8AATA

X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 150
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1991-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 8aatA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 8aatA01
1GBNA 5EUNA 2BWPA 1O62A 2Z9VA 3DZZA 3R4TA 2AATA 4GE7A 2BHXA 3EI8A 4TV7A 4U1TA 3PD6B 2R5EA 4K2MA 4K2BA 5EAAA 5FT8A 2CB1A 4JF1A 3RBFA 4XQ2A 3GZDA 4IXZA 3II0A 4XJMA 2CINA 2VMNA 4MQQA 1S08A 1TOGA 4AO4A 2D61A 3QI6A 3WGBA 1AKAA 1TARA 1M0NA 2W7KA 1XEYA 4OCAA 1ARTA 1Z3ZA 3W1IA 4F4EA 3HDOA 1SF2A 1S0AA 5EQCA 3HMUA 3JTXA 3NTJA 4LNJA 1SPAA 1X2AA 1ARHA 2FQ6A 2GMSA 1LS3A 4DGTA 5G4JA 4MSOA 1AY4A 4WYFA 3LY1A 4CVQA 1BJOA 3G0TA 1H1CA 1N2TA 1EJIA 1KMJA 2FN6A 1BS0A 2D66A 2VMRA 3A9ZA 3FQ8A 3K7YA 3P6KA 4BA5A 1OXOA 3NU7A 3D6KA 2VIAA 2VLHA 1LW4A 1CL1A 3ELEA 1D7SA 3DR7A 2BIGA 1DJ9A 3H14A 3MAFB 1GEYA 4PFNA 1GC4A 3FFHA 3AATA 1RV4A 3DC1A 4GDYA 4LW4A 1IVRA 4QGRA 1GD9A 3MKJA 1CZCA 3ZZJA 3VP6A 4J8LA 2OKKA 4LC3A 3UE8A 4P7YA 3EI6A 4WB0B 3DODA 3BS8A 4WLJA 2AY7A 2VIBA 5HXXA 1P3WA 4UHOA 3PIUA 2RFVA 1ASAA 2OATA 3GWPA 1GC0A 3B1EA 4XJOA 1LC5A 1MDXA 2DKBA 3BCXA 4ADCA 3RI6A 1AMQA 3NYUA 2AEVA 2CJGA 5FT6A 2YCTA 4PFFA 4W1WA 1TOIA 3CQ5A 3FFRA 2YCNA 3BV0A 3NYTA 2AY6A 1WYTA 2YOBA 1GCKA 2AY2A 3A8UX 2G6WA 4OMAA 4L0OA 5HHYA 1M0QA 2W8VA 3KE3A 4BMKA 3I16A 4RAEA 2E7IA 4DBCA 4R2NA 1TATA 4A6TA 1AX4A 4ZDPA 5BJ4A 1OHYA 2C7TA 3FSLA 2X3LA 2VYCA 3TQXA 1TPLA 3AEPA 1ASBA 1B4XA 2ZP7A 3QHXA 3AOVA 3COGA 4F5LA 5EUEA 2CY8A 3JU7A 2EH6A 2VMOA 4WP0A 1AHXA 3QN6A 3RUYA 2BWNA 1T3IA 1QGNA 1DJUA 1PMOA 2BI1A 4O6ZA 2W7MA 1FG7A 4AZJA 3PA9A 1JF9A 1ZOBA 2OGAA 4XJPA 1RV3A 1SZUA 3EI5A 1TOJA 1AMSA 2CJDA 3G7QA 4F5JA 3N5MA 1ARGA 2HOXA 1DGEA 1OHWA 4R5FA 4F5MA 2ZSMA 3HL2A 1ASFA 1SVVA 1IUGA 1JG8A 2YKYA 1BT4A 4E3RA 1CL2A 3AEJC 3B1DA 3BN1A 3BWNC 1D7RA 4ZM4A 2ZY4A 3PDBB 1M0PA 1AICA 1CQ7A 3EZ1A 3GZCA 4IYOB 4ADBA 2CFBA 4R5ZA 1W3UA 9AATA 1ORDA 3K28A 4Q75A 3CBFA 4K2IA 3ATHA 1BJNA 1FG3A 2D5YA 2YKXA 1TOEA 1W7NA 4W1XA 2HUFA 2Z9UA 1DGDA 1UU1A 2O0RA 2DKJA 2GMUA 2AEUA 3ZZKA 4WD2A 4CXRA 2VGUA 4A0HA 1GC2A 3JZLA 2WK7A 2XH1A 1BW0A 2D64A 4IXOA 3DXWA 3MADA 1AAMA 1BJ4A 1CJ0A 3UWCA 1ZC9A 3PAAA 1XI9A 1N8PA 2HP1A 3L8AA 2AY1A 4WYEA 4TMRA 2ZY5A 3AV7A 3JWAA 1Y4IA 4F5KA 4XJLA 2W7LA 1GDEA 2Z1YA 4WYAA 1ELQA 1VP4A 4KAMA 3EIBA 4WXGA 3PD6A 2Z1ZA 3PPLA 4W1VA 3EUCA 3FQAA 2C81A 1WYTB 2PO3A 1DJEA 1D7VA 2O1BA 3FVSA 4MQRA 4ZLVA 4A0FA 2BI2A 1KL2A 4ZWMA 3HQTA 3PGYA 4A6RA 2W8WA 4WLHA 1C7GA 3NUBA 1LC8A 2EZ1A 5G4IA 1UU2A 5G2QA 5M4DA 4N0WA 1ECXA 2WK9A 3AELA 3E6GA 3LV2A 4FFCA 1S09A 4GEBA 4JE5D 3W1JA 3FQ7A 1QJ5A 2HORA 3WY7A 1C7OA 2VMYA 4M2MA 2AY3A 4W8IA 4HF8A 4XK1A 4R8DA 1I48A 1O61A 4WB0A 2E7JA 1MAPA 1PMMA 2QLRA 2VI8A 2ZSLA 1SZKA 2VMWA 1I43A 3KKIA 5EUDA 2BI9A 3W1HA 5M46A 2R2NA 2CSTA 2VI9A 1JS6A 3QM2A 1MLYA 3G8MA 4JEZA 3MAFA 3FZ6A 1PFFA 2W7FA 5M4BA 1B9IA 4ITXA 5AX8A 4U2HA 3N0LA 1YAAA 2OKJA 2EO5A 1QITA 3PDBA 2Q7WA 3GR9A 5E4ZA 3FZ8A 3ZRRA 3CQ4A 1MGVA 1BJOB 3AEJA 4AH3A 3E77A 1AAWA 2Z67A 4EU1A 1G7XA 3WKRA 1V2FA 1SFFA 3MBBA 5EIGB 1PG8A 3ELPA 3F6TA 5EAVA 3OKSA 5EIGA 4AZKA 3RBLA 5BJ3A 4M2JA 5J8QA 3T32A 4ZAHA 2R5CB 2BIEA 3JWBA 5DB5A 1W23A 3UAKA 3NRAA 1W7MA 1AHGA 2V1PA 3NDNA 4ATQA 1E5EA 2NMPA 2VMTA 3A9XA 4WBTA 1AIBA 3NUIA 3R9AA 2YRIA 1ZODA 1D2FA 2W8UA 1BKGA 4JEXA 1WYVB 2YHKA 4LNMA 3N75A 3K40A 1ASNA 2C0RA 2DOUA 4A6UA 2VGTA 1ASEA 2VMZA 4MGRA 2VMSA 1G4XA 4A0RA 2ZUKA 1B5PA 1MDOA 4PVFA 3BCAA 5C6UA 3GETA 2ZY2A 2JJFA 1N31A 4ITGA 1AHYA 4BHDA 4ADDA 4IW7A 4MQPA 1X29A 2E7UA 3F9TA 1ASGA 2Z61A 1D7UA 1DKAA 4E1OA 2FNIA 5E5IA 4JEWA 3LVJA 3LVMA 3FZ7A 4Q31A 1YIZA 2E54A 1I29A 1M4NA 2FM1A 4OTLA 2W8JA 2BYJA 4EB7A 2XBNA 4ZDLA 4KXKA 3WCOA 1AJSB 5M49A 4IXSA 2X5FA 5DJ9A 4GSAA 3FDDA 1J04A 1X0MA 2V0YA 3TCMA 1BQAA 3MC6A 4JEVA 4ADEA 4A72A 4UQVA 2VGWA 3NNKA 4MY5A 1JS3A 1YJZA 3EI7A 3B46A 5LH9A 4AOAA 1V2DA 3AOWA 3HT4A 1EQBA 3HBXA 1M0OA 4MKKA 2HP2A 1B9HA 2BI3A 1YIYA 2D65A 5F9SA 3F0HA 4F5GA 4WXBA 1AHFA 3BWNA 1O4SA 3AENB 2VMPA 2W8TA 2X5DA 4WYDA 4ZM3A 3CAIA 4EMYA 1GEWA 1AY8A 2BKWA 4E77A 1IX6A 4CXQA 3KGWA 1LC7A 1S07A 1CS1A 3AEMA 5EFSA 3QBOA 4RIZA 5G09A 3Q8NA 2VGSA 5LHAA 1J32A 3NX3A 3E2YA 4KYOA 3EI9A 3MC6C 4BA4A 2Z9WA 4JF0A 2JISA 8AATA 2GB3A 3LVLB 1VEFA 4DQ6A 1M7YA 3MEBA 3RCHB 7AATA 2WKAA 1G7WA 1KMKA 5E3KA 1QIRA 4RM1A 3ASAA 4H51A 3ZRQA 3AEOA 1UKJA 3H7FA 3L44A 2VGVA 4ZSWA 3IHJA 3P1TA 2W7HA 3ECDA 2VLFA 1BJWA 1WSTA 2PB2A 1E5FA 2D63A 4XEWA 3WX9A 1CZEA 1CQ8A 3ASBA 3RQ1A 1M32A 2QB2A 3BB8A 4B98A 4RLGA 1AJSA 4OBUA 1CQ6A 1KKPA 5FT5A 2F8JA 1H0CA 2W7JA 3PJ0A 3ACZA 1U08A 3I4JA 4MKJA 4RJ0A 3GJUA 4P3MA 3TFUA 4OT8A 1AMRA 4IYOA 5DX5A 3WCNA 4W91A 1WKGA 2FNUA 3I5TA 1ASLA 2JGTA 4RJYA 3FRKA 1IAXA 5D5SA 1LK9A 4FL0A 1YJYA 1C4KA 1BQDA 1GEXA 3E9KA 4ZDOA 4GE4A 1IBJA 3LWSA 4RITA 1FC4A 4ZWVA 4RKDA 4EB5A 2HUIA 1Z7DA 4ZASA 4E3QA 5IWQA 3PDXA 4A00A 3FD0A 2EGYA 3GZDC 1B5OA 1G4VA 4OYTA 4A0GA 4HVKA 1ARIA 4CBSA 4IY7A 5F8VA 5I92A 4GRXA 1IX8A 3VOMA 1ARSA 1AHEA 2CANA 3FTBA 2DGKA 2HOYA 3GBXA 4ATPA 1RVYA 4Q76A 1AKCA 2W7DA 4JE5A 1MLZA 4F5IA 2D7YA 3JW9A 1UU0A 3QGUA 3A9YA 1AJRA 1QISA 2R5CA 2JG2A 1W7LA 3A2BA 1M6SA 2D7ZA 4WXFA 4ISYA 1RVUA 5DJ1A 1LW5A 3FDBA 4B9BA 1O69A 3M5UA 5K8BA 2VMVA 1C7NA 1ELUA 2HZPA 3IF2A 4Y0DA 3EIAA 2W7IA 2EPJA 1GC3A 4AO9A 2QA3A 4WYGA 4LNLA 1QJ3A 1V72A 2YRRA 2JJGA 3FCRA 3FVXA 2W7EA 4XAUA 3AEMC 1LKCA 1YOOA 1MDZA 3DXVA 1C9CA 1C0NA 1IJIA 1QZ9A 5D95A 2BYLA 2AY9A 2W7GA 3LG0A 1OATA 1AIAA 3E2ZB 2QBTA 1KKJA 1ASCA 2GQNA 3B8XA 2HOZA 2JJHA 5HDMA 1DFOA 4GE9A 4NOGA 4OC9A 4UHMA 4CBRA 2EZ2A 1TASA 1YJSA 1ASMA 2TPLA 4ZSYA 1YNUA 3ZRPA 1MAQA 2DGMA 2JJEA 4UOYA 3VK2A 3NU8A 2Z20A 2ZJGA 2AY4A 4W5KA 1VJOA 2ORDA 2DR1A 3GSBA 3TFTA 2ZYJA 4IX8A 2FYFA 2VGZA 5G0AA 3VAXA 3EZSA 2CH2A 2CTZA 3HVYA 1WYUA 4PIWA 1OHVA 3KGXA 3VK4A 3E2FA 1EG5A 3FVUA 1AKBA 1IX7A 3BC8A 2AY8A 3OP7A 1AMAA 3CQ6A 4I8AA 3DR4A 3FKDA 2OGEA 3ISLA 2WK8A 1OXPA 2QMAA 3VK3A 2X8UA 4LW2A 5TF5A 1SZSA 4Y0IA 4WYCA 4BQ0A 3QPGA 1IAYA 4M2KA 2ZC0A 4J5UA 5G2PA 3DYDA 3MAUA 3WKSA 4Y0HA 4EFFA 1S06A 2BWOA 1TOKA 2CJHA 1WYUB 2HUUA 3AENA 2CH1A 2BI5A 2VMQA 4Q6RA 1ASDA 4N0BA 2DGLA 1WYVA 2VMUA 2R0TA 1X28A 1DTYA 1B8GA 2OQXA 4F5FA 3LVKA 2YCPA 3TATA 2C44A 4OBVA 5JAYA 3NYSA 2QB3A 2YKVA 2Z9XA 3DRDA 3DU4A 3BWOA 3HLMA 2AY5A 4TN4A 1I41A 1WKHA 4RKCA 2BIAA 4F5HA 2ZY3A 2O7CA 3E2ZA 2GSAA 1AY5A 4UHNA 3RCHA 3WLXA 3BCBA 1V2EA 5FT4A 3USFA 3WGCA 1KL1A 2PB0A 3B1CA 3WZFA 2YKUA 2VMXA 4JEYA
