8AATA

X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
total genus 150
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1991-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 8aatA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 8aatA01
2X8UA 3VK2A 2YKUA 5K8BA 1AIAA 2BWNA 4IYOA 1Z3ZA 3GBXA 4DQ6A 2CY8A 4OTLA 1W3UA 2HP1A 4KXKA 1G7WA 5G0AA 1LW4A 3IF2A 4ADDA 1B5PA 2VMPA 3PIUA 2O7CA 3B1DA 1MLZA 1YNUA 1BS0A 1YOOA 2Z61A 4GE4A 3RCHA 3I4JA 1QISA 1B4XA 3HLMA 3FCRA 5M4BA 1GEXA 1V2EA 4W91A 2VLFA 2Z9UA 4XJOA 2NMPA 4KYOA 1AICA 3NU7A 2CTZA 3W1JA 1YJZA 4ADBA 4ZDPA 2VGUA 4WB0A 2QMAA 4IX8A 3FQ7A 3ELEA 4MSOA 4R2NA 2HOYA 2Z20A 4O6ZA 1I43A 1KKJA 3BCBA 1WYUA 1AMAA 3W1HA 2EPJA 4AH3A 3FSLA 3TCMA 4EFFA 4EMYA 1MAQA 1V2DA 2VGWA 3DXWA 3COGA 2YKXA 5D5SA 1TOEA 4F5HA 1AMRA 5DJ1A 4LC3A 1ASDA 3MEBA 4WD2A 3VP6A 1PMOA 1EJIA 2Z9VA 2ZJGA 4J8LA 3II0A 1XEYA 3EZ1A 2O1BA 1OATA 2BI5A 1AHYA 4M2JA 4W1WA 5F8VA 3VK4A 1UKJA 3L44A 2YRIA 1VP4A 1KL2A 2FN6A 3OP7A 4RITA 4HVKA 2BHXA 2HZPA 4U2HA 5I92A 3PGYA 2WKAA 4CBSA 1SZKA 1SFFA 4RKCA 1IX7A 2GMUA 2GB3A 2AY4A 5G2QA 2TPLA 3NUBA 1GC3A 2Z1YA 3QGUA 4OT8A 4WYDA 2DGLA 2GSAA 2BI1A 4JEXA 4DGTA 4ZWVA 1LK9A 1O4SA 4BA5A 2W7JA 2X5FA 4IXSA 2EH6A 2W7KA 1W23A 1G4XA 1X0MA 3MAFA 4TV7A 5M49A 3F9TA 2X5DA 2YCTA 1GD9A 3FZ8A 4KAMA 4R5FA 4WBTA 1BT4A 2DKBA 5FT6A 4CVQA 1M0NA 1WKHA 5G4IA 1GEWA 1J32A 3LG0A 3AATA 2XBNA 4WYEA 1MDZA 1AMQA 3MKJA 5G2PA 4U1TA 1D7VA 1AIBA 3ZZJA 4A0FA 4XJMA 2AY1A 4IXOA 4JF0A 3PD6A 1JS6A 2VMWA 3HMUA 1LC7A 1TARA 4ADEA 2W8VA 2W8UA 2VMZA 2DKJA 3MAUA 2XH1A 3ASBA 3E2FA 2YRRA 3EZSA 4M2MA 4MQQA 2OQXA 5EIGB 4JE5D 4OMAA 2WK7A 1CZEA 1IAXA 2BKWA 5EUNA 2OATA 5DJ9A 4R5ZA 3ATHA 1KL1A 3JWBA 1KKPA 2D65A 3E77A 1TOKA 4PVFA 9AATA 3NNKA 4BHDA 3B46A 3BN1A 3I5TA 5D95A 4JF1A 3DU4A 3AOWA 1OXOA 1C7OA 4ITXA 1AY8A 4IY7A 3I16A 3DODA 1ARSA 1TATA 4XEWA 4BMKA 3RCHB 3AENB 1ZC9A 1UU0A 2Q7WA 1O62A 5JAYA 1YJSA 2BWPA 1AKCA 3E6GA 4ATPA 1YJYA 4ISYA 2Z9WA 1QGNA 2C44A 2ZSMA 3GZCA 3OKSA 4BA4A 3K28A 1M0OA 1N31A 3QN6A 3DR4A 3A9YA 3GZDA 3H7FA 3PA9A 5J8QA 1TASA 1FC4A 3DRDA 3TQXA 4Q31A 1ARTA 1WYUB 1M0QA 2VI8A 3WCOA 3GZDC 3RUYA 4WLJA 5AX8A 5FT5A 1GC4A 1AJSA 1MAPA 1S08A 2BIGA 3BCAA 3FZ6A 3ASAA 1S0AA 3BWOA 3PJ0A 2C7TA 4CBRA 1GCKA 1GEYA 4UOYA 4ZASA 3T32A 1ASFA 1ASGA 1DTYA 2F8JA 3M5UA 3NX3A 4OBUA 4RAEA 1VJOA 4UQVA 3AENA 4Y0IA 1JF9A 2CB1A 4A00A 5BJ3A 2BYLA 1GC2A 2VIAA 4F5IA 1OHWA 3FRKA 5G09A 3LVLB 1OXPA 4K2IA 3GJUA 5F9SA 2JJHA 3FDDA 1ECXA 4L0OA 2EGYA 4ZSYA 1AAWA 2DR1A 1V2FA 5M46A 3Q8NA 3QM2A 4WYFA 3WGBA 4JEVA 4OBVA 3ISLA 4EB5A 2YCPA 3AV7A 3ZZKA 3QI6A 4ZSWA 3FD0A 3DC1A 1B5OA 2CJHA 5C6UA 3K7YA 1BQDA 3MAFB 4A6TA 2D63A 1GC0A 4JE5A 2Z9XA 3EI6A 1CJ0A 4HF8A 1GDEA 3NUIA 1CQ8A 2BYJA 2AEUA 1AKAA 4W1VA 3NYTA 2GQNA 1JS3A 4LW4A 4RKDA 4F4EA 1ASNA 2QLRA 4ZDOA 1H1CA 3ELPA 1M6SA 2W8WA 2YCNA 3AEMA 1GBNA 4JEZA 1IJIA 1I29A 3PD6B 3FFHA 5E3KA 1ARGA 3A9ZA 5EAVA 4A0RA 2JG2A 3AELA 3BS8A 3FZ7A 3KGXA 1WKGA 5EUEA 3AEMC 4DBCA 1CZCA 4H51A 2G6WA 3UAKA 4RIZA 3AEJA 1AHEA 1H0CA 4ZLVA 3JTXA 3WLXA 2BI3A 1C7GA 1C0NA 1UU2A 1X29A 3AEJC 1AHXA 3FVSA 3NTJA 5FT4A 4IXZA 1RV3A 2ZUKA 1M4NA 3MC6A 2ZP7A 3DZZA 5HXXA 3BC8A 3FQ8A 4MQPA 1BJOB 2QB2A 5FT8A 4E1OA 3VK3A 3CQ5A 3MC6C 4ZDLA 1AY4A 2D66A 3RI6A 3A2BA 3JZLA 3HL2A 1MLYA 1OHYA 3ZRQA 1WSTA 2W7MA 5EFSA 3FVUA 3ZRRA 4GDYA 2VMUA 1OHVA 3JU7A 1TPLA 3ZRPA 1X28A 4XK1A 4UHOA 1AHFA 1CL2A 1WYTB 2AATA 1BJNA 1LC5A 2FQ6A 3FQAA 1ASAA 4F5JA 1QIRA 2VI9A 1JG8A 3KE3A 4GE9A 2PB2A 4GEBA 2AEVA 4AZKA 2CFBA 3RQ1A 5BJ4A 2V1PA 3B1EA 1ASMA 2WK9A 2ZSLA 1LW5A 1MGVA 3P1TA 5EAAA 1QZ9A 4UHNA 1PMMA 1ASEA 3AOVA 2VYCA 2JJFA 1S07A 1AJSB 2HP2A 2YKYA 3DYDA 4RM1A 3H14A 3TFTA 1P3WA 1BJOA 3BB8A 2CANA 5M4DA 1EQBA 2RFVA 3G8MA 1IX8A 2VMSA 3AEPA 1N8PA 2HOZA 2R2NA 1B9HA 4ZWMA 4R8DA 2V0YA 3E9KA 4PIWA 3UE8A 4A6RA 3WCNA 2AY6A 1IBJA 1WYTA 2Z1ZA 1BQAA 4K2BA 2OKKA 4WYAA 1SF2A 4F5LA 3F6TA 2VMTA 4NOGA 3B1CA 1SZSA 4GE7A 1AX4A 1CQ7A 1AHGA 3EI9A 3FDBA 7AATA 4PFNA 3NYUA 4RLGA 2VMYA 4E3QA 3PDXA 1PFFA 1QJ3A 2W7IA 5IWQA 4RJYA 1D7RA 2R0TA 3FTBA 2HORA 2JJGA 2QA3A 4LNMA 3LWSA 5DB5A 3G7QA 5DX5A 2CJGA 3EI8A 4MKKA 1DFOA 3E2ZA 1EG5A 4P7YA 1QITA 3R9AA 2W7HA 4FL0A 2VGTA 2EO5A 2PO3A 2AY9A 1W7LA 3MADA 1SPAA 4P3MA 3W1IA 5HDMA 1B9IA 1BJ4A 3N5MA 3N75A 2HOXA 3TFUA 2CSTA 2VGVA 1AMSA 3A9XA 4AO4A 2BWOA 4AZJA 4IW7A 2VMQA 2FNUA 1U08A 2C0RA 2YHKA 3WKRA 3HDOA 3PDBA 4WYCA 1WYVB 4W8IA 1B8GA 3BCXA 2HUFA 1C7NA 2HUIA 1D7UA 4AOAA 2DGMA 1BW0A 3PPLA 2QBTA 4GRXA 1M0PA 4XAUA 2ZY2A 2AY3A 1I41A 2C81A 1IAYA 2Z67A 4ZM3A 2W7FA 4K2MA 3GSBA 4JEWA 4LNLA 4M2KA 3EIBA 1D2FA 2R5EA 3VAXA 4GSAA 1G4VA 1ARIA 4BQ0A 3HQTA 4F5MA 3D6KA 3LV2A 3A8UX 1J04A 2HUUA 3JWAA 1T3IA 1ELQA 1RVUA 2AY8A 2D7YA 2OGAA 4MY5A 4OYTA 3LVKA 1E5FA 1C9CA 2E7JA 4MQRA 3WKSA 3QPGA 2YKVA 1ASBA 2FYFA 3L8AA 3LVJA 2PB0A 2DOUA 1DJUA 2VIBA 4XQ2A 3ECDA 2BIEA 1WYVA 2VMVA 3CQ6A 4F5FA 2R5CA 3AEOA 3KGWA 4J5UA 2OKJA 4Q6RA 5LH9A 1CL1A 3GR9A 4MGRA 2AY5A 1ARHA 4WXBA 3WZFA 2W7LA 1D7SA 1Y4IA 1Z7DA 2O0RA 3FKDA 1MDOA 1TOGA 2X3LA 5EUDA 2YOBA 4Q75A 3P6KA 2DGKA 4E77A 1O61A 1W7NA 1YIYA 4XJPA 2JJEA 3DR7A 1ZODA 1IVRA 2D61A 1AKBA 3PAAA 1LC8A 3KKIA 3EI5A 3EIAA 1XI9A 2W7GA 3B8XA 2QB3A 4W5KA 1E5EA 3HVYA 4QGRA 2FM1A 2VMRA 4TN4A 1DGEA 4A0HA 2ZY3A 2AY7A 3LY1A 1IUGA 1LKCA 3K40A 2VGSA 2BIAA 1M32A 2W7EA 3EUCA 2VMNA 3CBFA 2W8JA 3IHJA 2VLHA 3GETA 4OC9A 2BI9A 3DXVA 1MDXA 4B9BA 2BI2A 2GMSA 4LNJA 2AY2A 1DJEA 1FG7A 4PFFA 1QJ5A 1ELUA 4A0GA 3E2YA 1UU1A 1ORDA 1V72A 3R4TA 3USFA 1AJRA 1IX6A 4AO9A 4WP0A 1YAAA 3G0TA 4CXQA 3N0LA 4ZM4A 4I8AA 3HBXA 2WK8A 3GWPA 4WXGA 3RBLA 4Y0DA 1DGDA 1SVVA 1RVYA 2E7IA 8AATA 3WX9A 1KMKA 3NU8A 3NYSA 3FFRA 4E3RA 1O69A 4CXRA 2W7DA 3E2ZB 2JISA 4WLHA 4N0WA 4XJLA 1DKAA 3JW9A 4ATQA 3UWCA 3BWNA 4JEYA 1PG8A 2CH2A 5E4ZA 2ZY5A 4W1XA 2VMXA 2JGTA 1RV4A 3BWNC 3VOMA 4FFCA 4A72A 3MBBA 4OCAA 5G4JA 5TF5A 4EU1A 3WY7A 2D7ZA 3TATA 3NDNA 4F5KA 1AAMA 2ORDA 3PDBB 1N2TA 2E54A 4Q76A 4B98A 5HHYA 2VMOA 2D64A 4IYOB 4ITGA 1S06A 1YIZA 4F5GA 4ADCA 1KMJA 2CH1A 3CAIA 1CS1A 4LW2A 1G7XA 5EQCA 4ZAHA 5LHAA 4A6UA 3BV0A 1X2AA 4Y0HA 2OGEA 4RJ0A 5E5IA 1C4KA 2CJDA 4WYGA 1W7MA 2CINA 3NRAA 1I48A 3QBOA 2FNIA 3FVXA 4EB7A 2ZYJA 2E7UA 5EIGA 4WB0B 2W8TA 4WXFA 1FG3A 1M7YA 1ZOBA 3CQ4A 4N0BA 3QHXA 2EZ1A 4MKJA 3EI7A 3RBFA 3WGCA 1ASCA 1VEFA 1AY5A 1TOIA 1SZUA 1BJWA 1CQ6A 1DJ9A 1BKGA 3ACZA 1LS3A 2ZC0A 3F0HA 3HT4A 3LVMA 4TMRA 4UHMA 1TOJA 2R5CB 2EZ2A 2D5YA 1ASLA 2VGZA 1S09A 2ZY4A
