDOA 2Q2VA 4JBWA 3EWSA 4K28A 1SCNE 5DTQA 4ZVMA 1KAQA 1BWQA 2A33A 5C7YA 3VZQA 1TVKA 1C4WA 2HV8A 3H1AA 1W19A 5HS4A 4KB5A 3A32A 4EUHA 1BWSA 3OUZA 4QBTA 5LJLA 4XWAA 3DW3X 1YS9A 1ZUIA 1VHQA 4NZOA 4TYMA 1KDYA 5C8XA 4Y2QA 2Y0CA 2QY9A 3QBJA 2Y77A 3SQLA 2GD0A 2QXTA 3QXCA 1E66A 1ZXLA 2J41A 1IY9A 1ZKDA 3A2KA 3RRJA 3DD1A 2R1VB 3H5TA 5AKGA 4BP9A 1IONA 1RKVA 3G82C 2QRHA 1NW9B 2X4LA 4PNZA 4TTJA 5H4HA 4BJ3A 1LFDB 3P9CA 4FHZA 4MVJH 3BH0A 2ACEA 2FXIA 3ZX4A 3J7AC 4HYTA 3SYTA 4D5EA 2JZOA 2ZTUA 3D8NA 4H60A 4EB3A 3KT3A 5BR8B 2D1FA 5AHOA 1Y6JA 3D6UA 4HN9A 1MRSA 4OGFA 4AZ3B 4JT2A 1CY6A 2ZE5A 3VPDA 4TMVA 1MT3A 3GFOA 3I72A 2YWFA 4C87A 3V2UA 2QORA 2AN9A 2IXGA 3FXAA 1PT5A 3BMQA 2R6AA 3DLIA 1E7QA 5AVOA 1CJCA 2VDOB 4EY3A 3LIPA 3H97A 2RK4A 1N57A 4EHFA 3IC5A 3F9RA 4FLFA 4KLRA 3QWBA 1YNSA 2DHCA 1XMJA 3B9BA 1BN6A 4TXMA 5FNVF 1U0BB 3ZS8A 4BLWA 3EBOA 1N3BA 4NMMA 1N0HA 2OY0A 1UT8A 2QUBA 3A9CA 2C5LA 1AUPA 2QGFA 1FXSA 2GDJA 1VLLA 1T8TA 4FMDF 1L1QA 2I4OA 4EPWA 1J90A 3KZOA 1E0AA 2R5FA 4OK3A 2J6IA 4HWGA 3OOJA 2Y0EA 5FBHA 3S7TA 5DNVA 2I4IA 3HP1A 5JW6A 3QUTA 4CIAA 1PUJA 3QE0A 4EATA 1HQCA 3W7AA 1FRFS 2BONA 1B43A 4IV5A 5EIAA 3UT5A 4C3UA 1GNPA 4EF5A 4B6PA 3MCTA 2ZVPX 4OQNA 3TJZA 1OXBB 2GN0A 4Q4HA 4K40A 3KFVA 4FFMA 3RS9A 2Q29A 4HB0A 1KEPA 2PUWA 2HMVA 3GPCA 1RHMA 5CVJA 3WGKA 4D8UA 3C5EA 4NDZA 4WT7A 1O94C 4RX1A 2VR1A 4AZWA 4AZ0B 1ZM4A 1A9YA 4S1TA 2GN9A 3WLKX 5F1OA 4M0PA 4R2MA 3BFVA 2B35A 1CJTC 1XAIA 4U2EA 5ICFA 2F1JA 2XMGA 4IQ0A 1T6NA 3M83A 3KSDO 2HEIA 1P7ZA 4ACAA 4HXYA 4KE6A 4KQ6A 5K2OA 3A1UA 3M6XA 5BSRA 1OLSB 1SEVA 5FYDA 2VK1A 4C2UA 3I2FA 2VZ9A 2ZGVA 3G79A 2B4KA 2XWPA 3IP9A 4Q1VA 5TPWA 3WGNA 1UMDB 2GNOA 2RCNA 4FR5A 2D59A 4KMSA 2ZRLA 