chains in the Genus database with same CATH superfamily
1GBNA 2EYQA 5EUNA 2BWPA 1O62A 2Z9VA 3DZZA 3R4TA 2AATA 4GE7A 2BHXA 3EI8A 4TV7A 4U1TA 3PD6B 2R5EA 4K2MA 4K2BA 5EAAA 5FT8A 2CB1A 4JF1A 3RBFA 4XQ2A 3GZDA 4IXZA 3II0A 4XJMA 2CINA 2VMNA 4MQQA 1S08A 1TOGA 1KAFA 4AO4A 2D61A 3QI6A 3WGBA 1AKAA 1TARA 1M0NA 2W7KA 1XEYA 4OCAA 1ARTA 1Z3ZA 3W1IA 4F4EA 3HDOA 1SF2A 1S0AA 5EQCA 3HMUA 3JTXA 3NTJA 4LNJA 1SPAA 1X2AA 1ARHA 2FQ6A 2GMSA 1LS3A 4DGTA 5G4JA 4MSOA 1AY4A 4WYFA 3LY1A 4CVQA 1BJOA 3G0TA 1H1CA 1N2TA 1EJIA 1KMJA 2FN6A 1BS0A 2D66A 2VMRA 3A9ZA 3FQ8A 3K7YA 3P6KA 4BA5A 1OXOA 3NU7A 3D6KA 2VIAA 2VLHA 1LW4A 1CL1A 3ELEA 1D7SA 3DR7A 2BIGA 1DJ9A 3H14A 3MAFB 1GEYA 4PFNA 1GC4A 3FFHA 3AATA 1RV4A 3DC1A 4GDYA 4LW4A 1IVRA 4QGRA 4H63Q 1GD9A 3MKJA 1CZCA 3ZZJA 3VP6A 4J8LA 2OKKA 4LC3A 3UE8A 4P7YA 3EI6A 4WB0B 3DODA 3BS8A 4WLJA 2AY7A 2VIBA 5HXXA 1P3WA 4UHOA 3PIUA 2RFVA 1ASAA 2OATA 3GWPA 1GC0A 3B1EA 4XJOA 1LC5A 1MDXA 2DKBA 3BCXA 4ADCA 3RI6A 1AMQA 3NYUA 2AEVA 2CJGA 5FT6A 2YCTA 4PFFA 4W1WA 1TOIA 3CQ5A 3FFRA 2YCNA 3BV0A 3NYTA 2AY6A 1WYTA 2YOBA 1GCKA 2AY2A 3A8UX 2G6WA 4OMAA 4L0OA 5HHYA 1M0QA 2W8VA 3KE3A 4BMKA 5KTBA 3I16A 4RAEA 2E7IA 4DBCA 4R2NA 1TATA 4A6TA 1AX4A 4ZDPA 5BJ4A 1OHYA 2C7TA 3FSLA 2X3LA 2VYCA 3TQXA 1TPLA 3AEPA 1ASBA 1B4XA 2ZP7A 3QHXA 3AOVA 3COGA 4F5LA 5EUEA 2CY8A 3JU7A 2EH6A 2VMOA 4WP0A 1AHXA 3QN6A 3RUYA 2BWNA 1T3IA 3N7NA 1QGNA 1DJUA 1PMOA 2BI1A 4O6ZA 2W7MA 1FG7A 2WB6A 4AZJA 3PA9A 1JF9A 1ZOBA 2OGAA 4XJPA 1RV3A 1SZUA 3EI5A 1TOJA 1AMSA 2CJDA 3G7QA 4F5JA 3N5MA 1ARGA 2HOXA 1DGEA 1OHWA 4R5FA 4F5MA 2ZSMA 3HL2A 1ASFA 1SVVA 1IUGA 1JG8A 2YKYA 1BT4A 4E3RA 1CL2A 3AEJC 3B1DA 3BN1A 3BWNC 1D7RA 4ZM4A 2ZY4A 3PDBB 1M0PA 1AICA 1CQ7A 3EZ1A 3GZCA 4IYOB 4ADBA 2CFBA 4R5ZA 1W3UA 9AATA 1ORDA 3K28A 4Q75A 3CBFA 4K2IA 3ATHA 1BJNA 1FG3A 2D5YA 2YKXA 1TOEA 1W7NA 4W1XA 2HUFA 2Z9UA 1DGDA 1UU1A 2O0RA 2DKJA 2GMUA 2AEUA 3ZZKA 4WD2A 4CXRA 2VGUA 4A0HA 1GC2A 3JZLA 2WK7A 2XH1A 1BW0A 2D64A 4IXOA 3DXWA 3MADA 1AAMA 1BJ4A 1CJ0A 3UWCA 1ZC9A 3PAAA 1XI9A 1N8PA 2HP1A 3L8AA 2G7JA 2AY1A 4WYEA 4TMRA 2ZY5A 3AV7A 3JWAA 1Y4IA 4F5KA 4XJLA 2W7LA 1GDEA 2Z1YA 4WYAA 1ELQA 1VP4A 4KAMA 3EIBA 4WXGA 3PD6A 2Z1ZA 3PPLA 4W1VA 3EUCA 3FQAA 2C81A 1WYTB 2PO3A 1DJEA 1D7VA 2O1BA 3FVSA 4MQRA 4ZLVA 4A0FA 2BI2A 1KL2A 4ZWMA 3HQTA 3PGYA 4A6RA 2W8WA 3N4SA 4WLHA 1C7GA 3NUBA 1LC8A 2EZ1A 5G4IA 1UU2A 5G2QA 5M4DA 4N0WA 1ECXA 2WK9A 3AELA 3E6GA 3LV2A 4FFCA 1S09A 4GEBA 4JE5D 3W1JA 3FQ7A 1QJ5A 2HORA 3WY7A 1C7OA 2VMYA 4M2MA 2AY3A 4W8IA 4HF8A 4XK1A 4R8DA 1I48A 1O61A 4WB0A 2E7JA 1MAPA 1PMMA 2QLRA 2VI8A 2ZSLA 1SZKA 2VMWA 1I43A 3KKIA 5EUDA 2BI9A 3W1HA 5M46A 2R2NA 2CSTA 2VI9A 1JS6A 3QM2A 1MLYA 3G8MA 4JEZA 3MAFA 3FZ6A 1PFFA 2W7FA 5M4BA 1B9IA 4ITXA 5AX8A 4U2HA 3N0LA 1YAAA 2OKJA 2EO5A 1QITA 3PDBA 2Q7WA 3GR9A 5E4ZA 3H9XA 3FZ8A 3ZRRA 3CQ4A 1MGVA 1BJOB 3AEJA 4AH3A 3E77A 1AAWA 2Z67A 4EU1A 3N4XA 1G7XA 3WKRA 1V2FA 1SFFA 3MBBA 5EIGB 1PG8A 3ELPA 3F6TA 5EAVA 3OKSA 5EIGA 4AZKA 3RBLA 5BJ3A 4M2JA 5J8QA 3T32A 4ZAHA 2R5CB 2BIEA 3JWBA 5DB5A 1W23A 3UAKA 3NRAA 1W7MA 1AHGA 2V1PA 3NDNA 4ATQA 1E5EA 2NMPA 2VMTA 3A9XA 4WBTA 1AIBA 3NUIA 3R9AA 2YRIA 1ZODA 1D2FA 2W8UA 1BKGA 4JEXA 1WYVB 2YHKA 4LNMA 3N75A 3K40A 1ASNA 2C0RA 2DOUA 4A6UA 2VGTA 1ASEA 2VMZA 4MGRA 2VMSA 1G4XA 4A0RA 2ZUKA 1B5PA 1MDOA 4PVFA 3BCAA 5C6UA 3GETA 2ZY2A 2JJFA 1N31A 4ITGA 1AHYA 4BHDA 4ADDA 4IW7A 4MQPA 1X29A 2E7UA 3F9TA 1ASGA 2Z61A 1D7UA 1DKAA 4E1OA 2FNIA 5E5IA 4JEWA 3LVJA 3LVMA 3FZ7A 4Q31A 1YIZA 2E54A 1I29A 1M4NA 2FM1A 4OTLA 2W8JA 2BYJA 4EB7A 2XBNA 4ZDLA 4KXKA 3WCOA 1AJSB 5M49A 4IXSA 2X5FA 5DJ9A 4GSAA 3FDDA 1J04A 1X0MA 2V0YA 3TCMA 1BQAA 3MC6A 4JEVA 4ADEA 4A72A 4UQVA 2VGWA 3NNKA 4MY5A 1JS3A 1YJZA 3EI7A 3B46A 5LH9A 4AOAA 1V2DA 3AOWA 3HT4A 1EQBA 3HBXA 1M0OA 4MKKA 2HP2A 1B9HA 2BI3A 1YIYA 2D65A 5F9SA 3F0HA 4F5GA 4WXBA 1AHFA 3BWNA 1O4SA 3AENB 2VMPA 2W8TA 2X5DA 4WYDA 4ZM3A 3CAIA 4EMYA 1GEWA 1AY8A 2BKWA 4E77A 1IX6A 4CXQA 3KGWA 1LC7A 1S07A 1CS1A 3AEMA 5EFSA 3QBOA 4RIZA 5G09A 3Q8NA 2VGSA 5LHAA 1J32A 3NX3A 3E2YA 4KYOA 3EI9A 3MC6C 4BA4A 2Z9WA 4JF0A 2JISA 8AATA 2GB3A 3LVLB 1VEFA 4DQ6A 1M7YA 3MEBA 3RCHB 7AATA 2WKAA 1G7WA 1KMKA 5E3KA 1QIRA 4RM1A 3ASAA 4H51A 3ZRQA 3AEOA 1UKJA 3H7FA 3L44A 2VGVA 4ZSWA 3IHJA 3P1TA 2W7HA 3ECDA 2VLFA 1BJWA 1WSTA 2PB2A 1E5FA 2D63A 4XEWA 3WX9A 1CZEA 1CQ8A 3ASBA 3RQ1A 1M32A 2QB2A 3BB8A 4B98A 4RLGA 1AJSA 4OBUA 1CQ6A 1KKPA 5FT5A 2F8JA 1H0CA 2W7JA 3PJ0A 3ACZA 1U08A 3I4JA 4MKJA 4RJ0A 3GJUA 4P3MA 3TFUA 4OT8A 1AMRA 4IYOA 5DX5A 3WCNA 4W91A 1WKGA 2FNUA 3I5TA 1ASLA 2JGTA 4RJYA 3FRKA 1IAXA 5D5SA 1LK9A 4FL0A 1YJYA 1C4KA 1BQDA 1GEXA 3E9KA 4ZDOA 4GE4A 1IBJA 3LWSA 4RITA 1FC4A 4ZWVA 4RKDA 4EB5A 2HUIA 1Z7DA 4ZASA 4E3QA 5IWQA 3PDXA 4A00A 3FD0A 2EGYA 3GZDC 1B5OA 1G4VA 4OYTA 4A0GA 4HVKA 1ARIA 4K05A 4CBSA 4IY7A 5F8VA 5I92A 4GRXA 1IX8A 3VOMA 1ARSA 1AHEA 2CANA 3FTBA 2DGKA 2HOYA 3GBXA 4ATPA 1RVYA 4Q76A 1AKCA 2W7DA 4JE5A 1MLZA 4F5IA 2D7YA 3JW9A 1UU0A 3QGUA 3A9YA 1AJRA 1QISA 2R5CA 2JG2A 1W7LA 3A2BA 2KFPA 1M6SA 2D7ZA 4WXFA 4ISYA 2FKIA 1RVUA 5DJ1A 1LW5A 3FDBA 4B9BA 1O69A 3M5UA 5K8BA 2VMVA 1C7NA 1ELUA 2HZPA 3IF2A 4Y0DA 3EIAA 2W7IA 2EPJA 1GC3A 4AO9A 2QA3A 4WYGA 4LNLA 1QJ3A 2QSRA 1V72A 2YRRA 2JJGA 3FCRA 3FVXA 2W7EA 4XAUA 3AEMC 1LKCA 1YOOA 1MDZA 3DXVA 1C9CA 1C0NA 1IJIA 1QZ9A 5D95A 2BYLA 2AY9A 2W7GA 3LG0A 1OATA 1AIAA 3E2ZB 2QBTA 1KKJA 1ASCA 2GQNA 3B8XA 2HOZA 2JJHA 5HDMA 1DFOA 4GE9A 