chains in the Genus database with same CATH superfamily
2X8UA 3VK2A 2YKUA 5K8BA 1AIAA 2BWNA 4IYOA 1Z3ZA 3GBXA 4DQ6A 2CY8A 4OTLA 1W3UA 2HP1A 4KXKA 1G7WA 5G0AA 1LW4A 3IF2A 4ADDA 1B5PA 2VMPA 3PIUA 2O7CA 3B1DA 1MLZA 1YNUA 1BS0A 1YOOA 2Z61A 4GE4A 3RCHA 3I4JA 1QISA 1B4XA 3HLMA 3FCRA 5M4BA 1GEXA 1V2EA 4W91A 2VLFA 2Z9UA 4XJOA 2NMPA 5KTBA 4KYOA 1AICA 3NU7A 2CTZA 3W1JA 1YJZA 4ADBA 4ZDPA 2VGUA 4WB0A 2QMAA 4IX8A 3FQ7A 3ELEA 4MSOA 4R2NA 2HOYA 2Z20A 4O6ZA 1I43A 1KKJA 3BCBA 1WYUA 1AMAA 3W1HA 2EPJA 4AH3A 3FSLA 3TCMA 4EFFA 4EMYA 1MAQA 1V2DA 2VGWA 3DXWA 3COGA 2YKXA 5D5SA 1TOEA 4F5HA 1AMRA 5DJ1A 4LC3A 1ASDA 3MEBA 4WD2A 3VP6A 1PMOA 1EJIA 2Z9VA 2ZJGA 4J8LA 3II0A 1XEYA 3EZ1A 2O1BA 1OATA 2BI5A 1AHYA 4M2JA 4W1WA 5F8VA 3VK4A 1UKJA 3L44A 2YRIA 1VP4A 1KL2A 2FN6A 3OP7A 4RITA 4HVKA 2BHXA 2HZPA 4U2HA 5I92A 3PGYA 2WKAA 4CBSA 1SZKA 1SFFA 4RKCA 1IX7A 2GMUA 2GB3A 2AY4A 5G2QA 2TPLA 3NUBA 1GC3A 2Z1YA 3QGUA 4OT8A 4WYDA 2DGLA 2GSAA 2BI1A 4JEXA 4DGTA 4ZWVA 1LK9A 1O4SA 4BA5A 2W7JA 2X5FA 4IXSA 2EH6A 2W7KA 1W23A 1G4XA 1X0MA 3MAFA 4TV7A 5M49A 3F9TA 2X5DA 2YCTA 1GD9A 3FZ8A 4KAMA 4R5FA 4WBTA 1BT4A 2DKBA 5FT6A 4CVQA 1M0NA 1WKHA 5G4IA 1GEWA 1J32A 3LG0A 3AATA 2XBNA 4WYEA 1MDZA 1AMQA 3MKJA 5G2PA 4U1TA 1D7VA 1AIBA 3ZZJA 4A0FA 4XJMA 2AY1A 4IXOA 4JF0A 3PD6A 1JS6A 2VMWA 3HMUA 1LC7A 1TARA 4ADEA 2W8VA 2W8UA 2VMZA 2DKJA 3MAUA 2XH1A 3ASBA 3E2FA 2YRRA 3EZSA 4M2MA 4MQQA 2OQXA 5EIGB 4JE5D 4OMAA 2WK7A 1CZEA 1IAXA 2BKWA 5EUNA 2OATA 5DJ9A 4R5ZA 3ATHA 1KL1A 3JWBA 1KKPA 2D65A 3E77A 1TOKA 4PVFA 9AATA 3NNKA 4BHDA 3B46A 3BN1A 3I5TA 5D95A 4JF1A 3DU4A 3AOWA 1OXOA 1C7OA 4ITXA 1AY8A 4IY7A 3I16A 3DODA 1ARSA 1TATA 4XEWA 4BMKA 3RCHB 3AENB 1ZC9A 1UU0A 2Q7WA 1O62A 5JAYA 1YJSA 2BWPA 1AKCA 3E6GA 4ATPA 1YJYA 4ISYA 2Z9WA 1QGNA 2C44A 2ZSMA 3GZCA 3OKSA 4BA4A 3K28A 1M0OA 1N31A 3QN6A 3DR4A 3A9YA 3GZDA 3H7FA 3PA9A 5J8QA 1TASA 1FC4A 3DRDA 3TQXA 4Q31A 1ARTA 1WYUB 1M0QA 2VI8A 3WCOA 3GZDC 3RUYA 4WLJA 5AX8A 5FT5A 1GC4A 1AJSA 1MAPA 1S08A 2BIGA 3BCAA 3FZ6A 3ASAA 1S0AA 3BWOA 3PJ0A 2C7TA 4CBRA 1GCKA 1GEYA 4UOYA 4ZASA 3T32A 1ASFA 1ASGA 1DTYA 2F8JA 3M5UA 3NX3A 4OBUA 4RAEA 1VJOA 4UQVA 3AENA 4Y0IA 1JF9A 2CB1A 4A00A 5BJ3A 2BYLA 1GC2A 2VIAA 4F5IA 1OHWA 3FRKA 5G09A 3LVLB 1OXPA 4K2IA 3GJUA 5F9SA 2JJHA 3FDDA 1ECXA 4L0OA 2EGYA 4ZSYA 1AAWA 2DR1A 1V2FA 5M46A 3Q8NA 3QM2A 4WYFA 3WGBA 4JEVA 4OBVA 3ISLA 4EB5A 2YCPA 3AV7A 3ZZKA 3QI6A 4ZSWA 3FD0A 3DC1A 1B5OA 2CJHA 5C6UA 3K7YA 1BQDA 3MAFB 4A6TA 2D63A 1GC0A 4JE5A 2Z9XA 3EI6A 1CJ0A 4HF8A 1GDEA 3NUIA 1CQ8A 2BYJA 2AEUA 1AKAA 4W1VA 3NYTA 2GQNA 1JS3A 4LW4A 4RKDA 4F4EA 1ASNA 2QLRA 4ZDOA 1H1CA 3ELPA 1M6SA 2W8WA 2YCNA 3AEMA 1GBNA 4JEZA 1IJIA 1I29A 3PD6B 3FFHA 5E3KA 1ARGA 3A9ZA 5EAVA 4A0RA 2JG2A 3AELA 3BS8A 3FZ7A 3KGXA 1WKGA 5EUEA 3AEMC 4DBCA 1CZCA 4H51A 2G6WA 3UAKA 4RIZA 3AEJA 1AHEA 1H0CA 4ZLVA 3JTXA 3WLXA 2BI3A 1C7GA 1C0NA 1UU2A 1X29A 3AEJC 1AHXA 3FVSA 3NTJA 5FT4A 4IXZA 1RV3A 2ZUKA 1M4NA 3MC6A 2ZP7A 3DZZA 5HXXA 3BC8A 3FQ8A 4MQPA 1BJOB 2QB2A 5FT8A 4E1OA 3VK3A 3CQ5A 3MC6C 4ZDLA 1AY4A 2D66A 3RI6A 3A2BA 3JZLA 3HL2A 1MLYA 1OHYA 2FKIA 3ZRQA 1WSTA 2W7MA 5EFSA 3FVUA 3ZRRA 4GDYA 2VMUA 1OHVA 3JU7A 1TPLA 3ZRPA 1X28A 4XK1A 4UHOA 1AHFA 1CL2A 1WYTB 2AATA 1BJNA 1LC5A 2FQ6A 3FQAA 1ASAA 4F5JA 1QIRA 2VI9A 1JG8A 3KE3A 4GE9A 2PB2A 4GEBA 2AEVA 4AZKA 2CFBA 3RQ1A 5BJ4A 2V1PA 3B1EA 1ASMA 2WK9A 2ZSLA 1LW5A 1MGVA 3P1TA 5EAAA 1QZ9A 4UHNA 1PMMA 1ASEA 3AOVA 2VYCA 2JJFA 1S07A 1AJSB 2HP2A 2YKYA 3DYDA 4RM1A 3H14A 3TFTA 1P3WA 1BJOA 3BB8A 2CANA 5M4DA 1EQBA 2RFVA 3G8MA 1IX8A 2VMSA 3AEPA 1N8PA 2HOZA 2R2NA 1B9HA 4ZWMA 4R8DA 2V0YA 3E9KA 4PIWA 3UE8A 4A6RA 3WCNA 2AY6A 1IBJA 1WYTA 2Z1ZA 1BQAA 4K2BA 2QSRA 2OKKA 4WYAA 1SF2A 4F5LA 3F6TA 2VMTA 4NOGA 3B1CA 1SZSA 4GE7A 1AX4A 1CQ7A 1AHGA 3EI9A 3FDBA 7AATA 4PFNA 3NYUA 4RLGA 2VMYA 4E3QA 3PDXA 1PFFA 1QJ3A 2W7IA 5IWQA 4RJYA 1D7RA 2R0TA 3FTBA 2HORA 2JJGA 2QA3A 4LNMA 3LWSA 5DB5A 3G7QA 5DX5A 2CJGA 3EI8A 4MKKA 1DFOA 3E2ZA 1EG5A 4P7YA 1QITA 3R9AA 2W7HA 4FL0A 2VGTA 2EO5A 2PO3A 2AY9A 1W7LA 3MADA 1SPAA 4P3MA 3W1IA 5HDMA 1B9IA 1BJ4A 3N5MA 3N75A 2HOXA 3TFUA 2CSTA 2VGVA 1AMSA 3A9XA 4AO4A 3H9XA 2BWOA 4AZJA 4IW7A 2VMQA 2FNUA 1U08A 2C0RA 2YHKA 3WKRA 3HDOA 3PDBA 4WYCA 1WYVB 4W8IA 1B8GA 3BCXA 2HUFA 1C7NA 2HUIA 1D7UA 4AOAA 2DGMA 1BW0A 3PPLA 2QBTA 4GRXA 1M0PA 4XAUA 2ZY2A 2AY3A 1I41A 2C81A 1IAYA 2Z67A 4ZM3A 2W7FA 4K2MA 3GSBA 4JEWA 4LNLA 4M2KA 3EIBA 1D2FA 2R5EA 3VAXA 4GSAA 1G4VA 1ARIA 4BQ0A 3HQTA 4F5MA 3D6KA 3LV2A 3A8UX 1J04A 2HUUA 3JWAA 1T3IA 1ELQA 1RVUA 2AY8A 2D7YA 2OGAA 4MY5A 4OYTA 3N4XA 3LVKA 1E5FA 1C9CA 2E7JA 4MQRA 3WKSA 2KFPA 3QPGA 2YKVA 1ASBA 2FYFA 3L8AA 3LVJA 2PB0A 1KAFA 2DOUA 1DJUA 2VIBA 4XQ2A 3ECDA 2BIEA 1WYVA 2VMVA 3CQ6A 4F5FA 2R5CA 3AEOA 3KGWA 4J5UA 2OKJA 4Q6RA 5LH9A 1CL1A 3GR9A 4MGRA 2AY5A 1ARHA 4WXBA 3WZFA 4K05A 2W7LA 1D7SA 1Y4IA 1Z7DA 2O0RA 3FKDA 1MDOA 1TOGA 2X3LA 5EUDA 2YOBA 4Q75A 3P6KA 2DGKA 4E77A 1O61A 1W7NA 1YIYA 4XJPA 2JJEA 3DR7A 1ZODA 1IVRA 2D61A 1AKBA 3PAAA 1LC8A 3KKIA 3EI5A 3EIAA 1XI9A 2W7GA 3B8XA 2QB3A 4W5KA 1E5EA 3HVYA 4QGRA 2FM1A 2VMRA 4TN4A 1DGEA 4A0HA 2ZY3A 2AY7A 3LY1A 1IUGA 1LKCA 3K40A 2VGSA 2BIAA 1M32A 2W7EA 3EUCA 2VMNA 3CBFA 2W8JA 3IHJA 2VLHA 3GETA 4OC9A 2BI9A 3DXVA 1MDXA 4B9BA 2BI2A 2GMSA 4LNJA 2AY2A 3N4RA 1DJEA 1FG7A 4PFFA 1QJ5A 1ELUA 4A0GA 3E2YA 1UU1A 1ORDA 1V72A 3R4TA 3USFA 1AJRA 1IX6A 4AO9A 4WP0A 1YAAA 3G0TA 4CXQA 3N0LA 4ZM4A 