2VRCD 3JVVA 3QVKA 4L8YA 3F4KA 3KUCA 1HH4A 4W6ZA 1MJHA 4JLJA 1D0IA 4RHEA 1Y8QB 5DI3B 3T7AA 3DWFA 4E5PA 1TCUA 4R3NA 3MQ4A 2J4DA 3M1YA 3DUFA 3RM3A 1V3VA 1JP7A 1V16A 2H1RA 4II3A 5I7SA 1CJKC 3LHDA 4QAQA 1ACLA 1M7GA 3O8QA 3LQKA 1HYBA 1KNQA 1L4MA 4KQJA 1VLVA 2YXPX 3U4QA 4R7GA 5HK8A 1JIKA 1NAHA 3SSNA 3ITEA 2YBDA 3RYCB 5BP7A 2IHNA 1QZTA 4K9DA 4ON9A 3W3AH 2SHKA 1ML3A 1F0YA 1VJ5A 4ZHSA 4PSAA 1PTJA 2WZCA 3AI2A 2ZROA 3GNQA 1FDWA 4X7RA 2IXAA 5DM2A 3ER9A 2YMMA 2VUHB 2C2KA 2XW6A 3CPJB 4BFLA 4CUZA 4DV7B 5IAAA 5K0NA 3PKIA 5DX0A 2FP4B 1USUA 5THXA 1P4AA 5KJFA 2F00A 4MR8A 3ZE7A 4CLDA 2JLQA 1B0PA 4QWWA 1F51E 3PVZA 4URYR 4DR6B 1ZRHA 1OWPA 5GV8A 3IBSA 2BTQA 3BVPA 2CLMB 4CT5A 4I4IA 4IS3A 1I2AA 1I6LA 4KG7A 3W3AA 1LBEA 4LZZA 2ZULA 4GXQA 4ITUA 3L0OA 1AGXA 1R7RA 5E7MA 3T15A 4MV6A 4GAEA 4UHBA 2DPYA 2R7KA 4B47A 1DAEA 5AI6A 1I3OA 1IRIA 4Q16A 2ZU0C 3LBNA 3LBFA 4QBKA 4AG5A 5IKOA 2VQ3A 1TAUA 3SJ7A 3PK0A 4UBNA 2UV8A 4CIVA 5KVVA 4FWTA 1NBEA 1DV1A 4KAFA 3ZEAA 1G20E 2IJGX 4HFMA 1EQUA 4BDSA 2W48A 3ZCSA 2CD7A 1ZJ5A 4HEA6 2X0JA 4N5LA 4UCWA 3TKLA 2XYVA 1ZYUA 1U4SA 2XXJA 1YA6A 4LBVA 4EECA 5BMVB 1GDDA 3MTEA 3U61B 5A4IS 1H2EA 3MGCA 3IUMA 4EJSA 4MKXA 2Q6VA 4ZXFA 3V7UA 2HPVA 1JXQA 2CB0A 3RVMA 2GT1A 4U39A 4D0GA 2V1XA 5HXAA 1VA5A 1EGAA 1ORWA 4RLSA 5LQKA 3D7LA 4JBXA 2VXCA 3ES9A 4LC1A 2LXNA 1PIWA 4WH0A 1UBMS 4JQYA 2CVFA 3ANNA 3PA6A 1K9VF 1Y98A 3CCFA 1E3EA 1U0JA 3BK2A 1JT9A 5TQVA 4MYHA 3VNBA 1MT0A 2G25A 2HD4A 3NIBA 3PUXA 4IJ5A 3QE2A 4MPJA 5KYYB 3H0EA 3AK4A 5JCJD 4NENB 3SFTA 3LECA 3N2GB 2OCLA 1HFEL 3RUEA 3M5WA 1A5SB 1G21A 2BJVA 3O4FA 3WA7A 1D3AA 4QUJA 5KQLA 2RFLA 4QXQA 3NPMA 4F9EA 3LUDA 4IJ6A 1DEAA 2W2KB 1E89A 3DM9B 4Z5XA 1JECA 3NC1C 2UUBB 