4NOGA 4OC9A 4UHMA 4CBRA 2EZ2A 1TASA 1YJSA 1ASMA 2TPLA 4ZSYA 1YNUA 3ZRPA 1MAQA 2DGMA 2JJEA 4UOYA 3VK2A 3NU8A 2Z20A 2ZJGA 2AY4A 4W5KA 1VJOA 2ORDA 2DR1A 3GSBA 3N4RA 3TFTA 2ZYJA 4IX8A 2FYFA 2VGZA 5G0AA 3VAXA 3EZSA 2CH2A 2CTZA 3HVYA 1WYUA 4PIWA 1OHVA 3KGXA 3VK4A 3E2FA 1EG5A 3FVUA 1AKBA 1IX7A 3BC8A 2AY8A 3OP7A 1AMAA 3CQ6A 4I8AA 3DR4A 3FKDA 2OGEA 3ISLA 2WK8A 1OXPA 2QMAA 3VK3A 2X8UA 4LW2A 5TF5A 1SZSA 4Y0IA 4WYCA 4BQ0A 3QPGA 1IAYA 4M2KA 2ZC0A 4J5UA 5G2PA 3DYDA 3MAUA 3WKSA 4Y0HA 4EFFA 2A1VA 1S06A 2BWOA 1TOKA 2CJHA 1WYUB 2HUUA 3AENA 2CH1A 2BI5A 2VMQA 4Q6RA 1ASDA 4N0BA 2DGLA 1WYVA 2VMUA 2R0TA 1X28A 1DTYA 1B8GA 2OQXA 4F5FA 3LVKA 2YCPA 3TATA 2C44A 4OBVA 5JAYA 3NYSA 2QB3A 2YKVA 2Z9XA 3DRDA 3DU4A 3BWOA 3HLMA 2AY5A 4TN4A 1I41A 1WKHA 4RKCA 2BIAA 4F5HA 2ZY3A 2O7CA 3E2ZA 2GSAA 1AY5A 4UHNA 3RCHA 3WLXA 3BCBA 1V2EA 5FT4A 3USFA 3WGCA 1KL1A 2PB0A 3B1CA 3WZFA 2YKUA 2VMXA 4JEYA
chains in the Genus database with same CATH topology
1GBNA 2EYQA 5EUNA 2BWPA 1O62A 2Z9VA 3DZZA 3R4TA 2AATA 4GE7A 2BHXA 3EI8A 4TV7A 4U1TA 3PD6B 2R5EA 4K2MA 4K2BA 5EAAA 5FT8A 2CB1A 4JF1A 3RBFA 4XQ2A 3GZDA 4IXZA 3II0A 4XJMA 2CINA 2VMNA 4MQQA 1S08A 1TOGA 4AO4A 2D61A 3QI6A 3WGBA 1AKAA 1TARA 1M0NA 2W7KA 1XEYA 4OCAA 1ARTA 1Z3ZA 3W1IA 4F4EA 3HDOA 1SF2A 1S0AA 5EQCA 3HMUA 3JTXA 3NTJA 4LNJA 1SPAA 1X2AA 1ARHA 2FQ6A 2GMSA 1LS3A 4DGTA 5G4JA 4MSOA 1AY4A 4WYFA 3LY1A 4CVQA 1BJOA 3G0TA 1H1CA 1N2TA 1EJIA 1KMJA 2FN6A 1BS0A 2D66A 2VMRA 3A9ZA 3FQ8A 3K7YA 3P6KA 4BA5A 1OXOA 3NU7A 3D6KA 2VIAA 2VLHA 1LW4A 1CL1A 3ELEA 1D7SA 3DR7A 2BIGA 1DJ9A 3H14A 3MAFB 1GEYA 4PFNA 1GC4A 3FFHA 3AATA 1RV4A 3DC1A 4GDYA 4LW4A 1IVRA 4QGRA 4H63Q 1GD9A 3MKJA 1CZCA 3ZZJA 3VP6A 4J8LA 2OKKA 4LC3A 3UE8A 4P7YA 3EI6A 4WB0B 3DODA 3BS8A 4WLJA 2AY7A 2VIBA 5HXXA 1P3WA 4UHOA 3PIUA 2RFVA 1ASAA 2OATA 3GWPA 1GC0A 3B1EA 4XJOA 1LC5A 1MDXA 2DKBA 3BCXA 4ADCA 3RI6A 1AMQA 3NYUA 2AEVA 2CJGA 5FT6A 2YCTA 4PFFA 4W1WA 1TOIA 3CQ5A 3FFRA 2YCNA 3BV0A 3NYTA 2AY6A 1WYTA 2YOBA 1GCKA 2AY2A 3A8UX 2G6WA 4OMAA 4L0OA 5HHYA 1M0QA 2W8VA 3KE3A 4BMKA 5KTBA 3I16A 4RAEA 2E7IA 4DBCA 4R2NA 1TATA 4A6TA 1AX4A 4ZDPA 5BJ4A 1OHYA 2C7TA 3FSLA 2X3LA 2VYCA 3TQXA 1TPLA 3AEPA 1ASBA 1B4XA 2ZP7A 3QHXA 3AOVA 3COGA 4F5LA 5EUEA 2CY8A 3JU7A 2EH6A 2VMOA 4WP0A 1AHXA 3QN6A 3RUYA 2BWNA 1T3IA 3N7NA 1QGNA 1DJUA 1PMOA 2BI1A 4O6ZA 2W7MA 1FG7A 2WB6A 4AZJA 3PA9A 1JF9A 1ZOBA 2OGAA 4XJPA 1RV3A 1SZUA 3EI5A 1TOJA 1AMSA 2CJDA 3G7QA 4F5JA 3N5MA 1ARGA 2HOXA 1DGEA 1OHWA 4R5FA 4F5MA 2ZSMA 3HL2A 1ASFA 1SVVA 1IUGA 1JG8A 2YKYA 1BT4A 4E3RA 1CL2A 3AEJC 3B1DA 3BN1A 3BWNC 1D7RA 4ZM4A 2ZY4A 3PDBB 1M0PA 1AICA 1CQ7A 3EZ1A 3GZCA 4IYOB 4ADBA 2CFBA 4R5ZA 1W3UA 9AATA 1ORDA 3K28A 4Q75A 3CBFA 4K2IA 3ATHA 1BJNA 1FG3A 2D5YA 2YKXA 1TOEA 1W7NA 4W1XA 2HUFA 2Z9UA 1DGDA 1UU1A 2O0RA 2DKJA 2GMUA 2AEUA 3ZZKA 4WD2A 4CXRA 2VGUA 4A0HA 1GC2A 3JZLA 2WK7A 2XH1A 1BW0A 2D64A 4IXOA 3DXWA 3MADA 1AAMA 1BJ4A 1CJ0A 3UWCA 1ZC9A 3PAAA 1XI9A 1N8PA 2HP1A 3L8AA 2G7JA 2AY1A 4WYEA 4TMRA 2ZY5A 3AV7A 3JWAA 1Y4IA 4F5KA 4XJLA 2W7LA 1GDEA 2Z1YA 4WYAA 1ELQA 1VP4A 4KAMA 3EIBA 4WXGA 3PD6A 2Z1ZA 3PPLA 4W1VA 3EUCA 3FQAA 2C81A 1WYTB 2PO3A 1DJEA 1D7VA 2O1BA 3FVSA 4MQRA 4ZLVA 4A0FA 2BI2A 1KL2A 4ZWMA 3HQTA 3PGYA 4A6RA 2W8WA 3N4SA 4WLHA 1C7GA 3NUBA 1LC8A 2EZ1A 5G4IA 1UU2A 5G2QA 5M4DA 4N0WA 1ECXA 2WK9A 3AELA 3E6GA 3LV2A 4FFCA 1S09A 4GEBA 4JE5D 3W1JA 3FQ7A 1QJ5A 2HORA 3WY7A 1C7OA 2VMYA 4M2MA 2AY3A 4W8IA 4HF8A 4XK1A 4R8DA 1I48A 1O61A 4WB0A 2E7JA 1MAPA 1PMMA 2QLRA 2VI8A 2ZSLA 1SZKA 2VMWA 1I43A 3KKIA 5EUDA 2BI9A 3W1HA 5M46A 2R2NA 2CSTA 2VI9A 1JS6A 3QM2A 1MLYA 3G8MA 4JEZA 3MAFA 3FZ6A 1PFFA 2W7FA 5M4BA 1B9IA 4ITXA 5AX8A 4U2HA 3N0LA 1YAAA 2OKJA 2EO5A 1QITA 3PDBA 2Q7WA 3GR9A 5E4ZA 3H9XA 3FZ8A 3ZRRA 3CQ4A 1MGVA 1BJOB 3AEJA 4AH3A 3E77A 1AAWA 2Z67A 4EU1A 3N4XA 1G7XA 3WKRA 1V2FA 1SFFA 3MBBA 5EIGB 1PG8A 3ELPA 3F6TA 5EAVA 3OKSA 5EIGA 4AZKA 3RBLA 5BJ3A 4M2JA 5J8QA 3T32A 4ZAHA 2R5CB 2BIEA 3JWBA 5DB5A 1W23A 3UAKA 3NRAA 1W7MA 1AHGA 2V1PA 3NDNA 4ATQA 1E5EA 2NMPA 2VMTA 3A9XA 4WBTA 1AIBA 3NUIA 3R9AA 2YRIA 1ZODA 1D2FA 2W8UA 1BKGA 4JEXA 1WYVB 2YHKA 4LNMA 3N75A 3K40A 1ASNA 2C0RA 2DOUA 4A6UA 2VGTA 1ASEA 2VMZA 4MGRA 2VMSA 1G4XA 4A0RA 2ZUKA 1B5PA 1MDOA 4PVFA 3BCAA 5C6UA 3GETA 2ZY2A 2JJFA 1N31A 4ITGA 1AHYA 4BHDA 4ADDA 4IW7A 4MQPA 1X29A 2E7UA 3F9TA 1ASGA 2Z61A 1D7UA 1DKAA 4E1OA 2FNIA 5E5IA 4JEWA 3LVJA 3LVMA 3FZ7A 4Q31A 1YIZA 2E54A 1I29A 1M4NA 2FM1A 4OTLA 2W8JA 2BYJA 4EB7A 2XBNA 4ZDLA 4KXKA 3WCOA 1AJSB 5M49A 4IXSA 2X5FA 5DJ9A 4GSAA 3FDDA 1J04A 1X0MA 2V0YA 3TCMA 1BQAA 3MC6A 4JEVA 4ADEA 4A72A 4UQVA 2VGWA 3NNKA 4MY5A 1JS3A 1YJZA 3EI7A 3B46A 5LH9A 4AOAA 1V2DA 3AOWA 3HT4A 1EQBA 3HBXA 1M0OA 4MKKA 2HP2A 1B9HA 2BI3A 1YIYA 2D65A 5F9SA 3F0HA 4F5GA 4WXBA 1AHFA 3BWNA 1O4SA 3AENB 2VMPA 2W8TA 2X5DA 4WYDA 4ZM3A 3CAIA 4EMYA 1GEWA 1AY8A 2BKWA 4E77A 1IX6A 4CXQA 3KGWA 1LC7A 1S07A 1CS1A 3AEMA 5EFSA 3QBOA 4RIZA 5G09A 3Q8NA 2VGSA 5LHAA 1J32A 3NX3A 3E2YA 4KYOA 3EI9A 3MC6C 4BA4A 2Z9WA 4JF0A 2JISA 8AATA 2GB3A 3LVLB 1VEFA 4DQ6A 1M7YA 3MEBA 3RCHB 7AATA 2WKAA 1G7WA 1KMKA 5E3KA 1QIRA 4RM1A 3ASAA 4H51A 3ZRQA 3AEOA 1UKJA 3H7FA 3L44A 2VGVA 4ZSWA 3IHJA 3P1TA 2W7HA 3ECDA 2VLFA 1BJWA 1WSTA 2PB2A 1E5FA 2D63A 4XEWA 3WX9A 1CZEA 1CQ8A 3ASBA 3RQ1A 1M32A 2QB2A 3BB8A 4B98A 4RLGA 1AJSA 4OBUA 1CQ6A 1KKPA 5FT5A 2F8JA 1H0CA 2W7JA 3PJ0A 3ACZA 1U08A 3I4JA 4MKJA 4RJ0A 3GJUA 4P3MA 3TFUA 4OT8A 1AMRA 4IYOA 5DX5A 3WCNA 4W91A 1WKGA 2FNUA 3I5TA 1ASLA 2JGTA 4RJYA 3FRKA 1IAXA 5D5SA 1LK9A 4FL0A 1YJYA 1C4KA 1BQDA 1GEXA 3E9KA 4ZDOA 4GE4A 1IBJA 3LWSA 4RITA 1FC4A 4ZWVA 4RKDA 4EB5A 2HUIA 1Z7DA 4ZASA 4E3QA 5IWQA 3PDXA 4A00A 3FD0A 2EGYA 3GZDC 1B5OA 1G4VA 4OYTA 4A0GA 4HVKA 1ARIA 4K05A 4CBSA 4IY7A 5F8VA 5I92A 4GRXA 1IX8A 3VOMA 1ARSA 1AHEA 2CANA 3FTBA 2DGKA 2HOYA 3GBXA 4ATPA 1RVYA 4Q76A 1AKCA 2W7DA 4JE5A 1MLZA 4F5IA 2D7YA 3JW9A 1UU0A 3QGUA 3A9YA 1AJRA 1QISA 2R5CA 2JG2A 1W7LA 3A2BA 2KFPA 