4I8AA 3HBXA 2WK8A 3GWPA 4WXGA 3RBLA 4Y0DA 1DGDA 1SVVA 1RVYA 2E7IA 8AATA 3WX9A 1KMKA 3NU8A 3NYSA 3FFRA 4E3RA 1O69A 4CXRA 2W7DA 3E2ZB 2JISA 4WLHA 4N0WA 4XJLA 2EYQA 3N7NA 1DKAA 3JW9A 2WB6A 4ATQA 3UWCA 3BWNA 4JEYA 1PG8A 2CH2A 5E4ZA 2ZY5A 4W1XA 2VMXA 2JGTA 1RV4A 3BWNC 3VOMA 4FFCA 4A72A 3MBBA 4OCAA 5G4JA 5TF5A 4EU1A 3WY7A 2D7ZA 3TATA 3NDNA 4F5KA 1AAMA 2ORDA 3PDBB 1N2TA 2E54A 4Q76A 4B98A 5HHYA 2VMOA 2D64A 4IYOB 4ITGA 1S06A 1YIZA 4F5GA 3N4SA 4ADCA 1KMJA 2CH1A 3CAIA 1CS1A 4LW2A 1G7XA 5EQCA 4ZAHA 5LHAA 2A1VA 4H63Q 4A6UA 3BV0A 1X2AA 4Y0HA 2OGEA 4RJ0A 5E5IA 1C4KA 2CJDA 4WYGA 1W7MA 2CINA 3NRAA 1I48A 3QBOA 2FNIA 3FVXA 4EB7A 2ZYJA 2E7UA 5EIGA 4WB0B 2W8TA 4WXFA 1FG3A 1M7YA 1ZOBA 3CQ4A 4N0BA 3QHXA 2EZ1A 4MKJA 3EI7A 3RBFA 3WGCA 1ASCA 1VEFA 1AY5A 1TOIA 2G7JA 1SZUA 1BJWA 1CQ6A 1DJ9A 1BKGA 3ACZA 1LS3A 2ZC0A 3F0HA 3HT4A 3LVMA 4TMRA 4UHMA 1TOJA 2R5CB 2EZ2A 2D5YA 1ASLA 2VGZA 1S09A 2ZY4A
chains in the Genus database with same CATH topology
2X8UA 3VK2A 2YKUA 5K8BA 1AIAA 2BWNA 4IYOA 1Z3ZA 3GBXA 4DQ6A 2CY8A 4OTLA 1W3UA 2HP1A 4KXKA 1G7WA 5G0AA 1LW4A 3IF2A 4ADDA 1B5PA 2VMPA 3PIUA 2O7CA 3B1DA 1MLZA 1YNUA 1BS0A 1YOOA 2Z61A 4GE4A 3RCHA 3I4JA 1QISA 1B4XA 3HLMA 3FCRA 5M4BA 1GEXA 1V2EA 4W91A 2VLFA 2Z9UA 4XJOA 2NMPA 5KTBA 4KYOA 1AICA 3NU7A 2CTZA 3W1JA 1YJZA 4ADBA 4ZDPA 2VGUA 4WB0A 2QMAA 4IX8A 3FQ7A 3ELEA 4MSOA 4R2NA 2HOYA 2Z20A 4O6ZA 1I43A 1KKJA 3BCBA 1WYUA 1AMAA 3W1HA 2EPJA 4AH3A 3FSLA 3TCMA 4EFFA 4EMYA 1MAQA 1V2DA 2VGWA 3DXWA 3COGA 2YKXA 5D5SA 1TOEA 4F5HA 1AMRA 5DJ1A 4LC3A 1ASDA 3MEBA 4WD2A 3VP6A 1PMOA 1EJIA 2Z9VA 2ZJGA 4J8LA 3II0A 1XEYA 3EZ1A 2O1BA 1OATA 2BI5A 1AHYA 4M2JA 4W1WA 5F8VA 3VK4A 1UKJA 3L44A 2YRIA 1VP4A 1KL2A 2FN6A 3OP7A 4RITA 4HVKA 2BHXA 2HZPA 4U2HA 5I92A 3PGYA 2WKAA 4CBSA 1SZKA 1SFFA 4RKCA 1IX7A 2GMUA 2GB3A 2AY4A 5G2QA 2TPLA 3NUBA 1GC3A 2Z1YA 3QGUA 4OT8A 4WYDA 2DGLA 2GSAA 2BI1A 4JEXA 4DGTA 4ZWVA 1LK9A 1O4SA 4BA5A 2W7JA 2X5FA 4IXSA 2EH6A 2W7KA 1W23A 1G4XA 1X0MA 3MAFA 4TV7A 5M49A 3F9TA 2X5DA 2YCTA 1GD9A 3FZ8A 4KAMA 4R5FA 4WBTA 1BT4A 2DKBA 5FT6A 4CVQA 1M0NA 1WKHA 5G4IA 1GEWA 1J32A 3LG0A 3AATA 2XBNA 4WYEA 1MDZA 1AMQA 3MKJA 5G2PA 4U1TA 1D7VA 1AIBA 3ZZJA 4A0FA 4XJMA 2AY1A 4IXOA 4JF0A 3PD6A 1JS6A 2VMWA 3HMUA 1LC7A 1TARA 4ADEA 2W8VA 2W8UA 2VMZA 2DKJA 3MAUA 2XH1A 3ASBA 3E2FA 2YRRA 3EZSA 4M2MA 4MQQA 2OQXA 5EIGB 4JE5D 4OMAA 2WK7A 1CZEA 1IAXA 2BKWA 5EUNA 2OATA 5DJ9A 4R5ZA 3ATHA 1KL1A 3JWBA 1KKPA 2D65A 3E77A 1TOKA 4PVFA 9AATA 3NNKA 4BHDA 3B46A 3BN1A 3I5TA 5D95A 4JF1A 3DU4A 3AOWA 1OXOA 1C7OA 4ITXA 1AY8A 4IY7A 3I16A 3DODA 1ARSA 1TATA 4XEWA 4BMKA 3RCHB 3AENB 1ZC9A 1UU0A 2Q7WA 1O62A 5JAYA 1YJSA 2BWPA 1AKCA 3E6GA 4ATPA 1YJYA 4ISYA 2Z9WA 1QGNA 2C44A 2ZSMA 3GZCA 3OKSA 4BA4A 3K28A 1M0OA 1N31A 3QN6A 3DR4A 3A9YA 3GZDA 3H7FA 3PA9A 5J8QA 1TASA 1FC4A 3DRDA 3TQXA 4Q31A 1ARTA 1WYUB 1M0QA 2VI8A 3WCOA 3GZDC 3RUYA 4WLJA 5AX8A 5FT5A 1GC4A 1AJSA 1MAPA 1S08A 2BIGA 3BCAA 3FZ6A 3ASAA 1S0AA 3BWOA 3PJ0A 2C7TA 4CBRA 1GCKA 1GEYA 4UOYA 4ZASA 3T32A 1ASFA 1ASGA 1DTYA 2F8JA 3M5UA 3NX3A 4OBUA 4RAEA 1VJOA 4UQVA 3AENA 4Y0IA 1JF9A 2CB1A 4A00A 5BJ3A 2BYLA 1GC2A 2VIAA 4F5IA 1OHWA 3FRKA 5G09A 3LVLB 1OXPA 4K2IA 3GJUA 5F9SA 2JJHA 3FDDA 1ECXA 4L0OA 2EGYA 4ZSYA 1AAWA 2DR1A 1V2FA 5M46A 3Q8NA 3QM2A 4WYFA 3WGBA 4JEVA 4OBVA 3ISLA 4EB5A 2YCPA 3AV7A 3ZZKA 3QI6A 4ZSWA 3FD0A 3DC1A 1B5OA 2CJHA 5C6UA 3K7YA 1BQDA 3MAFB 4A6TA 2D63A 1GC0A 4JE5A 2Z9XA 3EI6A 1CJ0A 4HF8A 1GDEA 3NUIA 1CQ8A 2BYJA 2AEUA 1AKAA 4W1VA 3NYTA 2GQNA 1JS3A 4LW4A 4RKDA 4F4EA 1ASNA 2QLRA 4ZDOA 1H1CA 3ELPA 1M6SA 2W8WA 2YCNA 3AEMA 1GBNA 4JEZA 1IJIA 1I29A 3PD6B 3FFHA 5E3KA 1ARGA 3A9ZA 5EAVA 4A0RA 2JG2A 3AELA 3BS8A 3FZ7A 3KGXA 1WKGA 5EUEA 3AEMC 4DBCA 1CZCA 4H51A 2G6WA 3UAKA 4RIZA 3AEJA 1AHEA 1H0CA 4ZLVA 3JTXA 3WLXA 2BI3A 1C7GA 1C0NA 1UU2A 1X29A 3AEJC 1AHXA 3FVSA 3NTJA 5FT4A 4IXZA 1RV3A 2ZUKA 1M4NA 3MC6A 2ZP7A 3DZZA 5HXXA 3BC8A 3FQ8A 4MQPA 1BJOB 2QB2A 5FT8A 4E1OA 3VK3A 3CQ5A 3MC6C 4ZDLA 1AY4A 2D66A 3RI6A 3A2BA 3JZLA 3HL2A 1MLYA 1OHYA 2FKIA 3ZRQA 1WSTA 2W7MA 5EFSA 3FVUA 3ZRRA 4GDYA 2VMUA 1OHVA 3JU7A 1TPLA 3ZRPA 1X28A 4XK1A 4UHOA 1AHFA 1CL2A 1WYTB 2AATA 1BJNA 1LC5A 2FQ6A 3FQAA 1ASAA 4F5JA 1QIRA 2VI9A 1JG8A 3KE3A 4GE9A 2PB2A 4GEBA 2AEVA 4AZKA 2CFBA 3RQ1A 5BJ4A 2V1PA 3B1EA 1ASMA 2WK9A 2ZSLA 1LW5A 1MGVA 3P1TA 5EAAA 1QZ9A 4UHNA 1PMMA 1ASEA 3AOVA 2VYCA 2JJFA 1S07A 1AJSB 2HP2A 2YKYA 3DYDA 4RM1A 3H14A 3TFTA 1P3WA 1BJOA 3BB8A 2CANA 5M4DA 1EQBA 2RFVA 3G8MA 1IX8A 2VMSA 3AEPA 1N8PA 2HOZA 2R2NA 1B9HA 4ZWMA 4R8DA 2V0YA 3E9KA 4PIWA 3UE8A 4A6RA 3WCNA 2AY6A 1IBJA 1WYTA 2Z1ZA 1BQAA 4K2BA 2QSRA 2OKKA 4WYAA 1SF2A 4F5LA 3F6TA 2VMTA 4NOGA 3B1CA 1SZSA 4GE7A 1AX4A 1CQ7A 1AHGA 3EI9A 3FDBA 7AATA 4PFNA 3NYUA 4RLGA 2VMYA 4E3QA 3PDXA 1PFFA 1QJ3A 2W7IA 5IWQA 4RJYA 1D7RA 2R0TA 3FTBA 2HORA 2JJGA 2QA3A 4LNMA 3LWSA 5DB5A 3G7QA 5DX5A 2CJGA 3EI8A 4MKKA 1DFOA 3E2ZA 1EG5A 4P7YA 1QITA 3R9AA 2W7HA 4FL0A 2VGTA 2EO5A 2PO3A 2AY9A 1W7LA 3MADA 1SPAA 4P3MA 3W1IA 5HDMA 1B9IA 1BJ4A 3N5MA 3N75A 2HOXA 3TFUA 2CSTA 2VGVA 1AMSA 3A9XA 4AO4A 3H9XA 2BWOA 4AZJA 4IW7A 2VMQA 2FNUA 1U08A 2C0RA 2YHKA 3WKRA 3HDOA 3PDBA 4WYCA 1WYVB 4W8IA 1B8GA 3BCXA 2HUFA 1C7NA 2HUIA 1D7UA 4AOAA 2DGMA 1BW0A 3PPLA 2QBTA 4GRXA 1M0PA 4XAUA 2ZY2A 2AY3A 1I41A 2C81A 1IAYA 2Z67A 4ZM3A 2W7FA 4K2MA 3GSBA 4JEWA 4LNLA 4M2KA 3EIBA 1D2FA 2R5EA 3VAXA 4GSAA 1G4VA 1ARIA 4BQ0A 3HQTA 4F5MA 3D6KA 3LV2A 3A8UX 1J04A 2HUUA 3JWAA 1T3IA 1ELQA 1RVUA 2AY8A 2D7YA 2OGAA 4MY5A 4OYTA 3N4XA 3LVKA 1E5FA 1C9CA 2E7JA 4MQRA 3WKSA 2KFPA 3QPGA 2YKVA 1ASBA 2FYFA 3L8AA 3LVJA 2PB0A 2DOUA 1DJUA 2VIBA 4XQ2A 3ECDA 2BIEA 1WYVA 2VMVA 3CQ6A 4F5FA 2R5CA 3AEOA 3KGWA 4J5UA 2OKJA 4Q6RA 5LH9A 1CL1A 3GR9A 4MGRA 2AY5A 1ARHA 4WXBA 3WZFA 4K05A 2W7LA 1D7SA 1Y4IA 1Z7DA 2O0RA 3FKDA 1MDOA 1TOGA 2X3LA 5EUDA 2YOBA 4Q75A 3P6KA 2DGKA 4E77A 1O61A 1W7NA 1YIYA 4XJPA 2JJEA 3DR7A 1ZODA 1IVRA 2D61A 1AKBA 3PAAA 1LC8A 3KKIA 3EI5A 