1SCIA 3R7NA 3CWQA 3ENQA 5ITVA 2ZYUX 2ROQA 1GTVA 1U2RA 3M8KA 1M1YE 1K5DA 3IERA 4P5DA 4YCAA 2NU9A 1D5WA 2WPNA 4DLAA 5C4GB 3PKZA 4R8RA 4B4DA 5H70A 3JQDA 1PRYA 5E0OA 3UYLA 5K3EA 4HDNB 5L3QB 3ZGXA 1CY8A 2QTFA 4IIFA 4RY9A 2Y66A 2FWAA 3RSFA 1EDOA 1LI7A 2QX8A 2X8JA 4I5IA 4QARA 2UYOA 2WM9B 2C9CA 2WSIA 1T29A 3L8YA 3USES 4GMHA 4FILA 2HMSA 1X9HA 1UMDA 1JQLB 1ID1A 2QENA 4L9RA 4X62B 1GVNB 3NYRA 2ZDGA 1J2YA 4FFNA 4ND5A 3TD2A 4YPVA 1R4AA 2R00C 2WJAA 1OFTA 1RZ3A 5IJXA 2O7NA 3AUXA 4HLUC 1SAYA 2I4RA 3P45A 1FTSA 1GYPA 2GEUA 2NO7A 3EXG1 4KOEC 4RLQA 4XA8A 1KETA 3FW1A 4UBMA 4AECA 4DNXA 2NLOA 1U90A 1Q19A 2CUKA 2X2PA 2OHIA 3BD9A 3CUSA 3BH7A 2VCEA 3I45A 5LB4A 4OHMA 4B71A 1CEYA 1XTVA 3CWCA 3GUVA 2Z43A 4INZA 4YTEA 5E3JA 3SX4A 3UM9A 4BVFA 3VAZA 4TTTS 4LN1A 1EMDA 2WG0A 1O95A 3QI2A 1CD5A 1RWOA 5JZMA 3TWOA 2H52A 1NYTA 1PGNA 1YS2X 4PAOA 3C6MA 5TMDA 3RU7A 1DAHA 5JY6A 2PKWA 2QN3A 4DNQA 3PNVA 1QFMA 1DKRA 1NJFA 1S2MA 1G8GA 2AA3A 1A9PA 2C1EA 1NVFA 4TXHA 3PX2A 3EUAA 5BW6B 4FB5A 3THXB 2GBLA 2QLFA 1XQ1A 4LOAA 3AWIA 3HKCA 4NBWA 1UPAA 3DEYX 3IMFA 1X14A 2W2OA 4ZAVA 1VBKA 1DEOA 4WCFA 3IP7A 4D57A 4DA8A 1SXPA 3ZWYA 3R7WB 4Y2GA 4CMKA 3GZNB 4MUXA 2DB3A 3H0KA 3R0QA 4LISA 2QUZA 1PV4A 2YHIA 4YJFB 1CRQA 2H59A 1YZYA 5CA0F 1M9NA 3OQOA 1JB9A 1HE8B 3DAFA 4QHTA 4R16A 1TTQB 1ILWA 4IPTA 3SE0A 3DLTA 1OZFA 4O29A 1KPGA 1OKKA 4BPRA 2BLLA 1P29A 4BJ6A 2QT1A 1N6LA 2WVHA 3HYTA 4ZPJA 1ZIXA 3MJHA 5EE0A 5JAOA 4D44A 2PX4A 1MAUA 3HY4A 2O8EA 5CPFA 2RGRA 3LPCA 4C7VA 1C7ZA 2X22A 1UC4B 2XCUA 2AKAB 1Q15A 2WRZA 3H5WA 4EH1A 3QPCA 1ZXXA 2GERA 1EFPB 1K88A 1GPMA 1T2CA 4P4SB 1KR2A 3ZYCA 1XKXA 2VYFA 2CHEA 4MRSA 3OEWA 2PK3A 4E88A 3DFMA 1O9GA 1PYOA 4H7PA 4MVJA 2BEWA 1QIHA