1M6SA 2D7ZA 4WXFA 4ISYA 2FKIA 1RVUA 5DJ1A 1LW5A 3FDBA 4B9BA 1O69A 3M5UA 5K8BA 2VMVA 1C7NA 1ELUA 2HZPA 3IF2A 4Y0DA 3EIAA 2W7IA 2EPJA 1GC3A 4AO9A 2QA3A 4WYGA 4LNLA 1QJ3A 2QSRA 1V72A 2YRRA 2JJGA 3FCRA 3FVXA 2W7EA 4XAUA 3AEMC 1LKCA 1YOOA 1MDZA 3DXVA 1C9CA 1C0NA 1IJIA 1QZ9A 5D95A 2BYLA 2AY9A 2W7GA 3LG0A 1OATA 1AIAA 3E2ZB 2QBTA 1KKJA 1ASCA 2GQNA 3B8XA 2HOZA 2JJHA 5HDMA 1DFOA 4GE9A 4NOGA 4OC9A 4UHMA 4CBRA 2EZ2A 1TASA 1YJSA 1ASMA 2TPLA 4ZSYA 1YNUA 3ZRPA 1MAQA 2DGMA 2JJEA 4UOYA 3VK2A 3NU8A 2Z20A 2ZJGA 2AY4A 4W5KA 1VJOA 2ORDA 2DR1A 3GSBA 3N4RA 3TFTA 2ZYJA 4IX8A 2FYFA 2VGZA 5G0AA 3VAXA 3EZSA 2CH2A 2CTZA 3HVYA 1WYUA 4PIWA 1OHVA 3KGXA 3VK4A 3E2FA 1EG5A 3FVUA 1AKBA 1IX7A 3BC8A 2AY8A 3OP7A 1AMAA 3CQ6A 4I8AA 3DR4A 3FKDA 2OGEA 3ISLA 2WK8A 1OXPA 2QMAA 3VK3A 2X8UA 4LW2A 5TF5A 1SZSA 4Y0IA 4WYCA 4BQ0A 3QPGA 1IAYA 4M2KA 2ZC0A 4J5UA 5G2PA 3DYDA 3MAUA 3WKSA 4Y0HA 4EFFA 2A1VA 1S06A 2BWOA 1TOKA 2CJHA 1WYUB 2HUUA 3AENA 2CH1A 2BI5A 2VMQA 4Q6RA 1ASDA 4N0BA 2DGLA 1WYVA 2VMUA 2R0TA 1X28A 1DTYA 1B8GA 2OQXA 4F5FA 3LVKA 2YCPA 3TATA 2C44A 4OBVA 5JAYA 3NYSA 2QB3A 2YKVA 2Z9XA 3DRDA 3DU4A 3BWOA 3HLMA 2AY5A 4TN4A 1I41A 1WKHA 4RKCA 2BIAA 4F5HA 2ZY3A 2O7CA 3E2ZA 2GSAA 1AY5A 4UHNA 3RCHA 3WLXA 3BCBA 1V2EA 5FT4A 3USFA 3WGCA 1KL1A 2PB0A 3B1CA 3WZFA 2YKUA 2VMXA 4JEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GBN A;  5EUN A;  2BWP A;  1O62 A;  2Z9V A;  3DZZ A;  3R4T A;  2AAT A;  4GE7 A;  2BHX A;  3EI8 A;  4TV7 A;  4U1T A;  3PD6 B;  2R5E A;  4K2M A;  4K2B A;  5EAA A;  5FT8 A;  2CB1 A;  4JF1 A;  3RBF A;  4XQ2 A;  3GZD A;  4IXZ A;  3II0 A;  4XJM A;  2CIN A;  2VMN A;  4MQQ A;  1S08 A;  1TOG A;  4AO4 A;  2D61 A;  3QI6 A;  3WGB A;  1AKA A;  1TAR A;  1M0N A;  2W7K A;  1XEY A;  4OCA A;  1ART A;  1Z3Z A;  3W1I A;  4F4E A;  3HDO A;  1SF2 A;  1S0A A;  5EQC A;  3HMU A;  3JTX A;  3NTJ A;  4LNJ A;  1SPA A;  1X2A A;  1ARH A;  2FQ6 A;  2GMS A;  1LS3 A;  4DGT A;  5G4J A;  4MSO A;  1AY4 A;  4WYF A;  3LY1 A;  4CVQ A;  1BJO A;  3G0T A;  1H1C A;  1N2T A;  1EJI A;  1KMJ A;  2FN6 A;  1BS0 A;  2D66 A;  2VMR A;  3A9Z A;  3FQ8 A;  3K7Y A;  3P6K A;  4BA5 A;  1OXO A;  3NU7 A;  3D6K A;  2VIA A;  2VLH A;  1LW4 A;  1CL1 A;  3ELE A;  1D7S A;  3DR7 A;  2BIG A;  1DJ9 A;  3H14 A;  3MAF B;  1GEY A;  4PFN A;  1GC4 A;  3FFH A;  3AAT A;  1RV4 A;  3DC1 A;  4GDY A;  4LW4 A;  1IVR A;  4QGR A;  1GD9 A;  3MKJ A;  1CZC A;  3ZZJ A;  3VP6 A;  4J8L A;  2OKK A;  4LC3 A;  3UE8 A;  4P7Y A;  3EI6 A;  4WB0 B;  3DOD A;  3BS8 A;  4WLJ A;  2AY7 A;  2VIB A;  5HXX A;  1P3W A;  4UHO A;  3PIU A;  2RFV A;  1ASA A;  2OAT A;  3GWP A;  1GC0 A;  3B1E A;  4XJO A;  1LC5 A;  1MDX A;  2DKB A;  3BCX A;  4ADC A;  3RI6 A;  1AMQ A;  3NYU A;  2AEV A;  2CJG A;  5FT6 A;  2YCT A;  4PFF A;  4W1W A;  1TOI A;  3CQ5 A;  3FFR A;  2YCN A;  3BV0 A;  3NYT A;  2AY6 A;  1WYT A;  2YOB A;  1GCK A;  2AY2 A;  3A8U X;  2G6W A;  4OMA A;  4L0O A;  5HHY A;  1M0Q A;  2W8V A;  3KE3 A;  4BMK A;  3I16 A;  4RAE A;  2E7I A;  4DBC A;  4R2N A;  1TAT A;  4A6T A;  1AX4 A;  4ZDP A;  5BJ4 A;  1OHY A;  2C7T A;  3FSL A;  2X3L A;  2VYC A;  3TQX A;  1TPL A;  3AEP A;  1ASB A;  1B4X A;  2ZP7 A;  3QHX A;  3AOV A;  3COG A;  4F5L A;  5EUE A;  2CY8 A;  3JU7 A;  2EH6 A;  2VMO A;  4WP0 A;  1AHX A;  3QN6 A;  3RUY A;  2BWN A;  1T3I A;  1QGN A;  1DJU A;  1PMO A;  2BI1 A;  4O6Z A;  2W7M A;  1FG7 A;  4AZJ A;  3PA9 A;  1JF9 A;  1ZOB A;  2OGA A;  4XJP A;  1RV3 A;  1SZU A;  3EI5 A;  1TOJ A;  1AMS A;  2CJD A;  3G7Q A;  4F5J A;  3N5M A;  1ARG A;  2HOX A;  1DGE A;  1OHW A;  4R5F A;  4F5M A;  2ZSM A;  3HL2 A;  1ASF A;  1SVV A;  1IUG A;  1JG8 A;  2YKY A;  1BT4 A;  4E3R A;  1CL2 A;  3AEJ C;  3B1D A;  3BN1 A;  3BWN C;  1D7R A;  4ZM4 A;  2ZY4 A;  3PDB B;  1M0P A;  1AIC A;  1CQ7 A;  3EZ1 A;  3GZC A;  4IYO B;  4ADB A;  2CFB A;  4R5Z A;  1W3U A;  9AAT A;  1ORD A;  3K28 A;  4Q75 A;  3CBF A;  4K2I A;  3ATH A;  1BJN A;  1FG3 A;  2D5Y A;  2YKX A;  1TOE A;  1W7N A;  4W1X A;  2HUF A;  2Z9U A;  1DGD A;  1UU1 A;  2O0R A;  2DKJ A;  2GMU A;  2AEU A;  3ZZK A;  4WD2 A;  4CXR A;  2VGU A;  4A0H A;  1GC2 A;  3JZL A;  2WK7 A;  2XH1 A;  1BW0 A;  2D64 A;  4IXO A;  3DXW A;  3MAD A;  1AAM A;  1BJ4 A;  1CJ0 A;  3UWC A;  1ZC9 A;  3PAA A;  1XI9 A;  1N8P A;  2HP1 A;  3L8A A;  2AY1 A;  4WYE A;  4TMR A;  2ZY5 A;  3AV7 A;  3JWA A;  1Y4I A;  4F5K A;  4XJL A;  2W7L A;  1GDE A;  2Z1Y A;  4WYA A;  1ELQ A;  1VP4 A;  4KAM A;  3EIB A;  4WXG A;  3PD6 A;  2Z1Z A;  3PPL A;  4W1V A;  3EUC A;  3FQA A;  2C81 A;  1WYT B;  2PO3 A;  1DJE A;  1D7V A;  2O1B A;  3FVS A;  4MQR A;  4ZLV A;  4A0F A;  2BI2 A;  1KL2 A;  4ZWM A;  3HQT A;  3PGY A;  4A6R A;  2W8W A;  4WLH A;  1C7G A;  3NUB A;  1LC8 A;  2EZ1 A;  5G4I A;  1UU2 A;  5G2Q A;  5M4D A;  4N0W A;  1ECX A;  2WK9 A;  3AEL A;  3E6G A;  3LV2 A;  4FFC A;  1S09 A;  4GEB A;  4JE5 D;  3W1J A;  3FQ7 A;  1QJ5 A;  2HOR A;  3WY7 A;  1C7O A;  2VMY A;  4M2M A;  2AY3 A;  4W8I A;  4HF8 A;  4XK1 A;  4R8D A;  1I48 A;  1O61 A;  4WB0 A;  2E7J A;  1MAP A;  1PMM A;  2QLR A;  2VI8 A;  2ZSL A;  1SZK A;  2VMW A;  1I43 A;  3KKI A;  5EUD A;  2BI9 A;  3W1H A;  5M46 A;  2R2N A;  2CST A;  2VI9 A;  1JS6 A;  3QM2 A;  1MLY A;  3G8M A;  4JEZ A;  3MAF A;  3FZ6 A;  1PFF A;  2W7F A;  5M4B A;  1B9I A;  4ITX A;  5AX8 A;  4U2H A;  3N0L A;  1YAA A;  2OKJ A;  2EO5 A;  1QIT A;  3PDB A;  2Q7W A;  3GR9 A;  5E4Z A;  3FZ8 A;  3ZRR A;  3CQ4 A;  1MGV A;  1BJO B;  3AEJ A;  4AH3 A;  3E77 A;  1AAW A;  2Z67 A;  4EU1 A;  1G7X A;  3WKR A;  1V2F A;  1SFF A;  3MBB A;  5EIG B;  1PG8 A;  3ELP A;  3F6T A;  5EAV A;  3OKS A;  5EIG A;  4AZK A;  3RBL A;  5BJ3 A;  4M2J A;  5J8Q A;  3T32 A;  4ZAH A;  2R5C B;  2BIE A;  3JWB A;  5DB5 A;  1W23 A;  3UAK A;  3NRA A;  1W7M A;  1AHG A;  2V1P A;  3NDN A;  4ATQ A;  1E5E A;  2NMP A;  2VMT A;  3A9X A;  4WBT A;  1AIB A;  3NUI A;  3R9A A;  2YRI A;  