3EIAA 1XI9A 2W7GA 3B8XA 2QB3A 4W5KA 1E5EA 3HVYA 4QGRA 2FM1A 2VMRA 4TN4A 1DGEA 4A0HA 2ZY3A 2AY7A 3LY1A 1IUGA 1LKCA 3K40A 2VGSA 2BIAA 1M32A 2W7EA 3EUCA 2VMNA 3CBFA 2W8JA 3IHJA 2VLHA 3GETA 4OC9A 2BI9A 3DXVA 1MDXA 4B9BA 2BI2A 2GMSA 4LNJA 2AY2A 3N4RA 1DJEA 1FG7A 4PFFA 1QJ5A 1ELUA 4A0GA 3E2YA 1UU1A 1ORDA 1V72A 3R4TA 3USFA 1AJRA 1IX6A 4AO9A 4WP0A 1YAAA 3G0TA 4CXQA 3N0LA 4ZM4A 4I8AA 3HBXA 2WK8A 3GWPA 4WXGA 3RBLA 4Y0DA 1DGDA 1SVVA 1RVYA 2E7IA 8AATA 3WX9A 1KMKA 3NU8A 3NYSA 3FFRA 4E3RA 1O69A 4CXRA 2W7DA 3E2ZB 2JISA 4WLHA 4N0WA 4XJLA 2EYQA 3N7NA 1DKAA 3JW9A 2WB6A 4ATQA 3UWCA 3BWNA 4JEYA 1PG8A 2CH2A 5E4ZA 2ZY5A 4W1XA 2VMXA 2JGTA 1RV4A 3BWNC 3VOMA 4FFCA 4A72A 3MBBA 4OCAA 5G4JA 5TF5A 4EU1A 3WY7A 2D7ZA 3TATA 3NDNA 4F5KA 1AAMA 2ORDA 3PDBB 1N2TA 2E54A 4Q76A 4B98A 5HHYA 2VMOA 2D64A 4IYOB 4ITGA 1S06A 1YIZA 4F5GA 3N4SA 4ADCA 1KMJA 2CH1A 3CAIA 1CS1A 4LW2A 1G7XA 5EQCA 4ZAHA 5LHAA 2A1VA 4H63Q 4A6UA 3BV0A 1X2AA 4Y0HA 2OGEA 4RJ0A 5E5IA 1C4KA 2CJDA 4WYGA 1W7MA 2CINA 3NRAA 1I48A 3QBOA 2FNIA 3FVXA 4EB7A 2ZYJA 2E7UA 5EIGA 4WB0B 2W8TA 4WXFA 1FG3A 1M7YA 1ZOBA 3CQ4A 4N0BA 3QHXA 2EZ1A 4MKJA 3EI7A 3RBFA 3WGCA 1ASCA 1VEFA 1AY5A 1TOIA 2G7JA 1SZUA 1BJWA 1CQ6A 1DJ9A 1BKGA 3ACZA 1LS3A 2ZC0A 3F0HA 3HT4A 3LVMA 4TMRA 4UHMA 1TOJA 2R5CB 2EZ2A 2D5YA 1ASLA 2VGZA 1S09A 2ZY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8U A;  3VK2 A;  2YKU A;  5K8B A;  1AIA A;  2BWN A;  4IYO A;  1Z3Z A;  3GBX A;  4DQ6 A;  2CY8 A;  4OTL A;  1W3U A;  2HP1 A;  4KXK A;  1G7W A;  5G0A A;  1LW4 A;  3IF2 A;  4ADD A;  1B5P A;  2VMP A;  3PIU A;  2O7C A;  3B1D A;  1MLZ A;  1YNU A;  1BS0 A;  1YOO A;  2Z61 A;  4GE4 A;  3RCH A;  3I4J A;  1QIS A;  1B4X A;  3HLM A;  3FCR A;  5M4B A;  1GEX A;  1V2E A;  4W91 A;  2VLF A;  2Z9U A;  4XJO A;  2NMP A;  4KYO A;  1AIC A;  3NU7 A;  2CTZ A;  3W1J A;  1YJZ A;  4ADB A;  4ZDP A;  2VGU A;  4WB0 A;  2QMA A;  4IX8 A;  3FQ7 A;  3ELE A;  4MSO A;  4R2N A;  2HOY A;  2Z20 A;  4O6Z A;  1I43 A;  1KKJ A;  3BCB A;  1WYU A;  1AMA A;  3W1H A;  2EPJ A;  4AH3 A;  3FSL A;  3TCM A;  4EFF A;  4EMY A;  1MAQ A;  1V2D A;  2VGW A;  3DXW A;  3COG A;  2YKX A;  5D5S A;  1TOE A;  4F5H A;  1AMR A;  5DJ1 A;  4LC3 A;  1ASD A;  3MEB A;  4WD2 A;  3VP6 A;  1PMO A;  1EJI A;  2Z9V A;  2ZJG A;  4J8L A;  3II0 A;  1XEY A;  3EZ1 A;  2O1B A;  1OAT A;  2BI5 A;  1AHY A;  4M2J A;  4W1W A;  5F8V A;  3VK4 A;  1UKJ A;  3L44 A;  2YRI A;  1VP4 A;  1KL2 A;  2FN6 A;  3OP7 A;  4RIT A;  4HVK A;  2BHX A;  2HZP A;  4U2H A;  5I92 A;  3PGY A;  2WKA A;  4CBS A;  1SZK A;  1SFF A;  4RKC A;  1IX7 A;  2GMU A;  2GB3 A;  2AY4 A;  5G2Q A;  2TPL A;  3NUB A;  1GC3 A;  2Z1Y A;  3QGU A;  4OT8 A;  4WYD A;  2DGL A;  2GSA A;  2BI1 A;  4JEX A;  4DGT A;  4ZWV A;  1LK9 A;  1O4S A;  4BA5 A;  2W7J A;  2X5F A;  4IXS A;  2EH6 A;  2W7K A;  1W23 A;  1G4X A;  1X0M A;  3MAF A;  4TV7 A;  5M49 A;  3F9T A;  2X5D A;  2YCT A;  1GD9 A;  3FZ8 A;  4KAM A;  4R5F A;  4WBT A;  1BT4 A;  2DKB A;  5FT6 A;  4CVQ A;  1M0N A;  1WKH A;  5G4I A;  1GEW A;  1J32 A;  3LG0 A;  3AAT A;  2XBN A;  4WYE A;  1MDZ A;  1AMQ A;  3MKJ A;  5G2P A;  4U1T A;  1D7V A;  1AIB A;  3ZZJ A;  4A0F A;  4XJM A;  2AY1 A;  4IXO A;  4JF0 A;  3PD6 A;  1JS6 A;  2VMW A;  3HMU A;  1LC7 A;  1TAR A;  4ADE A;  2W8V A;  2W8U A;  2VMZ A;  2DKJ A;  3MAU A;  2XH1 A;  3ASB A;  3E2F A;  2YRR A;  3EZS A;  4M2M A;  4MQQ A;  2OQX A;  5EIG B;  4JE5 D;  4OMA A;  2WK7 A;  1CZE A;  1IAX A;  2BKW A;  5EUN A;  2OAT A;  5DJ9 A;  4R5Z A;  3ATH A;  1KL1 A;  3JWB A;  1KKP A;  2D65 A;  3E77 A;  1TOK A;  4PVF A;  9AAT A;  3NNK A;  4BHD A;  3B46 A;  3BN1 A;  3I5T A;  5D95 A;  4JF1 A;  3DU4 A;  3AOW A;  1OXO A;  1C7O A;  4ITX A;  1AY8 A;  4IY7 A;  3I16 A;  3DOD A;  1ARS A;  1TAT A;  4XEW A;  4BMK A;  3RCH B;  3AEN B;  1ZC9 A;  1UU0 A;  2Q7W A;  1O62 A;  5JAY A;  1YJS A;  2BWP A;  1AKC A;  3E6G A;  4ATP A;  1YJY A;  4ISY A;  2Z9W A;  1QGN A;  2C44 A;  2ZSM A;  3GZC A;  3OKS A;  4BA4 A;  3K28 A;  1M0O A;  1N31 A;  3QN6 A;  3DR4 A;  3A9Y A;  3GZD A;  3H7F A;  3PA9 A;  5J8Q A;  1TAS A;  1FC4 A;  3DRD A;  3TQX A;  4Q31 A;  1ART A;  1WYU B;  1M0Q A;  2VI8 A;  3WCO A;  3GZD C;  3RUY A;  4WLJ A;  5AX8 A;  5FT5 A;  1GC4 A;  1AJS A;  1MAP A;  1S08 A;  2BIG A;  3BCA A;  3FZ6 A;  3ASA A;  1S0A A;  3BWO A;  3PJ0 A;  2C7T A;  4CBR A;  1GCK A;  1GEY A;  4UOY A;  4ZAS A;  3T32 A;  1ASF A;  1ASG A;  1DTY A;  2F8J A;  3M5U A;  3NX3 A;  4OBU A;  4RAE A;  1VJO A;  4UQV A;  3AEN A;  4Y0I A;  1JF9 A;  2CB1 A;  4A00 A;  5BJ3 A;  2BYL A;  1GC2 A;  2VIA A;  4F5I A;  1OHW A;  3FRK A;  5G09 A;  3LVL B;  1OXP A;  4K2I A;  3GJU A;  5F9S A;  2JJH A;  3FDD A;  1ECX A;  4L0O A;  2EGY A;  4ZSY A;  1AAW A;  2DR1 A;  1V2F A;  5M46 A;  3Q8N A;  3QM2 A;  4WYF A;  3WGB A;  4JEV A;  4OBV A;  3ISL A;  4EB5 A;  2YCP A;  3AV7 A;  3ZZK A;  3QI6 A;  4ZSW A;  3FD0 A;  3DC1 A;  1B5O A;  2CJH A;  5C6U A;  3K7Y A;  1BQD A;  3MAF B;  4A6T A;  2D63 A;  1GC0 A;  4JE5 A;  2Z9X A;  3EI6 A;  1CJ0 A;  4HF8 A;  1GDE A;  3NUI A;  1CQ8 A;  2BYJ A;  2AEU A;  1AKA A;  4W1V A;  3NYT A;  2GQN A;  1JS3 A;  4LW4 A;  4RKD A;  4F4E A;  1ASN A;  2QLR A;  4ZDO A;  1H1C A;  3ELP A;  1M6S A;  2W8W A;  2YCN A;  3AEM A;  1GBN A;  4JEZ A;  1IJI A;  1I29 A;  3PD6 B;  3FFH A;  5E3K A;  1ARG A;  3A9Z A;  5EAV A;  4A0R A;  2JG2 A;  3AEL A;  3BS8 A;  3FZ7 A;  3KGX A;  1WKG A;  5EUE A;  3AEM C;  4DBC A;  1CZC A;  4H51 A;  2G6W A;  3UAK A;  4RIZ A;  3AEJ A;  1AHE A;  1H0C A;  4ZLV A;  3JTX A;  3WLX A;  2BI3 A;  1C7G A;  1C0N A;  1UU2 A;  1X29 A;  3AEJ C;  1AHX A;  3FVS A;  3NTJ A;  5FT4 A;  4IXZ A;  1RV3 A;  2ZUK A;  1M4N A;  3MC6 A;  2ZP7 A;  3DZZ A;  5HXX A;  3BC8 A;  3FQ8 A;  4MQP A;  1BJO B;  2QB2 A;  5FT8 A;  4E1O A;  3VK3 A;  3CQ5 A;  3MC6 C;  4ZDL A;  1AY4 A;  2D66 A;  3RI6 A;  3A2B A;  3JZL A;  3HL2 A;  1MLY A;  1OHY A;  3ZRQ A;  1WST A;  2W7M A;  5EFS A;  3FVU A;  3ZRR A;  4GDY A;  2VMU A;  1OHV A;  3JU7 A;  1TPL A;  3ZRP A;  1X28 A;  4XK1 A;  4UHO A;  1AHF A;  1CL2 A;  1WYT B;  2AAT A;  1BJN A;  1LC5 A;  2FQ6 A;  3FQA A;  1ASA A;  4F5J A;  1QIR A;  2VI9 A;  1JG8 A;  3KE3 A;  4GE9 A;  2PB2 A;  4GEB A;  2AEV A;  4AZK A;  2CFB A;  3RQ1 A;  5BJ4 A;  2V1P A;  3B1E A;  1ASM A;  2WK9 A;  2ZSL A;  1LW5 A;  1MGV A;  3P1T A;  5EAA A;  1QZ9 A;  4UHN A;  1PMM A;  1ASE A;  3AOV A;  2VYC A;  2JJF A;  1S07 A;  1AJS B;  2HP2 A;  2YKY A;  3DYD A;  4RM1 A;  3H14 A;  3TFT A;  1P3W A;  1BJO A;  3BB8 A;  2CAN A;  5M4D A;  1EQB A;  2RFV A;  3G8M A;  1IX8 A;  2VMS A;  3AEP A;  1N8P A;  2HOZ A;  2R2N A;  1B9H A;  4ZWM A;  4R8D A;  2V0Y A;  3E9K A;  4PIW A;  3UE8 A;  4A6R A;  3WCN A;  2AY6 A;  1IBJ A;  1WYT A;  2Z1Z A;  1BQA A;  4K2B A;  2OKK A;  4WYA A;  1SF2 A;  4F5L A;  3F6T A;  2VMT A;  4NOG A;  3B1C A;  1SZS A;  4GE7 A;  1AX4 A;  1CQ7 A;  1AHG A;  3EI9 A;  3FDB A;  7AAT A;  4PFN A;  3NYU A;  4RLG A;  2VMY A;  4E3Q A;  3PDX A;  1PFF A;  1QJ3 A;  2W7I A;  5IWQ A;  4RJY A;  1D7R A;  2R0T A;  3FTB A;  2HOR A;  2JJG A;  2QA3 A;  4LNM A;  3LWS A;  5DB5 A;  3G7Q A;  5DX5 A;  2CJG A;  3EI8 A;  4MKK A;  1DFO A;  3E2Z A;  1EG5 A;  4P7Y A;  1QIT A;  3R9A A;  2W7H A;  4FL0 A;  2VGT A;  2EO5 A;  2PO3 A;  2AY9 A;  1W7L A;  3MAD A;  1SPA A;  4P3M A;  3W1I A;  5HDM A;  1B9I A;  1BJ4 A;  3N5M A;  3N75 A;  2HOX A;  3TFU A;  2CST A;  2VGV A;  1AMS A;  3A9X A;  4AO4 A;  2BWO A;  4AZJ A;  4IW7 A;  2VMQ A;  2FNU A;  1U08 A;  2C0R A;  2YHK A;  3WKR A;  3HDO A;  3PDB A;  4WYC A;  1WYV B;  4W8I A;  1B8G A;  3BCX A;  2HUF A;  1C7N A;  2HUI A;  1D7U A;  4AOA A;  2DGM A;  1BW0 A;  3PPL A;  2QBT A;  4GRX A;  1M0P A;  4XAU A;  2ZY2 A;  2AY3 A;  1I41 A;  2C81 A;  1IAY A;  2Z67 A;  4ZM3 A;  2W7F A;  4K2M A;  3GSB A;  4JEW A;  4LNL A;  4M2K A;  3EIB A;  1D2F A;  2R5E A;  3VAX A;  4GSA A;  1G4V A;  1ARI A;  4BQ0 A;  3HQT A;  4F5M A;  3D6K A;  3LV2 A;  3A8U X;  1J04 A;  2HUU A;  3JWA A;  1T3I A;  1ELQ A;  1RVU A;  2AY8 A;  2D7Y A;  2OGA A;  4MY5 A;  4OYT A;  3LVK A;  1E5F A;  1C9C A;  2E7J A;  4MQR A;  3WKS A;  3QPG A;  2YKV A;  1ASB A;  2FYF A;  3L8A A;  3LVJ A;  2PB0 A;  2DOU A;  1DJU A;  2VIB A;  4XQ2 A;  3ECD A;  2BIE A;  1WYV A;  2VMV A;  3CQ6 A;  4F5F A;  2R5C A;  3AEO A;  3KGW A;  4J5U A;  2OKJ A;  4Q6R A;  5LH9 A;  1CL1 A;  3GR9 A;  4MGR A;  2AY5 A;  1ARH A;  4WXB A;  3WZF A;  2W7L A;  1D7S A;  1Y4I A;  1Z7D A;  2O0R A;  3FKD A;  1MDO A;  1TOG A;  2X3L A;  5EUD A;  2YOB A;  4Q75 A;  3P6K A;  2DGK A;  4E77 A;  1O61 A;  1W7N A;  1YIY A;  4XJP A;  2JJE A;  3DR7 A;  1ZOD A;  1IVR A;  2D61 A;  1AKB A;  3PAA A;  1LC8 A;  3KKI A;  3EI5 A;  3EIA A;  1XI9 A;  2W7G A;  3B8X A;  2QB3 A;  4W5K A;  1E5E A;  3HVY A;  4QGR A;  2FM1 A;  2VMR A;  4TN4 A;  1DGE A;  4A0H A;  2ZY3 A;  2AY7 A;  3LY1 A;  1IUG A;  1LKC A;  3K40 A;  2VGS A;  2BIA A;  1M32 A;  2W7E A;  3EUC A;  2VMN A;  3CBF A;  2W8J A;  3IHJ A;  2VLH A;  3GET A;  4OC9 A;  2BI9 A;  3DXV A;  1MDX A;  4B9B A;  2BI2 A;  2GMS A;  4LNJ A;  2AY2 A;  1DJE A;  1FG7 A;  4PFF A;  1QJ5 A;  1ELU A;  4A0G A;  3E2Y A;  1UU1 A;  1ORD A;  1V72 A;  3R4T A;  3USF A;  1AJR A;  1IX6 A;  4AO9 A;  4WP0 A;  1YAA A;  3G0T A;  4CXQ A;  3N0L A;  4ZM4 A;  4I8A A;  3HBX A;  2WK8 A;  3GWP A;  4WXG A;  3RBL A;  4Y0D A;  1DGD A;  1SVV A;  1RVY A;  2E7I A;  8AAT A;  3WX9 A;  1KMK A;  3NU8 A;  3NYS A;  3FFR A;  4E3R A;  1O69 A;  4CXR A;  2W7D A;  3E2Z B;  2JIS A;  4WLH A;  4N0W A;  4XJL A;  1DKA A;  3JW9 A;  4ATQ A;  3UWC A;  3BWN A;  4JEY A;  1PG8 A;  2CH2 A;  5E4Z A;  2ZY5 A;  4W1X A;  2VMX A;  2JGT A;  1RV4 A;  3BWN C;  3VOM A;  4FFC A;  4A72 A;  3MBB A;  4OCA A;  5G4J A;  5TF5 A;  4EU1 A;  3WY7 A;  2D7Z A;  3TAT A;  3NDN A;  4F5K A;  1AAM A;  2ORD A;  3PDB B;  1N2T A;  2E54 A;  4Q76 A;  4B98 A;  5HHY A;  2VMO A;  2D64 A;  4IYO B;  4ITG A;  1S06 A;  1YIZ A;  4F5G A;  4ADC A;  1KMJ A;  2CH1 A;  3CAI A;  1CS1 A;  4LW2 A;  1G7X A;  5EQC A;  4ZAH A;  5LHA A;  4A6U A;  3BV0 A;  1X2A A;  4Y0H A;  2OGE A;  4RJ0 A;  5E5I A;  1C4K A;  2CJD A;  4WYG A;  1W7M A;  2CIN A;  3NRA A;  1I48 A;  3QBO A;  2FNI A;  3FVX A;  4EB7 A;  2ZYJ A;  2E7U A;  5EIG A;  4WB0 B;  2W8T A;  4WXF A;  1FG3 A;  1M7Y A;  1ZOB A;  3CQ4 A;  4N0B A;  3QHX A;  2EZ1 A;  4MKJ A;  3EI7 A;  3RBF A;  3WGC A;  1ASC A;  1VEF A;  1AY5 A;  1TOI A;  1SZU A;  1BJW A;  1CQ6 A;  1DJ9 A;  1BKG A;  3ACZ A;  1LS3 A;  2ZC0 A;  3F0H A;  3HT4 A;  3LVM A;  4TMR A;  4UHM A;  1TOJ A;  2R5C B;  2EZ2 A;  2D5Y A;  1ASL A;  2VGZ A;  1S09 A;  2ZY4 A; 
#chains in the Genus database with same CATH topology
 2X8U A;  3VK2 A;  2YKU A;  5K8B A;  1AIA A;  2BWN A;  4IYO A;  1Z3Z A;  3GBX A;  4DQ6 A;  2CY8 A;  4OTL A;  1W3U A;  2HP1 A;  4KXK A;  1G7W A;  5G0A A;  1LW4 A;  3IF2 A;  4ADD A;  1B5P A;  2VMP A;  3PIU A;  2O7C A;  3B1D A;  1MLZ A;  1YNU A;  1BS0 A;  1YOO A;  2Z61 A;  4GE4 A;  3RCH A;  3I4J A;  1QIS A;  1B4X A;  3HLM A;  3FCR A;  5M4B A;  1GEX A;  1V2E A;  4W91 A;  2VLF A;  2Z9U A;  4XJO A;  2NMP A;  5KTB A;  4KYO A;  1AIC A;  3NU7 A;  2CTZ A;  3W1J A;  1YJZ A;  4ADB A;  4ZDP A;  2VGU A;  4WB0 A;  2QMA A;  4IX8 A;  3FQ7 A;  3ELE A;  4MSO A;  4R2N A;  2HOY A;  2Z20 A;  4O6Z A;  1I43 A;  1KKJ A;  3BCB A;  1WYU A;  1AMA A;  3W1H A;  2EPJ A;  4AH3 A;  3FSL A;  3TCM A;  4EFF A;  4EMY A;  1MAQ A;  1V2D A;  2VGW A;  3DXW A;  3COG A;  2YKX A;  5D5S A;  1TOE A;  4F5H A;  1AMR A;  5DJ1 A;  4LC3 A;  1ASD A;  3MEB A;  4WD2 A;  3VP6 A;  1PMO A;  1EJI A;  2Z9V A;  2ZJG A;  4J8L A;  3II0 A;  1XEY A;  3EZ1 A;  2O1B A;  1OAT A;  2BI5 A;  1AHY A;  4M2J A;  4W1W A;  5F8V A;  3VK4 A;  1UKJ A;  3L44 A;  2YRI A;  1VP4 A;  1KL2 A;  2FN6 A;  3OP7 A;  4RIT A;  4HVK A;  2BHX A;  2HZP A;  