1ZOD A;  1D2F A;  2W8U A;  1BKG A;  4JEX A;  1WYV B;  2YHK A;  4LNM A;  3N75 A;  3K40 A;  1ASN A;  2C0R A;  2DOU A;  4A6U A;  2VGT A;  1ASE A;  2VMZ A;  4MGR A;  2VMS A;  1G4X A;  4A0R A;  2ZUK A;  1B5P A;  1MDO A;  4PVF A;  3BCA A;  5C6U A;  3GET A;  2ZY2 A;  2JJF A;  1N31 A;  4ITG A;  1AHY A;  4BHD A;  4ADD A;  4IW7 A;  4MQP A;  1X29 A;  2E7U A;  3F9T A;  1ASG A;  2Z61 A;  1D7U A;  1DKA A;  4E1O A;  2FNI A;  5E5I A;  4JEW A;  3LVJ A;  3LVM A;  3FZ7 A;  4Q31 A;  1YIZ A;  2E54 A;  1I29 A;  1M4N A;  2FM1 A;  4OTL A;  2W8J A;  2BYJ A;  4EB7 A;  2XBN A;  4ZDL A;  4KXK A;  3WCO A;  1AJS B;  5M49 A;  4IXS A;  2X5F A;  5DJ9 A;  4GSA A;  3FDD A;  1J04 A;  1X0M A;  2V0Y A;  3TCM A;  1BQA A;  3MC6 A;  4JEV A;  4ADE A;  4A72 A;  4UQV A;  2VGW A;  3NNK A;  4MY5 A;  1JS3 A;  1YJZ A;  3EI7 A;  3B46 A;  5LH9 A;  4AOA A;  1V2D A;  3AOW A;  3HT4 A;  1EQB A;  3HBX A;  1M0O A;  4MKK A;  2HP2 A;  1B9H A;  2BI3 A;  1YIY A;  2D65 A;  5F9S A;  3F0H A;  4F5G A;  4WXB A;  1AHF A;  3BWN A;  1O4S A;  3AEN B;  2VMP A;  2W8T A;  2X5D A;  4WYD A;  4ZM3 A;  3CAI A;  4EMY A;  1GEW A;  1AY8 A;  2BKW A;  4E77 A;  1IX6 A;  4CXQ A;  3KGW A;  1LC7 A;  1S07 A;  1CS1 A;  3AEM A;  5EFS A;  3QBO A;  4RIZ A;  5G09 A;  3Q8N A;  2VGS A;  5LHA A;  1J32 A;  3NX3 A;  3E2Y A;  4KYO A;  3EI9 A;  3MC6 C;  4BA4 A;  2Z9W A;  4JF0 A;  2JIS A;  8AAT A;  2GB3 A;  3LVL B;  1VEF A;  4DQ6 A;  1M7Y A;  3MEB A;  3RCH B;  7AAT A;  2WKA A;  1G7W A;  1KMK A;  5E3K A;  1QIR A;  4RM1 A;  3ASA A;  4H51 A;  3ZRQ A;  3AEO A;  1UKJ A;  3H7F A;  3L44 A;  2VGV A;  4ZSW A;  3IHJ A;  3P1T A;  2W7H A;  3ECD A;  2VLF A;  1BJW A;  1WST A;  2PB2 A;  1E5F A;  2D63 A;  4XEW A;  3WX9 A;  1CZE A;  1CQ8 A;  3ASB A;  3RQ1 A;  1M32 A;  2QB2 A;  3BB8 A;  4B98 A;  4RLG A;  1AJS A;  4OBU A;  1CQ6 A;  1KKP A;  5FT5 A;  2F8J A;  1H0C A;  2W7J A;  3PJ0 A;  3ACZ A;  1U08 A;  3I4J A;  4MKJ A;  4RJ0 A;  3GJU A;  4P3M A;  3TFU A;  4OT8 A;  1AMR A;  4IYO A;  5DX5 A;  3WCN A;  4W91 A;  1WKG A;  2FNU A;  3I5T A;  1ASL A;  2JGT A;  4RJY A;  3FRK A;  1IAX A;  5D5S A;  1LK9 A;  4FL0 A;  1YJY A;  1C4K A;  1BQD A;  1GEX A;  3E9K A;  4ZDO A;  4GE4 A;  1IBJ A;  3LWS A;  4RIT A;  1FC4 A;  4ZWV A;  4RKD A;  4EB5 A;  2HUI A;  1Z7D A;  4ZAS A;  4E3Q A;  5IWQ A;  3PDX A;  4A00 A;  3FD0 A;  2EGY A;  3GZD C;  1B5O A;  1G4V A;  4OYT A;  4A0G A;  4HVK A;  1ARI A;  4CBS A;  4IY7 A;  5F8V A;  5I92 A;  4GRX A;  1IX8 A;  3VOM A;  1ARS A;  1AHE A;  2CAN A;  3FTB A;  2DGK A;  2HOY A;  3GBX A;  4ATP A;  1RVY A;  4Q76 A;  1AKC A;  2W7D A;  4JE5 A;  1MLZ A;  4F5I A;  2D7Y A;  3JW9 A;  1UU0 A;  3QGU A;  3A9Y A;  1AJR A;  1QIS A;  2R5C A;  2JG2 A;  1W7L A;  3A2B A;  1M6S A;  2D7Z A;  4WXF A;  4ISY A;  1RVU A;  5DJ1 A;  1LW5 A;  3FDB A;  4B9B A;  1O69 A;  3M5U A;  5K8B A;  2VMV A;  1C7N A;  1ELU A;  2HZP A;  3IF2 A;  4Y0D A;  3EIA A;  2W7I A;  2EPJ A;  1GC3 A;  4AO9 A;  2QA3 A;  4WYG A;  4LNL A;  1QJ3 A;  1V72 A;  2YRR A;  2JJG A;  3FCR A;  3FVX A;  2W7E A;  4XAU A;  3AEM C;  1LKC A;  1YOO A;  1MDZ A;  3DXV A;  1C9C A;  1C0N A;  1IJI A;  1QZ9 A;  5D95 A;  2BYL A;  2AY9 A;  2W7G A;  3LG0 A;  1OAT A;  1AIA A;  3E2Z B;  2QBT A;  1KKJ A;  1ASC A;  2GQN A;  3B8X A;  2HOZ A;  2JJH A;  5HDM A;  1DFO A;  4GE9 A;  4NOG A;  4OC9 A;  4UHM A;  4CBR A;  2EZ2 A;  1TAS A;  1YJS A;  1ASM A;  2TPL A;  4ZSY A;  1YNU A;  3ZRP A;  1MAQ A;  2DGM A;  2JJE A;  4UOY A;  3VK2 A;  3NU8 A;  2Z20 A;  2ZJG A;  2AY4 A;  4W5K A;  1VJO A;  2ORD A;  2DR1 A;  3GSB A;  3TFT A;  2ZYJ A;  4IX8 A;  2FYF A;  2VGZ A;  5G0A A;  3VAX A;  3EZS A;  2CH2 A;  2CTZ A;  3HVY A;  1WYU A;  4PIW A;  1OHV A;  3KGX A;  3VK4 A;  3E2F A;  1EG5 A;  3FVU A;  1AKB A;  1IX7 A;  3BC8 A;  2AY8 A;  3OP7 A;  1AMA A;  3CQ6 A;  4I8A A;  3DR4 A;  3FKD A;  2OGE A;  3ISL A;  2WK8 A;  1OXP A;  2QMA A;  3VK3 A;  2X8U A;  4LW2 A;  5TF5 A;  1SZS A;  4Y0I A;  4WYC A;  4BQ0 A;  3QPG A;  1IAY A;  4M2K A;  2ZC0 A;  4J5U A;  5G2P A;  3DYD A;  3MAU A;  3WKS A;  4Y0H A;  4EFF A;  1S06 A;  2BWO A;  1TOK A;  2CJH A;  1WYU B;  2HUU A;  3AEN A;  2CH1 A;  2BI5 A;  2VMQ A;  4Q6R A;  1ASD A;  4N0B A;  2DGL A;  1WYV A;  2VMU A;  2R0T A;  1X28 A;  1DTY A;  1B8G A;  2OQX A;  4F5F A;  3LVK A;  2YCP A;  3TAT A;  2C44 A;  4OBV A;  5JAY A;  3NYS A;  2QB3 A;  2YKV A;  2Z9X A;  3DRD A;  3DU4 A;  3BWO A;  3HLM A;  2AY5 A;  4TN4 A;  1I41 A;  1WKH A;  4RKC A;  2BIA A;  4F5H A;  2ZY3 A;  2O7C A;  3E2Z A;  2GSA A;  1AY5 A;  4UHN A;  3RCH A;  3WLX A;  3BCB A;  1V2E A;  5FT4 A;  3USF A;  3WGC A;  1KL1 A;  2PB0 A;  3B1C A;  3WZF A;  2YKU A;  2VMX A;  4JEY A; 
#chains in the Genus database with same CATH topology
 1GBN A;  2EYQ A;  5EUN A;  2BWP A;  1O62 A;  2Z9V A;  3DZZ A;  3R4T A;  2AAT A;  4GE7 A;  2BHX A;  3EI8 A;  4TV7 A;  4U1T A;  3PD6 B;  2R5E A;  4K2M A;  4K2B A;  5EAA A;  5FT8 A;  2CB1 A;  4JF1 A;  3RBF A;  4XQ2 A;  3GZD A;  4IXZ A;  3II0 A;  4XJM A;  2CIN A;  2VMN A;  4MQQ A;  1S08 A;  1TOG A;  1KAF A;  4AO4 A;  2D61 A;  3QI6 A;  3WGB A;  1AKA A;  1TAR A;  1M0N A;  2W7K A;  1XEY A;  4OCA A;  1ART A;  1Z3Z A;  3W1I A;  4F4E A;  3HDO A;  1SF2 A;  1S0A A;  5EQC A;  3HMU A;  3JTX A;  3NTJ A;  4LNJ A;  1SPA A;  1X2A A;  1ARH A;  2FQ6 A;  2GMS A;  1LS3 A;  4DGT A;  5G4J A;  4MSO A;  1AY4 A;  4WYF A;  3LY1 A;  4CVQ A;  1BJO A;  3G0T A;  1H1C A;  1N2T A;  1EJI A;  1KMJ A;  2FN6 A;  1BS0 A;  2D66 A;  2VMR A;  3A9Z A;  3FQ8 A;  3K7Y A;  3P6K A;  4BA5 A;  1OXO A;  3NU7 A;  3D6K A;  2VIA A;  2VLH A;  1LW4 A;  1CL1 A;  3ELE A;  1D7S A;  3DR7 A;  2BIG A;  1DJ9 A;  3H14 A;  3MAF B;  1GEY A;  4PFN A;  1GC4 A;  3FFH A;  3AAT A;  1RV4 A;  3DC1 A;  4GDY A;  4LW4 A;  1IVR A;  4QGR A;  4H63 Q;  1GD9 A;  3MKJ A;  1CZC A;  3ZZJ A;  3VP6 A;  4J8L A;  2OKK A;  4LC3 A;  3UE8 A;  4P7Y A;  3EI6 