4U2H A;  5I92 A;  3PGY A;  2WKA A;  4CBS A;  1SZK A;  1SFF A;  4RKC A;  1IX7 A;  2GMU A;  2GB3 A;  2AY4 A;  5G2Q A;  2TPL A;  3NUB A;  1GC3 A;  2Z1Y A;  3QGU A;  4OT8 A;  4WYD A;  2DGL A;  2GSA A;  2BI1 A;  4JEX A;  4DGT A;  4ZWV A;  1LK9 A;  1O4S A;  4BA5 A;  2W7J A;  2X5F A;  4IXS A;  2EH6 A;  2W7K A;  1W23 A;  1G4X A;  1X0M A;  3MAF A;  4TV7 A;  5M49 A;  3F9T A;  2X5D A;  2YCT A;  1GD9 A;  3FZ8 A;  4KAM A;  4R5F A;  4WBT A;  1BT4 A;  2DKB A;  5FT6 A;  4CVQ A;  1M0N A;  1WKH A;  5G4I A;  1GEW A;  1J32 A;  3LG0 A;  3AAT A;  2XBN A;  4WYE A;  1MDZ A;  1AMQ A;  3MKJ A;  5G2P A;  4U1T A;  1D7V A;  1AIB A;  3ZZJ A;  4A0F A;  4XJM A;  2AY1 A;  4IXO A;  4JF0 A;  3PD6 A;  1JS6 A;  2VMW A;  3HMU A;  1LC7 A;  1TAR A;  4ADE A;  2W8V A;  2W8U A;  2VMZ A;  2DKJ A;  3MAU A;  2XH1 A;  3ASB A;  3E2F A;  2YRR A;  3EZS A;  4M2M A;  4MQQ A;  2OQX A;  5EIG B;  4JE5 D;  4OMA A;  2WK7 A;  1CZE A;  1IAX A;  2BKW A;  5EUN A;  2OAT A;  5DJ9 A;  4R5Z A;  3ATH A;  1KL1 A;  3JWB A;  1KKP A;  2D65 A;  3E77 A;  1TOK A;  4PVF A;  9AAT A;  3NNK A;  4BHD A;  3B46 A;  3BN1 A;  3I5T A;  5D95 A;  4JF1 A;  3DU4 A;  3AOW A;  1OXO A;  1C7O A;  4ITX A;  1AY8 A;  4IY7 A;  3I16 A;  3DOD A;  1ARS A;  1TAT A;  4XEW A;  4BMK A;  3RCH B;  3AEN B;  1ZC9 A;  1UU0 A;  2Q7W A;  1O62 A;  5JAY A;  1YJS A;  2BWP A;  1AKC A;  3E6G A;  4ATP A;  1YJY A;  4ISY A;  2Z9W A;  1QGN A;  2C44 A;  2ZSM A;  3GZC A;  3OKS A;  4BA4 A;  3K28 A;  1M0O A;  1N31 A;  3QN6 A;  3DR4 A;  3A9Y A;  3GZD A;  3H7F A;  3PA9 A;  5J8Q A;  1TAS A;  1FC4 A;  3DRD A;  3TQX A;  4Q31 A;  1ART A;  1WYU B;  1M0Q A;  2VI8 A;  3WCO A;  3GZD C;  3RUY A;  4WLJ A;  5AX8 A;  5FT5 A;  1GC4 A;  1AJS A;  1MAP A;  1S08 A;  2BIG A;  3BCA A;  3FZ6 A;  3ASA A;  1S0A A;  3BWO A;  3PJ0 A;  2C7T A;  4CBR A;  1GCK A;  1GEY A;  4UOY A;  4ZAS A;  3T32 A;  1ASF A;  1ASG A;  1DTY A;  2F8J A;  3M5U A;  3NX3 A;  4OBU A;  4RAE A;  1VJO A;  4UQV A;  3AEN A;  4Y0I A;  1JF9 A;  2CB1 A;  4A00 A;  5BJ3 A;  2BYL A;  1GC2 A;  2VIA A;  4F5I A;  1OHW A;  3FRK A;  5G09 A;  3LVL B;  1OXP A;  4K2I A;  3GJU A;  5F9S A;  2JJH A;  3FDD A;  1ECX A;  4L0O A;  2EGY A;  4ZSY A;  1AAW A;  2DR1 A;  1V2F A;  5M46 A;  3Q8N A;  3QM2 A;  4WYF A;  3WGB A;  4JEV A;  4OBV A;  3ISL A;  4EB5 A;  2YCP A;  3AV7 A;  3ZZK A;  3QI6 A;  4ZSW A;  3FD0 A;  3DC1 A;  1B5O A;  2CJH A;  5C6U A;  3K7Y A;  1BQD A;  3MAF B;  4A6T A;  2D63 A;  1GC0 A;  4JE5 A;  2Z9X A;  3EI6 A;  1CJ0 A;  4HF8 A;  1GDE A;  3NUI A;  1CQ8 A;  2BYJ A;  2AEU A;  1AKA A;  4W1V A;  3NYT A;  2GQN A;  1JS3 A;  4LW4 A;  4RKD A;  4F4E A;  1ASN A;  2QLR A;  4ZDO A;  1H1C A;  3ELP A;  1M6S A;  2W8W A;  2YCN A;  3AEM A;  1GBN A;  4JEZ A;  1IJI A;  1I29 A;  3PD6 B;  3FFH A;  5E3K A;  1ARG A;  3A9Z A;  5EAV A;  4A0R A;  2JG2 A;  3AEL A;  3BS8 A;  3FZ7 A;  3KGX A;  1WKG A;  5EUE A;  3AEM C;  4DBC A;  1CZC A;  4H51 A;  2G6W A;  3UAK A;  4RIZ A;  3AEJ A;  1AHE A;  1H0C A;  4ZLV A;  3JTX A;  3WLX A;  2BI3 A;  1C7G A;  1C0N A;  1UU2 A;  1X29 A;  3AEJ C;  1AHX A;  3FVS A;  3NTJ A;  5FT4 A;  4IXZ A;  1RV3 A;  2ZUK A;  1M4N A;  3MC6 A;  2ZP7 A;  3DZZ A;  5HXX A;  3BC8 A;  3FQ8 A;  4MQP A;  1BJO B;  2QB2 A;  5FT8 A;  4E1O A;  3VK3 A;  3CQ5 A;  3MC6 C;  4ZDL A;  1AY4 A;  2D66 A;  3RI6 A;  3A2B A;  3JZL A;  3HL2 A;  1MLY A;  1OHY A;  2FKI A;  3ZRQ A;  1WST A;  2W7M A;  5EFS A;  3FVU A;  3ZRR A;  4GDY A;  2VMU A;  1OHV A;  3JU7 A;  1TPL A;  3ZRP A;  1X28 A;  4XK1 A;  4UHO A;  1AHF A;  1CL2 A;  1WYT B;  2AAT A;  1BJN A;  1LC5 A;  2FQ6 A;  3FQA A;  1ASA A;  4F5J A;  1QIR A;  2VI9 A;  1JG8 A;  3KE3 A;  4GE9 A;  2PB2 A;  4GEB A;  2AEV A;  4AZK A;  2CFB A;  3RQ1 A;  5BJ4 A;  2V1P A;  3B1E A;  1ASM A;  2WK9 A;  2ZSL A;  1LW5 A;  1MGV A;  3P1T A;  5EAA A;  1QZ9 A;  4UHN A;  1PMM A;  1ASE A;  3AOV A;  2VYC A;  2JJF A;  1S07 A;  1AJS B;  2HP2 A;  2YKY A;  3DYD A;  4RM1 A;  3H14 A;  3TFT A;  1P3W A;  1BJO A;  3BB8 A;  2CAN A;  5M4D A;  1EQB A;  2RFV A;  3G8M A;  1IX8 A;  2VMS A;  3AEP A;  1N8P A;  2HOZ A;  2R2N A;  1B9H A;  4ZWM A;  4R8D A;  2V0Y A;  3E9K A;  4PIW A;  3UE8 A;  4A6R A;  3WCN A;  2AY6 A;  1IBJ A;  1WYT A;  2Z1Z A;  1BQA A;  4K2B A;  2QSR A;  2OKK A;  4WYA A;  1SF2 A;  4F5L A;  3F6T A;  2VMT A;  4NOG A;  3B1C A;  1SZS A;  4GE7 A;  1AX4 A;  1CQ7 A;  1AHG A;  3EI9 A;  3FDB A;  7AAT A;  4PFN A;  3NYU A;  4RLG A;  2VMY A;  4E3Q A;  3PDX A;  1PFF A;  1QJ3 A;  2W7I A;  5IWQ A;  4RJY A;  1D7R A;  2R0T A;  3FTB A;  2HOR A;  2JJG A;  2QA3 A;  4LNM A;  3LWS A;  5DB5 A;  3G7Q A;  5DX5 A;  2CJG A;  3EI8 A;  4MKK A;  1DFO A;  3E2Z A;  1EG5 A;  4P7Y A;  1QIT A;  3R9A A;  2W7H A;  4FL0 A;  2VGT A;  2EO5 A;  2PO3 A;  2AY9 A;  1W7L A;  3MAD A;  1SPA A;  4P3M A;  3W1I A;  5HDM A;  1B9I A;  1BJ4 A;  3N5M A;  3N75 A;  2HOX A;  3TFU A;  2CST A;  2VGV A;  1AMS A;  3A9X A;  4AO4 A;  3H9X A;  2BWO A;  4AZJ A;  4IW7 A;  2VMQ A;  2FNU A;  1U08 A;  2C0R A;  2YHK A;  3WKR A;  3HDO A;  3PDB A;  4WYC A;  1WYV B;  4W8I A;  1B8G A;  3BCX A;  2HUF A;  1C7N A;  2HUI A;  1D7U A;  4AOA A;  2DGM A;  1BW0 A;  3PPL A;  2QBT A;  4GRX A;  1M0P A;  4XAU A;  2ZY2 A;  2AY3 A;  1I41 A;  2C81 A;  1IAY A;  2Z67 A;  4ZM3 A;  2W7F A;  4K2M A;  3GSB A;  4JEW A;  4LNL A;  4M2K A;  3EIB A;  1D2F A;  2R5E A;  3VAX A;  4GSA A;  1G4V A;  1ARI A;  4BQ0 A;  3HQT A;  4F5M A;  3D6K A;  3LV2 A;  3A8U X;  1J04 A;  2HUU A;  3JWA A;  1T3I A;  1ELQ A;  1RVU A;  2AY8 A;  2D7Y A;  2OGA A;  4MY5 A;  4OYT A;  3N4X A;  3LVK A;  1E5F A;  1C9C A;  2E7J A;  4MQR A;  3WKS A;  2KFP A;  3QPG A;  2YKV A;  1ASB A;  2FYF A;  3L8A A;  3LVJ A;  2PB0 A;  1KAF A;  2DOU A;  1DJU A;  2VIB A;  4XQ2 A;  3ECD A;  2BIE A;  1WYV A;  2VMV A;  3CQ6 A;  4F5F A;  2R5C A;  3AEO A;  3KGW A;  4J5U A;  2OKJ A;  4Q6R A;  5LH9 A;  1CL1 A;  3GR9 A;  4MGR A;  2AY5 A;  1ARH A;  4WXB A;  3WZF A;  4K05 A;  2W7L A;  1D7S A;  1Y4I A;  1Z7D A;  2O0R A;  3FKD A;  1MDO A;  1TOG A;  2X3L A;  5EUD A;  2YOB A;  4Q75 A;  3P6K A;  2DGK A;  4E77 A;  1O61 A;  1W7N A;  1YIY A;  4XJP A;  2JJE A;  3DR7 A;  1ZOD A;  1IVR A;  2D61 A;  1AKB A;  3PAA A;  1LC8 A;  3KKI A;  3EI5 A;  3EIA A;  1XI9 A;  2W7G A;  3B8X A;  2QB3 A;  4W5K A;  1E5E A;  3HVY A;  4QGR A;  2FM1 A;  2VMR A;  4TN4 A;  1DGE A;  4A0H A;  2ZY3 A;  2AY7 A;  3LY1 A;  1IUG A;  1LKC A;  3K40 A;  2VGS A;  2BIA A;  1M32 A;  2W7E A;  3EUC A;  2VMN A;  3CBF A;  2W8J A;  3IHJ A;  2VLH A;  3GET A;  4OC9 A;  2BI9 A;  3DXV A;  1MDX A;  4B9B A;  2BI2 A;  2GMS A;  4LNJ A;  2AY2 A;  3N4R A;  1DJE A;  1FG7 A;  4PFF A;  1QJ5 A;  1ELU A;  4A0G A;  3E2Y A;  1UU1 A;  1ORD A;  1V72 A;  3R4T A;  3USF A;  1AJR A;  1IX6 A;  4AO9 A;  4WP0 A;  1YAA A;  3G0T A;  4CXQ A;  3N0L A;  4ZM4 A;  4I8A A;  3HBX A;  2WK8 A;  3GWP A;  4WXG A;  3RBL A;  4Y0D A;  1DGD A;  1SVV A;  1RVY A;  2E7I A;  8AAT A;  3WX9 A;  1KMK A;  3NU8 A;  3NYS A;  3FFR A;  4E3R A;  1O69 A;  4CXR A;  2W7D A;  3E2Z B;  2JIS A;  4WLH A;  4N0W A;  4XJL A;  2EYQ A;  3N7N A;  1DKA A;  3JW9 A;  2WB6 A;  4ATQ A;  3UWC A;  3BWN A;  4JEY A;  1PG8 A;  2CH2 A;  5E4Z A;  2ZY5 A;  4W1X A;  2VMX A;  2JGT A;  1RV4 A;  3BWN C;  3VOM A;  4FFC A;  4A72 A;  3MBB A;  4OCA A;  5G4J A;  5TF5 A;  4EU1 A;  3WY7 A;  2D7Z A;  3TAT A;  3NDN A;  4F5K A;  1AAM A;  2ORD A;  3PDB B;  1N2T A;  2E54 A;  4Q76 A;  4B98 A;  5HHY A;  2VMO A;  2D64 A;  4IYO B;  4ITG A;  1S06 A;  1YIZ A;  4F5G A;  3N4S A;  4ADC A;  1KMJ A;  2CH1 A;  3CAI A;  1CS1 A;  4LW2 A;  1G7X A;  5EQC A;  4ZAH A;  5LHA A;  2A1V A;  4H63 Q;  4A6U A;  3BV0 A;  1X2A A;  4Y0H A;  2OGE A;  4RJ0 A;  5E5I A;  1C4K A;  2CJD A;  4WYG A;  1W7M A;  2CIN A;  3NRA A;  1I48 A;  3QBO A;  2FNI A;  3FVX A;  4EB7 A;  2ZYJ A;  2E7U A;  5EIG A;  4WB0 B;  2W8T A;  4WXF A;  1FG3 A;  1M7Y A;  1ZOB A;  3CQ4 A;  4N0B A;  3QHX A;  2EZ1 A;  4MKJ A;  3EI7 A;  3RBF A;  3WGC A;  1ASC A;  1VEF A;  1AY5 A;  1TOI A;  2G7J A;  1SZU A;  1BJW A;  1CQ6 A;  1DJ9 A;  1BKG A;  3ACZ A;  1LS3 A;  2ZC0 A;  3F0H A;  3HT4 A;  3LVM A;  4TMR A;  4UHM A;  1TOJ A;  2R5C B;  2EZ2 A;  2D5Y A;  1ASL A;  2VGZ A;  1S09 A;  2ZY4 A; 
#chains in the Genus database with same CATH homology
 2X8U A;  3VK2 A;  2YKU A;  5K8B A;  1AIA A;  2BWN A;  4IYO A;  1Z3Z A;  3GBX A;  4DQ6 A;  2CY8 A;  4OTL A;  1W3U A;  2HP1 A;  4KXK A;  1G7W A;  5G0A A;  1LW4 A;  3IF2 A;  4ADD A;  1B5P A;  2VMP A;  3PIU A;  2O7C A;  3B1D A;  1MLZ A;  1YNU A;  1BS0 A;  1YOO A;  2Z61 A;  4GE4 A;  3RCH A;  3I4J A;  1QIS A;  1B4X A;  3HLM A;  3FCR A;  5M4B A;  1GEX A;  1V2E A;  4W91 A;  2VLF A;  2Z9U A;  4XJO A;  2NMP A;  5KTB A;  4KYO A;  1AIC A;  3NU7 A;  2CTZ A;  3W1J A;  1YJZ A;  4ADB A;  4ZDP A;  2VGU A;  4WB0 A;  2QMA A;  4IX8 A;  3FQ7 A;  3ELE A;  4MSO A;  4R2N A;  2HOY A;  2Z20 A;  4O6Z A;  1I43 A;  1KKJ A;  3BCB A;  1WYU A;  1AMA A;  3W1H A;  2EPJ A;  4AH3 A;  3FSL A;  3TCM A;  4EFF A;  4EMY A;  1MAQ A;  1V2D A;  2VGW A;  3DXW A;  3COG A;  2YKX A;  5D5S A;  1TOE A;  4F5H A;  1AMR A;  5DJ1 A;  4LC3 A;  1ASD A;  3MEB A;  4WD2 A;  3VP6 A;  1PMO A;  1EJI A;  2Z9V A;  2ZJG A;  4J8L A;  3II0 A;  1XEY A;  3EZ1 A;  2O1B A;  1OAT A;  2BI5 A;  1AHY A;  4M2J A;  4W1W A;  5F8V A;  3VK4 A;  1UKJ A;  3L44 A;  2YRI A;  1VP4 A;  1KL2 A;  2FN6 A;  3OP7 A;  4RIT A;  4HVK A;  2BHX A;  2HZP A;  4U2H A;  5I92 A;  3PGY A;  2WKA A;  4CBS A;  1SZK A;  1SFF A;  4RKC A;  1IX7 A;  2GMU A;  2GB3 A;  2AY4 A;  5G2Q A;  2TPL A;  3NUB A;  1GC3 A;  2Z1Y A;  3QGU A;  4OT8 A;  4WYD A;  2DGL A;  2GSA A;  2BI1 A;  4JEX A;  4DGT A;  4ZWV A;  1LK9 A;  1O4S A;  4BA5 A;  2W7J A;  2X5F A;  4IXS A;  2EH6 A;  2W7K A;  1W23 A;  1G4X A;  1X0M A;  3MAF A;  4TV7 A;  5M49 A;  3F9T A;  2X5D A;  2YCT A;  1GD9 A;  3FZ8 A;  4KAM A;  4R5F A;  4WBT A;  1BT4 A;  2DKB A;  5FT6 A;  4CVQ A;  1M0N A;  1WKH A;  5G4I A;  1GEW A;  1J32 A;  3LG0 A;  3AAT A;  2XBN A;  4WYE A;  1MDZ A;  1AMQ A;  3MKJ A;  5G2P A;  4U1T A;  1D7V A;  1AIB A;  3ZZJ A;  4A0F A;  4XJM A;  2AY1 A;  4IXO A;  4JF0 A;  3PD6 A;  1JS6 A;  2VMW A;  3HMU A;  1LC7 A;  1TAR A;  4ADE A;  2W8V A;  2W8U A;  2VMZ A;  2DKJ A;  3MAU A;  2XH1 A;  3ASB A;  3E2F A;  2YRR A;  3EZS A;  4M2M A;  4MQQ A;  2OQX A;  5EIG B;  4JE5 D;  4OMA A;  2WK7 A;  1CZE A;  1IAX A;  2BKW A;  5EUN A;  2OAT A;  5DJ9 A;  4R5Z A;  3ATH A;  1KL1 A;  3JWB A;  1KKP A;  2D65 A;  3E77 A;  1TOK A;  4PVF A;  9AAT A;  3NNK A;  4BHD A;  3B46 A;  3BN1 A;  3I5T A;  5D95 A;  4JF1 A;  3DU4 A;  3AOW A;  1OXO A;  1C7O A;  4ITX A;  1AY8 A;  4IY7 A;  3I16 A;  3DOD A;  1ARS A;  1TAT A;  4XEW A;  4BMK A;  3RCH B;  3AEN B;  1ZC9 A;  1UU0 A;  2Q7W A;  1O62 A;  5JAY A;  1YJS A;  2BWP A;  1AKC A;  3E6G A;  4ATP A;  1YJY A;  4ISY A;  2Z9W A;  1QGN A;  2C44 A;  2ZSM A;  3GZC A;  3OKS A;  4BA4 A;  3K28 A;  1M0O A;  1N31 A;  3QN6 A;  3DR4 A;  3A9Y A;  3GZD A;  3H7F A;  3PA9 A;  5J8Q A;  1TAS A;  1FC4 A;  3DRD A;  3TQX A;  4Q31 A;  1ART A;  1WYU B;  1M0Q A;  2VI8 A;  3WCO A;  3GZD C;  3RUY A;  4WLJ A;  5AX8 A;  5FT5 A;  1GC4 A;  1AJS A;  1MAP A;  1S08 A;  2BIG A;  3BCA A;  3FZ6 A;  3ASA A;  1S0A A;  3BWO A;  3PJ0 A;  2C7T A;  4CBR A;  1GCK A;  1GEY A;  4UOY A;  4ZAS A;  3T32 A;  1ASF A;  1ASG A;  1DTY A;  2F8J A;  3M5U A;  3NX3 A;  4OBU A;  4RAE A;  1VJO A;  4UQV A;  3AEN A;  4Y0I A;  1JF9 A;  2CB1 A;  4A00 A;  5BJ3 A;  2BYL A;  1GC2 A;  2VIA A;  4F5I A;  1OHW A;  3FRK A;  5G09 A;  3LVL B;  1OXP A;  4K2I A;  3GJU A;  5F9S A;  2JJH A;  3FDD A;  1ECX A;  4L0O A;  2EGY A;  4ZSY A;  1AAW A;  2DR1 A;  1V2F A;  5M46 A;  3Q8N A;  3QM2 A;  4WYF A;  3WGB A;  4JEV A;  4OBV A;  3ISL A;  4EB5 A;  2YCP A;  3AV7 A;  3ZZK A;  3QI6 A;  