A;  4WB0 B;  3DOD A;  3BS8 A;  4WLJ A;  2AY7 A;  2VIB A;  5HXX A;  1P3W A;  4UHO A;  3PIU A;  2RFV A;  1ASA A;  2OAT A;  3GWP A;  1GC0 A;  3B1E A;  4XJO A;  1LC5 A;  1MDX A;  2DKB A;  3BCX A;  4ADC A;  3RI6 A;  1AMQ A;  3NYU A;  2AEV A;  2CJG A;  5FT6 A;  2YCT A;  4PFF A;  4W1W A;  1TOI A;  3CQ5 A;  3FFR A;  2YCN A;  3BV0 A;  3NYT A;  2AY6 A;  1WYT A;  2YOB A;  1GCK A;  2AY2 A;  3A8U X;  2G6W A;  4OMA A;  4L0O A;  5HHY A;  1M0Q A;  2W8V A;  3KE3 A;  4BMK A;  5KTB A;  3I16 A;  4RAE A;  2E7I A;  4DBC A;  4R2N A;  1TAT A;  4A6T A;  1AX4 A;  4ZDP A;  5BJ4 A;  1OHY A;  2C7T A;  3FSL A;  2X3L A;  2VYC A;  3TQX A;  1TPL A;  3AEP A;  1ASB A;  1B4X A;  2ZP7 A;  3QHX A;  3AOV A;  3COG A;  4F5L A;  5EUE A;  2CY8 A;  3JU7 A;  2EH6 A;  2VMO A;  4WP0 A;  1AHX A;  3QN6 A;  3RUY A;  2BWN A;  1T3I A;  3N7N A;  1QGN A;  1DJU A;  1PMO A;  2BI1 A;  4O6Z A;  2W7M A;  1FG7 A;  2WB6 A;  4AZJ A;  3PA9 A;  1JF9 A;  1ZOB A;  2OGA A;  4XJP A;  1RV3 A;  1SZU A;  3EI5 A;  1TOJ A;  1AMS A;  2CJD A;  3G7Q A;  4F5J A;  3N5M A;  1ARG A;  2HOX A;  1DGE A;  1OHW A;  4R5F A;  4F5M A;  2ZSM A;  3HL2 A;  1ASF A;  1SVV A;  1IUG A;  1JG8 A;  2YKY A;  1BT4 A;  4E3R A;  1CL2 A;  3AEJ C;  3B1D A;  3BN1 A;  3BWN C;  1D7R A;  4ZM4 A;  2ZY4 A;  3PDB B;  1M0P A;  1AIC A;  1CQ7 A;  3EZ1 A;  3GZC A;  4IYO B;  4ADB A;  2CFB A;  4R5Z A;  1W3U A;  9AAT A;  1ORD A;  3K28 A;  4Q75 A;  3CBF A;  4K2I A;  3ATH A;  1BJN A;  1FG3 A;  2D5Y A;  2YKX A;  1TOE A;  1W7N A;  4W1X A;  2HUF A;  2Z9U A;  1DGD A;  1UU1 A;  2O0R A;  2DKJ A;  2GMU A;  2AEU A;  3ZZK A;  4WD2 A;  4CXR A;  2VGU A;  4A0H A;  1GC2 A;  3JZL A;  2WK7 A;  2XH1 A;  1BW0 A;  2D64 A;  4IXO A;  3DXW A;  3MAD A;  1AAM A;  1BJ4 A;  1CJ0 A;  3UWC A;  1ZC9 A;  3PAA A;  1XI9 A;  1N8P A;  2HP1 A;  3L8A A;  2G7J A;  2AY1 A;  4WYE A;  4TMR A;  2ZY5 A;  3AV7 A;  3JWA A;  1Y4I A;  4F5K A;  4XJL A;  2W7L A;  1GDE A;  2Z1Y A;  4WYA A;  1ELQ A;  1VP4 A;  4KAM A;  3EIB A;  4WXG A;  3PD6 A;  2Z1Z A;  3PPL A;  4W1V A;  3EUC A;  3FQA A;  2C81 A;  1WYT B;  2PO3 A;  1DJE A;  1D7V A;  2O1B A;  3FVS A;  4MQR A;  4ZLV A;  4A0F A;  2BI2 A;  1KL2 A;  4ZWM A;  3HQT A;  3PGY A;  4A6R A;  2W8W A;  3N4S A;  4WLH A;  1C7G A;  3NUB A;  1LC8 A;  2EZ1 A;  5G4I A;  1UU2 A;  5G2Q A;  5M4D A;  4N0W A;  1ECX A;  2WK9 A;  3AEL A;  3E6G A;  3LV2 A;  4FFC A;  1S09 A;  4GEB A;  4JE5 D;  3W1J A;  3FQ7 A;  1QJ5 A;  2HOR A;  3WY7 A;  1C7O A;  2VMY A;  4M2M A;  2AY3 A;  4W8I A;  4HF8 A;  4XK1 A;  4R8D A;  1I48 A;  1O61 A;  4WB0 A;  2E7J A;  1MAP A;  1PMM A;  2QLR A;  2VI8 A;  2ZSL A;  1SZK A;  2VMW A;  1I43 A;  3KKI A;  5EUD A;  2BI9 A;  3W1H A;  5M46 A;  2R2N A;  2CST A;  2VI9 A;  1JS6 A;  3QM2 A;  1MLY A;  3G8M A;  4JEZ A;  3MAF A;  3FZ6 A;  1PFF A;  2W7F A;  5M4B A;  1B9I A;  4ITX A;  5AX8 A;  4U2H A;  3N0L A;  1YAA A;  2OKJ A;  2EO5 A;  1QIT A;  3PDB A;  2Q7W A;  3GR9 A;  5E4Z A;  3H9X A;  3FZ8 A;  3ZRR A;  3CQ4 A;  1MGV A;  1BJO B;  3AEJ A;  4AH3 A;  3E77 A;  1AAW A;  2Z67 A;  4EU1 A;  3N4X A;  1G7X A;  3WKR A;  1V2F A;  1SFF A;  3MBB A;  5EIG B;  1PG8 A;  3ELP A;  3F6T A;  5EAV A;  3OKS A;  5EIG A;  4AZK A;  3RBL A;  5BJ3 A;  4M2J A;  5J8Q A;  3T32 A;  4ZAH A;  2R5C B;  2BIE A;  3JWB A;  5DB5 A;  1W23 A;  3UAK A;  3NRA A;  1W7M A;  1AHG A;  2V1P A;  3NDN A;  4ATQ A;  1E5E A;  2NMP A;  2VMT A;  3A9X A;  4WBT A;  1AIB A;  3NUI A;  3R9A A;  2YRI A;  1ZOD A;  1D2F A;  2W8U A;  1BKG A;  4JEX A;  1WYV B;  2YHK A;  4LNM A;  3N75 A;  3K40 A;  1ASN A;  2C0R A;  2DOU A;  4A6U A;  2VGT A;  1ASE A;  2VMZ A;  4MGR A;  2VMS A;  1G4X A;  4A0R A;  2ZUK A;  1B5P A;  1MDO A;  4PVF A;  3BCA A;  5C6U A;  3GET A;  2ZY2 A;  2JJF A;  1N31 A;  4ITG A;  1AHY A;  4BHD A;  4ADD A;  4IW7 A;  4MQP A;  1X29 A;  2E7U A;  3F9T A;  1ASG A;  2Z61 A;  1D7U A;  1DKA A;  4E1O A;  2FNI A;  5E5I A;  4JEW A;  3LVJ A;  3LVM A;  3FZ7 A;  4Q31 A;  1YIZ A;  2E54 A;  1I29 A;  1M4N A;  2FM1 A;  4OTL A;  2W8J A;  2BYJ A;  4EB7 A;  2XBN A;  4ZDL A;  4KXK A;  3WCO A;  1AJS B;  5M49 A;  4IXS A;  2X5F A;  5DJ9 A;  4GSA A;  3FDD A;  1J04 A;  1X0M A;  2V0Y A;  3TCM A;  1BQA A;  3MC6 A;  4JEV A;  4ADE A;  4A72 A;  4UQV A;  2VGW A;  3NNK A;  4MY5 A;  1JS3 A;  1YJZ A;  3EI7 A;  3B46 A;  5LH9 A;  4AOA A;  1V2D A;  3AOW A;  3HT4 A;  1EQB A;  3HBX A;  1M0O A;  4MKK A;  2HP2 A;  1B9H A;  2BI3 A;  1YIY A;  2D65 A;  5F9S A;  3F0H A;  4F5G A;  4WXB A;  1AHF A;  3BWN A;  1O4S A;  3AEN B;  2VMP A;  2W8T A;  2X5D A;  4WYD A;  4ZM3 A;  3CAI A;  4EMY A;  1GEW A;  1AY8 A;  2BKW A;  4E77 A;  1IX6 A;  4CXQ A;  3KGW A;  1LC7 A;  1S07 A;  1CS1 A;  3AEM A;  5EFS A;  3QBO A;  4RIZ A;  5G09 A;  3Q8N A;  2VGS A;  5LHA A;  1J32 A;  3NX3 A;  3E2Y A;  4KYO A;  3EI9 A;  3MC6 C;  4BA4 A;  2Z9W A;  4JF0 A;  2JIS A;  8AAT A;  2GB3 A;  3LVL B;  1VEF A;  4DQ6 A;  1M7Y A;  3MEB A;  3RCH B;  7AAT A;  2WKA A;  1G7W A;  1KMK A;  5E3K A;  1QIR A;  4RM1 A;  3ASA A;  4H51 A;  3ZRQ A;  3AEO A;  1UKJ A;  3H7F A;  3L44 A;  2VGV A;  4ZSW A;  3IHJ A;  3P1T A;  2W7H A;  3ECD A;  2VLF A;  1BJW A;  1WST A;  2PB2 A;  1E5F A;  2D63 A;  4XEW A;  3WX9 A;  1CZE A;  1CQ8 A;  3ASB A;  3RQ1 A;  1M32 A;  2QB2 A;  3BB8 A;  4B98 A;  4RLG A;  1AJS A;  4OBU A;  1CQ6 A;  1KKP A;  5FT5 A;  2F8J A;  1H0C A;  2W7J A;  3PJ0 A;  3ACZ A;  1U08 A;  3I4J A;  4MKJ A;  4RJ0 A;  3GJU A;  4P3M A;  3TFU A;  4OT8 A;  1AMR A;  4IYO A;  5DX5 A;  3WCN A;  4W91 A;  1WKG A;  2FNU A;  3I5T A;  1ASL A;  2JGT A;  4RJY A;  3FRK A;  1IAX A;  5D5S A;  1LK9 A;  4FL0 A;  1YJY A;  1C4K A;  1BQD A;  1GEX A;  3E9K A;  4ZDO A;  4GE4 A;  1IBJ A;  3LWS A;  4RIT A;  1FC4 A;  4ZWV A;  4RKD A;  4EB5 A;  2HUI A;  1Z7D A;  4ZAS A;  4E3Q A;  5IWQ A;  3PDX A;  4A00 A;  3FD0 A;  2EGY A;  3GZD C;  1B5O A;  1G4V A;  4OYT A;  4A0G A;  4HVK A;  1ARI A;  4K05 A;  4CBS A;  4IY7 A;  5F8V A;  5I92 A;  4GRX A;  1IX8 A;  3VOM A;  1ARS A;  1AHE A;  2CAN A;  3FTB A;  2DGK A;  2HOY A;  3GBX A;  4ATP A;  1RVY A;  4Q76 A;  1AKC A;  2W7D A;  4JE5 A;  1MLZ A;  4F5I A;  2D7Y A;  3JW9 A;  1UU0 A;  3QGU A;  3A9Y A;  1AJR A;  1QIS A;  2R5C A;  2JG2 A;  1W7L A;  3A2B A;  2KFP A;  1M6S A;  2D7Z A;  4WXF A;  4ISY A;  2FKI A;  1RVU A;  5DJ1 A;  1LW5 A;  3FDB A;  4B9B A;  1O69 A;  3M5U A;  5K8B A;  2VMV A;  1C7N A;  1ELU A;  2HZP A;  3IF2 A;  4Y0D A;  3EIA A;  2W7I A;  2EPJ A;  1GC3 A;  4AO9 A;  2QA3 A;  4WYG A;  4LNL A;  1QJ3 A;  2QSR A;  1V72 A;  2YRR A;  2JJG A;  3FCR A;  3FVX A;  2W7E A;  4XAU A;  3AEM C;  1LKC A;  1YOO A;  1MDZ A;  3DXV A;  1C9C A;  1C0N A;  1IJI A;  1QZ9 A;  5D95 A;  2BYL A;  2AY9 A;  2W7G A;  3LG0 A;  1OAT A;  1AIA A;  3E2Z B;  2QBT A;  1KKJ A;  1ASC A;  2GQN A;  3B8X A;  2HOZ A;  2JJH A;  5HDM A;  1DFO A;  4GE9 A;  4NOG A;  4OC9 A;  4UHM A;  4CBR A;  2EZ2 A;  1TAS A;  1YJS A;  1ASM A;  2TPL A;  4ZSY A;  1YNU A;  3ZRP A;  1MAQ A;  2DGM A;  2JJE A;  4UOY A;  3VK2 A;  3NU8 A;  2Z20 A;  2ZJG A;  2AY4 A;  4W5K A;  1VJO A;  2ORD A;  2DR1 A;  3GSB A;  3N4R A;  3TFT A;  2ZYJ A;  4IX8 A;  2FYF A;  2VGZ A;  5G0A A;  3VAX A;  3EZS A;  2CH2 A;  2CTZ A;  3HVY A;  1WYU A;  4PIW A;  1OHV A;  3KGX A;  3VK4 A;  3E2F A;  1EG5 A;  3FVU A;  1AKB A;  1IX7 A;  3BC8 A;  2AY8 A;  3OP7 A;  1AMA A;  3CQ6 A;  4I8A A;  3DR4 A;  3FKD A;  2OGE A;  3ISL A;  2WK8 A;  1OXP A;  2QMA A;  3VK3 A;  2X8U A;  4LW2 A;  5TF5 A;  1SZS A;  4Y0I A;  4WYC A;  4BQ0 A;  3QPG A;  1IAY A;  4M2K A;  2ZC0 A;  4J5U A;  5G2P A;  3DYD A;  3MAU A;  3WKS A;  4Y0H A;  4EFF A;  2A1V A;  1S06 A;  2BWO A;  1TOK A;  2CJH A;  1WYU B;  2HUU A;  3AEN A;  2CH1 A;  2BI5 A;  2VMQ A;  4Q6R A;  1ASD A;  4N0B A;  2DGL A;  1WYV A;  2VMU A;  2R0T A;  1X28 A;  1DTY A;  1B8G A;  2OQX A;  4F5F A;  3LVK A;  2YCP A;  3TAT A;  2C44 A;  4OBV A;  5JAY A;  3NYS A;  2QB3 A;  2YKV A;  2Z9X A;  3DRD A;  3DU4 A;  3BWO A;  3HLM A;  2AY5 A;  4TN4 A;  1I41 A;  1WKH A;  4RKC A;  2BIA A;  4F5H A;  2ZY3 A;  2O7C A;  3E2Z A;  2GSA A;  1AY5 A;  4UHN A;  3RCH A;  3WLX A;  3BCB A;  1V2E A;  5FT4 A;  3USF A;  3WGC A;  1KL1 A;  2PB0 A;  3B1C A;  3WZF A;  2YKU A;  2VMX A;  4JEY A; 
#chains in the Genus database with same CATH homology
 1GBN A;  2EYQ A;  5EUN A;  2BWP A;  1O62 A;  2Z9V A;  3DZZ A;  3R4T A;  2AAT A;  4GE7 A;  2BHX A;  3EI8 A;  4TV7 A;  4U1T A;  3PD6 B;  2R5E A;  4K2M A;  4K2B A;  5EAA A;  5FT8 A;  2CB1 A;  4JF1 A;  3RBF A;  4XQ2 A;  3GZD A;  4IXZ A;  3II0 A;  4XJM A;  2CIN A;  2VMN A;  4MQQ A;  1S08 A;  1TOG A;  4AO4 A;  2D61 A;  3QI6 A;  3WGB A;  1AKA A;  1TAR A;  1M0N A;  2W7K A;  1XEY A;  4OCA A;  1ART A;  1Z3Z A;  3W1I A;  4F4E A;  3HDO A;  1SF2 A;  1S0A A;  5EQC A;  3HMU A;  3JTX A;  3NTJ A;  4LNJ A;  1SPA A;  1X2A A;  1ARH A;  2FQ6 A;  2GMS A;  1LS3 A;  4DGT A;  5G4J A;  4MSO A;  1AY4 A;  4WYF A;  3LY1 A;  4CVQ A;  1BJO A;  3G0T A;  1H1C A;  1N2T A;  1EJI A;  1KMJ A;  2FN6 A;  1BS0 A;  2D66 A;  2VMR A;  3A9Z A;  3FQ8 A;  3K7Y A;  3P6K A;  4BA5 A;  1OXO A;  3NU7 A;  3D6K A;  2VIA A;  2VLH A;  1LW4 A;  1CL1 A;  3ELE A;  1D7S A;  3DR7 A;  2BIG A;  1DJ9 A;  3H14 A;  3MAF B;  1GEY A;  4PFN A;  1GC4 A;  3FFH A;  3AAT A;  1RV4 A;  3DC1 A;  4GDY A;  4LW4 A;  1IVR A;  4QGR A;  4H63 Q;  1GD9 A;  3MKJ A;  1CZC A;  3ZZJ A;  3VP6 A;  4J8L A;  2OKK A;  4LC3 A;  3UE8 A;  4P7Y A;  3EI6 A;  4WB0 B;  3DOD A;  3BS8 A;  4WLJ A;  2AY7 A;  2VIB A;  5HXX A;  1P3W A;  4UHO A;  3PIU A;  2RFV A;  1ASA A;  2OAT A;  3GWP A;  1GC0 A;  3B1E A;  4XJO A;  1LC5 A;  1MDX A;  2DKB A;  3BCX A;  4ADC A;  3RI6 A;  1AMQ A;  3NYU A;  2AEV A;  2CJG A;  5FT6 A;  2YCT A;  4PFF A;  4W1W A;  1TOI A;  3CQ5 A;  3FFR A;  2YCN A;  3BV0 A;  3NYT A;  2AY6 A;  1WYT A;  2YOB A;  1GCK A;  2AY2 A;  3A8U X;  2G6W A;  4OMA A;  4L0O A;  5HHY A;  1M0Q A;  2W8V A;  3KE3 A;  4BMK A;  5KTB A;  3I16 A;  4RAE A;  2E7I A;  4DBC A;  4R2N A;  1TAT A;  4A6T A;  1AX4 A;  4ZDP A;  5BJ4 A;  1OHY A;  2C7T A;  3FSL A;  2X3L A;  2VYC A;  3TQX A;  1TPL A;  3AEP A;  1ASB A;  1B4X A;  2ZP7 A;  3QHX A;  3AOV A;  3COG A;  4F5L A;  5EUE A;  2CY8 A;  3JU7 A;  2EH6 A;  2VMO A;  4WP0 A;  1AHX A;  3QN6 A;  3RUY A;  2BWN A;  1T3I A;  3N7N A;  1QGN A;  1DJU A;  1PMO A;  2BI1 A;  4O6Z A;  2W7M A;  1FG7 A;  2WB6 A;  4AZJ A;  3PA9 A;  1JF9 A;  1ZOB A;  2OGA A;  4XJP A;  1RV3 A;  1SZU A;  3EI5 A;  1TOJ A;  1AMS A;  2CJD A;  3G7Q A;  4F5J A;  3N5M A;  1ARG A;  2HOX A;  1DGE A;  1OHW A;  4R5F A;  4F5M A;  2ZSM A;  3HL2 A;  1ASF A;  1SVV A;  1IUG A;  1JG8 A;  2YKY A;  1BT4 A;  4E3R A;  1CL2 A;  3AEJ C;  3B1D A;  3BN1 A;  3BWN C;  1D7R A;  4ZM4 A;  2ZY4 A;  3PDB B;  1M0P A;  1AIC A;  1CQ7 A;  3EZ1 A;  3GZC A;  4IYO B;  4ADB A;  2CFB A;  4R5Z A;  1W3U A;  9AAT A;  1ORD A;  3K28 A;  4Q75 A;  3CBF A;  4K2I A;  3ATH A;  1BJN A;  1FG3 A;  2D5Y A;  2YKX A;  1TOE A;  1W7N A;  4W1X A;  2HUF A;  2Z9U A;  1DGD A;  1UU1 A;  2O0R A;  2DKJ A;  2GMU A;  2AEU A;  3ZZK A;  4WD2 A;  4CXR A;  2VGU A;  4A0H A;  1GC2 A;  3JZL A;  2WK7 A;  2XH1 A;  1BW0 A;  2D64 A;  4IXO A;  3DXW A;  3MAD A;  1AAM A;  1BJ4 A;  1CJ0 A;  3UWC A;  1ZC9 A;  3PAA A;  1XI9 A;  1N8P A;  2HP1 A;  3L8A A;  2G7J A;  2AY1 A;  4WYE A;  4TMR A;  2ZY5 A;  3AV7 A;  3JWA A;  1Y4I A;  4F5K A;  4XJL A;  2W7L A;  1GDE A;  2Z1Y A;  4WYA A;  1ELQ A;  1VP4 A;  4KAM A;  3EIB A;  4WXG A;  3PD6 A;  2Z1Z A;  3PPL A;  4W1V A;  3EUC A;  3FQA A;  2C81 A;  1WYT B;  2PO3 A;  1DJE A;  1D7V A;  2O1B A;  3FVS A;  4MQR A;  4ZLV A;  4A0F A;  2BI2 A;  1KL2 A;  4ZWM A;  3HQT A;  3PGY A;  4A6R A;  2W8W A;  3N4S A;  4WLH A;  1C7G A;  3NUB A;  1LC8 A;  2EZ1 A;  5G4I A;  1UU2 A;  5G2Q A;  5M4D A;  4N0W A;  1ECX A;  2WK9 A;  3AEL A;  