4ZSW A;  3FD0 A;  3DC1 A;  1B5O A;  2CJH A;  5C6U A;  3K7Y A;  1BQD A;  3MAF B;  4A6T A;  2D63 A;  1GC0 A;  4JE5 A;  2Z9X A;  3EI6 A;  1CJ0 A;  4HF8 A;  1GDE A;  3NUI A;  1CQ8 A;  2BYJ A;  2AEU A;  1AKA A;  4W1V A;  3NYT A;  2GQN A;  1JS3 A;  4LW4 A;  4RKD A;  4F4E A;  1ASN A;  2QLR A;  4ZDO A;  1H1C A;  3ELP A;  1M6S A;  2W8W A;  2YCN A;  3AEM A;  1GBN A;  4JEZ A;  1IJI A;  1I29 A;  3PD6 B;  3FFH A;  5E3K A;  1ARG A;  3A9Z A;  5EAV A;  4A0R A;  2JG2 A;  3AEL A;  3BS8 A;  3FZ7 A;  3KGX A;  1WKG A;  5EUE A;  3AEM C;  4DBC A;  1CZC A;  4H51 A;  2G6W A;  3UAK A;  4RIZ A;  3AEJ A;  1AHE A;  1H0C A;  4ZLV A;  3JTX A;  3WLX A;  2BI3 A;  1C7G A;  1C0N A;  1UU2 A;  1X29 A;  3AEJ C;  1AHX A;  3FVS A;  3NTJ A;  5FT4 A;  4IXZ A;  1RV3 A;  2ZUK A;  1M4N A;  3MC6 A;  2ZP7 A;  3DZZ A;  5HXX A;  3BC8 A;  3FQ8 A;  4MQP A;  1BJO B;  2QB2 A;  5FT8 A;  4E1O A;  3VK3 A;  3CQ5 A;  3MC6 C;  4ZDL A;  1AY4 A;  2D66 A;  3RI6 A;  3A2B A;  3JZL A;  3HL2 A;  1MLY A;  1OHY A;  2FKI A;  3ZRQ A;  1WST A;  2W7M A;  5EFS A;  3FVU A;  3ZRR A;  4GDY A;  2VMU A;  1OHV A;  3JU7 A;  1TPL A;  3ZRP A;  1X28 A;  4XK1 A;  4UHO A;  1AHF A;  1CL2 A;  1WYT B;  2AAT A;  1BJN A;  1LC5 A;  2FQ6 A;  3FQA A;  1ASA A;  4F5J A;  1QIR A;  2VI9 A;  1JG8 A;  3KE3 A;  4GE9 A;  2PB2 A;  4GEB A;  2AEV A;  4AZK A;  2CFB A;  3RQ1 A;  5BJ4 A;  2V1P A;  3B1E A;  1ASM A;  2WK9 A;  2ZSL A;  1LW5 A;  1MGV A;  3P1T A;  5EAA A;  1QZ9 A;  4UHN A;  1PMM A;  1ASE A;  3AOV A;  2VYC A;  2JJF A;  1S07 A;  1AJS B;  2HP2 A;  2YKY A;  3DYD A;  4RM1 A;  3H14 A;  3TFT A;  1P3W A;  1BJO A;  3BB8 A;  2CAN A;  5M4D A;  1EQB A;  2RFV A;  3G8M A;  1IX8 A;  2VMS A;  3AEP A;  1N8P A;  2HOZ A;  2R2N A;  1B9H A;  4ZWM A;  4R8D A;  2V0Y A;  3E9K A;  4PIW A;  3UE8 A;  4A6R A;  3WCN A;  2AY6 A;  1IBJ A;  1WYT A;  2Z1Z A;  1BQA A;  4K2B A;  2QSR A;  2OKK A;  4WYA A;  1SF2 A;  4F5L A;  3F6T A;  2VMT A;  4NOG A;  3B1C A;  1SZS A;  4GE7 A;  1AX4 A;  1CQ7 A;  1AHG A;  3EI9 A;  3FDB A;  7AAT A;  4PFN A;  3NYU A;  4RLG A;  2VMY A;  4E3Q A;  3PDX A;  1PFF A;  1QJ3 A;  2W7I A;  5IWQ A;  4RJY A;  1D7R A;  2R0T A;  3FTB A;  2HOR A;  2JJG A;  2QA3 A;  4LNM A;  3LWS A;  5DB5 A;  3G7Q A;  5DX5 A;  2CJG A;  3EI8 A;  4MKK A;  1DFO A;  3E2Z A;  1EG5 A;  4P7Y A;  1QIT A;  3R9A A;  2W7H A;  4FL0 A;  2VGT A;  2EO5 A;  2PO3 A;  2AY9 A;  1W7L A;  3MAD A;  1SPA A;  4P3M A;  3W1I A;  5HDM A;  1B9I A;  1BJ4 A;  3N5M A;  3N75 A;  2HOX A;  3TFU A;  2CST A;  2VGV A;  1AMS A;  3A9X A;  4AO4 A;  3H9X A;  2BWO A;  4AZJ A;  4IW7 A;  2VMQ A;  2FNU A;  1U08 A;  2C0R A;  2YHK A;  3WKR A;  3HDO A;  3PDB A;  4WYC A;  1WYV B;  4W8I A;  1B8G A;  3BCX A;  2HUF A;  1C7N A;  2HUI A;  1D7U A;  4AOA A;  2DGM A;  1BW0 A;  3PPL A;  2QBT A;  4GRX A;  1M0P A;  4XAU A;  2ZY2 A;  2AY3 A;  1I41 A;  2C81 A;  1IAY A;  2Z67 A;  4ZM3 A;  2W7F A;  4K2M A;  3GSB A;  4JEW A;  4LNL A;  4M2K A;  3EIB A;  1D2F A;  2R5E A;  3VAX A;  4GSA A;  1G4V A;  1ARI A;  4BQ0 A;  3HQT A;  4F5M A;  3D6K A;  3LV2 A;  3A8U X;  1J04 A;  2HUU A;  3JWA A;  1T3I A;  1ELQ A;  1RVU A;  2AY8 A;  2D7Y A;  2OGA A;  4MY5 A;  4OYT A;  3N4X A;  3LVK A;  1E5F A;  1C9C A;  2E7J A;  4MQR A;  3WKS A;  2KFP A;  3QPG A;  2YKV A;  1ASB A;  2FYF A;  3L8A A;  3LVJ A;  2PB0 A;  2DOU A;  1DJU A;  2VIB A;  4XQ2 A;  3ECD A;  2BIE A;  1WYV A;  2VMV A;  3CQ6 A;  4F5F A;  2R5C A;  3AEO A;  3KGW A;  4J5U A;  2OKJ A;  4Q6R A;  5LH9 A;  1CL1 A;  3GR9 A;  4MGR A;  2AY5 A;  1ARH A;  4WXB A;  3WZF A;  4K05 A;  2W7L A;  1D7S A;  1Y4I A;  1Z7D A;  2O0R A;  3FKD A;  1MDO A;  1TOG A;  2X3L A;  5EUD A;  2YOB A;  4Q75 A;  3P6K A;  2DGK A;  4E77 A;  1O61 A;  1W7N A;  1YIY A;  4XJP A;  2JJE A;  3DR7 A;  1ZOD A;  1IVR A;  2D61 A;  1AKB A;  3PAA A;  1LC8 A;  3KKI A;  3EI5 A;  3EIA A;  1XI9 A;  2W7G A;  3B8X A;  2QB3 A;  4W5K A;  1E5E A;  3HVY A;  4QGR A;  2FM1 A;  2VMR A;  4TN4 A;  1DGE A;  4A0H A;  2ZY3 A;  2AY7 A;  3LY1 A;  1IUG A;  1LKC A;  3K40 A;  2VGS A;  2BIA A;  1M32 A;  2W7E A;  3EUC A;  2VMN A;  3CBF A;  2W8J A;  3IHJ A;  2VLH A;  3GET A;  4OC9 A;  2BI9 A;  3DXV A;  1MDX A;  4B9B A;  2BI2 A;  2GMS A;  4LNJ A;  2AY2 A;  3N4R A;  1DJE A;  1FG7 A;  4PFF A;  1QJ5 A;  1ELU A;  4A0G A;  3E2Y A;  1UU1 A;  1ORD A;  1V72 A;  3R4T A;  3USF A;  1AJR A;  1IX6 A;  4AO9 A;  4WP0 A;  1YAA A;  3G0T A;  4CXQ A;  3N0L A;  4ZM4 A;  4I8A A;  3HBX A;  2WK8 A;  3GWP A;  4WXG A;  3RBL A;  4Y0D A;  1DGD A;  1SVV A;  1RVY A;  2E7I A;  8AAT A;  3WX9 A;  1KMK A;  3NU8 A;  3NYS A;  3FFR A;  4E3R A;  1O69 A;  4CXR A;  2W7D A;  3E2Z B;  2JIS A;  4WLH A;  4N0W A;  4XJL A;  2EYQ A;  3N7N A;  1DKA A;  3JW9 A;  2WB6 A;  4ATQ A;  3UWC A;  3BWN A;  4JEY A;  1PG8 A;  2CH2 A;  5E4Z A;  2ZY5 A;  4W1X A;  2VMX A;  2JGT A;  1RV4 A;  3BWN C;  3VOM A;  4FFC A;  4A72 A;  3MBB A;  4OCA A;  5G4J A;  5TF5 A;  4EU1 A;  3WY7 A;  2D7Z A;  3TAT A;  3NDN A;  4F5K A;  1AAM A;  2ORD A;  3PDB B;  1N2T A;  2E54 A;  4Q76 A;  4B98 A;  5HHY A;  2VMO A;  2D64 A;  4IYO B;  4ITG A;  1S06 A;  1YIZ A;  4F5G A;  3N4S A;  4ADC A;  1KMJ A;  2CH1 A;  3CAI A;  1CS1 A;  4LW2 A;  1G7X A;  5EQC A;  4ZAH A;  5LHA A;  2A1V A;  4H63 Q;  4A6U A;  3BV0 A;  1X2A A;  4Y0H A;  2OGE A;  4RJ0 A;  5E5I A;  1C4K A;  2CJD A;  4WYG A;  1W7M A;  2CIN A;  3NRA A;  1I48 A;  3QBO A;  2FNI A;  3FVX A;  4EB7 A;  2ZYJ A;  2E7U A;  5EIG A;  4WB0 B;  2W8T A;  4WXF A;  1FG3 A;  1M7Y A;  1ZOB A;  3CQ4 A;  4N0B A;  3QHX A;  2EZ1 A;  4MKJ A;  3EI7 A;  3RBF A;  3WGC A;  1ASC A;  1VEF A;  1AY5 A;  1TOI A;  2G7J A;  1SZU A;  1BJW A;  1CQ6 A;  1DJ9 A;  1BKG A;  3ACZ A;  1LS3 A;  2ZC0 A;  3F0H A;  3HT4 A;  3LVM A;  4TMR A;  4UHM A;  1TOJ A;  2R5C B;  2EZ2 A;  2D5Y A;  1ASL A;  2VGZ A;  1S09 A;  2ZY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...