3E6G A;  3LV2 A;  4FFC A;  1S09 A;  4GEB A;  4JE5 D;  3W1J A;  3FQ7 A;  1QJ5 A;  2HOR A;  3WY7 A;  1C7O A;  2VMY A;  4M2M A;  2AY3 A;  4W8I A;  4HF8 A;  4XK1 A;  4R8D A;  1I48 A;  1O61 A;  4WB0 A;  2E7J A;  1MAP A;  1PMM A;  2QLR A;  2VI8 A;  2ZSL A;  1SZK A;  2VMW A;  1I43 A;  3KKI A;  5EUD A;  2BI9 A;  3W1H A;  5M46 A;  2R2N A;  2CST A;  2VI9 A;  1JS6 A;  3QM2 A;  1MLY A;  3G8M A;  4JEZ A;  3MAF A;  3FZ6 A;  1PFF A;  2W7F A;  5M4B A;  1B9I A;  4ITX A;  5AX8 A;  4U2H A;  3N0L A;  1YAA A;  2OKJ A;  2EO5 A;  1QIT A;  3PDB A;  2Q7W A;  3GR9 A;  5E4Z A;  3H9X A;  3FZ8 A;  3ZRR A;  3CQ4 A;  1MGV A;  1BJO B;  3AEJ A;  4AH3 A;  3E77 A;  1AAW A;  2Z67 A;  4EU1 A;  3N4X A;  1G7X A;  3WKR A;  1V2F A;  1SFF A;  3MBB A;  5EIG B;  1PG8 A;  3ELP A;  3F6T A;  5EAV A;  3OKS A;  5EIG A;  4AZK A;  3RBL A;  5BJ3 A;  4M2J A;  5J8Q A;  3T32 A;  4ZAH A;  2R5C B;  2BIE A;  3JWB A;  5DB5 A;  1W23 A;  3UAK A;  3NRA A;  1W7M A;  1AHG A;  2V1P A;  3NDN A;  4ATQ A;  1E5E A;  2NMP A;  2VMT A;  3A9X A;  4WBT A;  1AIB A;  3NUI A;  3R9A A;  2YRI A;  1ZOD A;  1D2F A;  2W8U A;  1BKG A;  4JEX A;  1WYV B;  2YHK A;  4LNM A;  3N75 A;  3K40 A;  1ASN A;  2C0R A;  2DOU A;  4A6U A;  2VGT A;  1ASE A;  2VMZ A;  4MGR A;  2VMS A;  1G4X A;  4A0R A;  2ZUK A;  1B5P A;  1MDO A;  4PVF A;  3BCA A;  5C6U A;  3GET A;  2ZY2 A;  2JJF A;  1N31 A;  4ITG A;  1AHY A;  4BHD A;  4ADD A;  4IW7 A;  4MQP A;  1X29 A;  2E7U A;  3F9T A;  1ASG A;  2Z61 A;  1D7U A;  1DKA A;  4E1O A;  2FNI A;  5E5I A;  4JEW A;  3LVJ A;  3LVM A;  3FZ7 A;  4Q31 A;  1YIZ A;  2E54 A;  1I29 A;  1M4N A;  2FM1 A;  4OTL A;  2W8J A;  2BYJ A;  4EB7 A;  2XBN A;  4ZDL A;  4KXK A;  3WCO A;  1AJS B;  5M49 A;  4IXS A;  2X5F A;  5DJ9 A;  4GSA A;  3FDD A;  1J04 A;  1X0M A;  2V0Y A;  3TCM A;  1BQA A;  3MC6 A;  4JEV A;  4ADE A;  4A72 A;  4UQV A;  2VGW A;  3NNK A;  4MY5 A;  1JS3 A;  1YJZ A;  3EI7 A;  3B46 A;  5LH9 A;  4AOA A;  1V2D A;  3AOW A;  3HT4 A;  1EQB A;  3HBX A;  1M0O A;  4MKK A;  2HP2 A;  1B9H A;  2BI3 A;  1YIY A;  2D65 A;  5F9S A;  3F0H A;  4F5G A;  4WXB A;  1AHF A;  3BWN A;  1O4S A;  3AEN B;  2VMP A;  2W8T A;  2X5D A;  4WYD A;  4ZM3 A;  3CAI A;  4EMY A;  1GEW A;  1AY8 A;  2BKW A;  4E77 A;  1IX6 A;  4CXQ A;  3KGW A;  1LC7 A;  1S07 A;  1CS1 A;  3AEM A;  5EFS A;  3QBO A;  4RIZ A;  5G09 A;  3Q8N A;  2VGS A;  5LHA A;  1J32 A;  3NX3 A;  3E2Y A;  4KYO A;  3EI9 A;  3MC6 C;  4BA4 A;  2Z9W A;  4JF0 A;  2JIS A;  8AAT A;  2GB3 A;  3LVL B;  1VEF A;  4DQ6 A;  1M7Y A;  3MEB A;  3RCH B;  7AAT A;  2WKA A;  1G7W A;  1KMK A;  5E3K A;  1QIR A;  4RM1 A;  3ASA A;  4H51 A;  3ZRQ A;  3AEO A;  1UKJ A;  3H7F A;  3L44 A;  2VGV A;  4ZSW A;  3IHJ A;  3P1T A;  2W7H A;  3ECD A;  2VLF A;  1BJW A;  1WST A;  2PB2 A;  1E5F A;  2D63 A;  4XEW A;  3WX9 A;  1CZE A;  1CQ8 A;  3ASB A;  3RQ1 A;  1M32 A;  2QB2 A;  3BB8 A;  4B98 A;  4RLG A;  1AJS A;  4OBU A;  1CQ6 A;  1KKP A;  5FT5 A;  2F8J A;  1H0C A;  2W7J A;  3PJ0 A;  3ACZ A;  1U08 A;  3I4J A;  4MKJ A;  4RJ0 A;  3GJU A;  4P3M A;  3TFU A;  4OT8 A;  1AMR A;  4IYO A;  5DX5 A;  3WCN A;  4W91 A;  1WKG A;  2FNU A;  3I5T A;  1ASL A;  2JGT A;  4RJY A;  3FRK A;  1IAX A;  5D5S A;  1LK9 A;  4FL0 A;  1YJY A;  1C4K A;  1BQD A;  1GEX A;  3E9K A;  4ZDO A;  4GE4 A;  1IBJ A;  3LWS A;  4RIT A;  1FC4 A;  4ZWV A;  4RKD A;  4EB5 A;  2HUI A;  1Z7D A;  4ZAS A;  4E3Q A;  5IWQ A;  3PDX A;  4A00 A;  3FD0 A;  2EGY A;  3GZD C;  1B5O A;  1G4V A;  4OYT A;  4A0G A;  4HVK A;  1ARI A;  4K05 A;  4CBS A;  4IY7 A;  5F8V A;  5I92 A;  4GRX A;  1IX8 A;  3VOM A;  1ARS A;  1AHE A;  2CAN A;  3FTB A;  2DGK A;  2HOY A;  3GBX A;  4ATP A;  1RVY A;  4Q76 A;  1AKC A;  2W7D A;  4JE5 A;  1MLZ A;  4F5I A;  2D7Y A;  3JW9 A;  1UU0 A;  3QGU A;  3A9Y A;  1AJR A;  1QIS A;  2R5C A;  2JG2 A;  1W7L A;  3A2B A;  2KFP A;  1M6S A;  2D7Z A;  4WXF A;  4ISY A;  2FKI A;  1RVU A;  5DJ1 A;  1LW5 A;  3FDB A;  4B9B A;  1O69 A;  3M5U A;  5K8B A;  2VMV A;  1C7N A;  1ELU A;  2HZP A;  3IF2 A;  4Y0D A;  3EIA A;  2W7I A;  2EPJ A;  1GC3 A;  4AO9 A;  2QA3 A;  4WYG A;  4LNL A;  1QJ3 A;  2QSR A;  1V72 A;  2YRR A;  2JJG A;  3FCR A;  3FVX A;  2W7E A;  4XAU A;  3AEM C;  1LKC A;  1YOO A;  1MDZ A;  3DXV A;  1C9C A;  1C0N A;  1IJI A;  1QZ9 A;  5D95 A;  2BYL A;  2AY9 A;  2W7G A;  3LG0 A;  1OAT A;  1AIA A;  3E2Z B;  2QBT A;  1KKJ A;  1ASC A;  2GQN A;  3B8X A;  2HOZ A;  2JJH A;  5HDM A;  1DFO A;  4GE9 A;  4NOG A;  4OC9 A;  4UHM A;  4CBR A;  2EZ2 A;  1TAS A;  1YJS A;  1ASM A;  2TPL A;  4ZSY A;  1YNU A;  3ZRP A;  1MAQ A;  2DGM A;  2JJE A;  4UOY A;  3VK2 A;  3NU8 A;  2Z20 A;  2ZJG A;  2AY4 A;  4W5K A;  1VJO A;  2ORD A;  2DR1 A;  3GSB A;  3N4R A;  3TFT A;  2ZYJ A;  4IX8 A;  2FYF A;  2VGZ A;  5G0A A;  3VAX A;  3EZS A;  2CH2 A;  2CTZ A;  3HVY A;  1WYU A;  4PIW A;  1OHV A;  3KGX A;  3VK4 A;  3E2F A;  1EG5 A;  3FVU A;  1AKB A;  1IX7 A;  3BC8 A;  2AY8 A;  3OP7 A;  1AMA A;  3CQ6 A;  4I8A A;  3DR4 A;  3FKD A;  2OGE A;  3ISL A;  2WK8 A;  1OXP A;  2QMA A;  3VK3 A;  2X8U A;  4LW2 A;  5TF5 A;  1SZS A;  4Y0I A;  4WYC A;  4BQ0 A;  3QPG A;  1IAY A;  4M2K A;  2ZC0 A;  4J5U A;  5G2P A;  3DYD A;  3MAU A;  3WKS A;  4Y0H A;  4EFF A;  2A1V A;  1S06 A;  2BWO A;  1TOK A;  2CJH A;  1WYU B;  2HUU A;  3AEN A;  2CH1 A;  2BI5 A;  2VMQ A;  4Q6R A;  1ASD A;  4N0B A;  2DGL A;  1WYV A;  2VMU A;  2R0T A;  1X28 A;  1DTY A;  1B8G A;  2OQX A;  4F5F A;  3LVK A;  2YCP A;  3TAT A;  2C44 A;  4OBV A;  5JAY A;  3NYS A;  2QB3 A;  2YKV A;  2Z9X A;  3DRD A;  3DU4 A;  3BWO A;  3HLM A;  2AY5 A;  4TN4 A;  1I41 A;  1WKH A;  4RKC A;  2BIA A;  4F5H A;  2ZY3 A;  2O7C A;  3E2Z A;  2GSA A;  1AY5 A;  4UHN A;  3RCH A;  3WLX A;  3BCB A;  1V2E A;  5FT4 A;  3USF A;  3WGC A;  1KL1 A;  2PB0 A;  3B1C A;  3WZF A;  2YKU A;  2VMX A;  4JEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...