8CGTA

Structure of cyclodextrin glycosyltransferase complexed with a thio-maltohexaose
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGAWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
total genus 230
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 8cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 8cgtA01
4M6ML 1RZKH 3VRLE 3MA7B 4K3EL 4PTTB 2P48B 2Z8SA 1OD0A 3ULUC 1FO0L 3VXNB 3HI6L 4K3GA 5BRZD 2DT1A 2GCYA 5FIEA 5GIRB 5IB5B 3X3FH 1EV2E 1G7MB 3CD4A 4NQCE 1KOAA 1SQ2N 1K85A 4YHGA 3UCQA 2F5AH 4AMXA 5BRZE 5DR5L 1KN2L 4JY5L 5K9JH 5LJYH 3OLGA 3UTTE 3SQOL 3IS1X 5L88L 3IVKB 5E8EB 1AO7E 1KTBA 3H55A 2GJZB 3F6LA 3MRLA 5AAWA 4BQ5A 2J8UE 3TIDA 4PJ5D 1KB5L 5KSUA 3JBG7 4ZUVA 4WO4C 3IDIB 5D7KD 4ZXBA 1YMMB 1G9MH 3TESA 4HS3B 4LARH 1UB5A 3HG1E 4WHTB 2O61A 3G6AA 1HWGB 1FLRH 1DANU 1HI6B 3QBTB 4JKKA 5D7LE 3BUPA 2DMBA 3EOTH 1A6VL 1RUKH 4AMKH 1A4JA 3TYFA 2Z8VC 3ZJ8A 1ZLVK 2D3NA 4S1SH 3VI3E 3Q1SL 1H11A 3CK0L 4MWFB 1U6AL 1SEQL 2C1OB 2YBRA 1M7DA 3RVVD 2FSEB 3RY6C 4NYLB 3MLRL 1HKLL 3W25A 3QXTA 1QLRB 2BV9A 3Q5YA 1NBYB 3D25B 2VRJA 1HIML 3S4SA 4LLWA 2DMKA 2Q8AH 2WWKO 4GQRA 1IKNA 1ZEAL 1Z0NA 5E8EA 4HC1L 3OKEB 4HH9A 3EDJA 2OL3H 1G7IB 1T21B 4ZE4A 3PHQB 4XMPH 1CZ8L 2FWOA 3T2OA 1J7VR 1HEZA 2VDKL 4OT1H 3VXTB 2DQGL 5BRPA 5E2JA 1E55A 5C6WH 3F12A 4KK9D 5ABHA 3T2QA 4UNUA 5ETUA 1UCTA 5KS9B 4FFZL 4TSBH 3DYOA 4K8RC 1MJJB 2F5BL 5DYOB 5HDQH 4JFWA 2WC3A 4P99A 4MS8D 3BAKA 5EU6A 3RDKA 3CU7A 4JHWL 5EG6C 4ZXOA 2I9LA 1SJEA 5J1SC 3MUHL 1CD1A 2MPAL 2X6MA 5EORL 4HG4J 1B4RA 1XSIA 3UROR 1D6VH 4TVPE 2ZX6A 3EYOB 5F7DB 1HHHB 1DBAL 1I8IB 3DVNB 3QI9A 3ZO0A 5KSUB 4TVPH 3UYOD 4Z7UB 4M03A 5L2JB 4ALAH 4GINA 1VJZA 3S2CA 4U1HA 4U6VH 4NQSB 5E09A 3O3AB 5TE6H 1IEAA 1FVCA 3O8XC 3HG1B 1UM4H 2QBWA 3P4NB 4AENB 3RM4A 5JBDA 3LV3B 4LCIL 3E3QE 4LGSB 1T22A 2NY6C 2R56H 3SKOA 1CWVA 2VLLA 1Q9LA 3GXFA 4TULH 1J10A 3HFMH 1EXUA 3NZ8A 4M8QB 1JYXA 2CO6B 4UOQA 1NAML 4JY4A 2E7MA 4UB0H 2R0LH 3UCRA 4TUOB 2X0HA 2R23B 3NFNA 4QYOA 4G8GB 1VIWA 4ORGB 4DEPB 3EMQA 5EOQH 3UETA 4ONHB 1L7IH 4I18A 4JY5H 5HY9A 4KTDL 2D7QA 5DJ6B 2M2DA 3QEUA 3BKML 1INQB 4I2XB 3VXPB 4UT7H 4MQSB 1QVBA 3ARBA 3PGCB 1DE4B 1EUUA 2HISA 4XCEA 4OZGA 3OKEA 4WO4D 1DBMH 3IXAB 4U1JB 3IDYB 1YN6A 4ZUUB 5KJRH 4PUEA 1P6FA 1JWSA 1HHGB 2VXQL 4WU5A 5E8PB 1D6EA 2CJUL 2ZOKA 1G7HB 2YA0A 2QL1A 4L3EA 2YS4A 3RWFB 1A6WL 1MPAL 5I74B 4U1KB 3VXUA 3WXWL 2HRPL 3GMNB 1E5JA 3IFNH 1LEKA 3KLDA 1BFVL 2P24A 2ICWJ 2JB6A 4I3GA 1F13A 4GKZB 5A2IH 3ZDYE 4Z7VF 4QHKI 5K9OA 1PKOA 3LS5L 2IH3B 3Q6GH 4JFZH 3O4LD 5HDOA 2HT2C 3QCVH 1QP1A 1BLIA 3PV6B 5FUOL 5I8EA 4WTWA 2X4RA 4WFED 5KN5B 5JOPD 5J6HB 1LO2H 3D3VD 4EDXA 2YWYA 4Z2JA 4YHML 1XSJA 3K2UL 1RK0B 3DLQR 1MCBA 4Z76B 1DEDA 4WDIB 4K55A 2ZSWB 2V3GA 2F19L 4JN1H 5E94B 2G4FA 4R4BA 1XRVA 2XHYA 3MSGA 4GXVL 5H2BA 2HWZH 4W93A 2AXFB 2P8MA 2Y06L 3PWLB 2PXYD 4XUYA 5BOZG 2R9HD 3FB8B 3OKMA 5ICXB 1XF2A 1FOBA 2MQ0A 4KVCL 3OB0H 2UZXB 1ZGLA 3QCUL 3O4LB 3QUZD 4UINH 5MI0B 3D1MC 5BXSA 2YL5A 2DQJH 1KGCE 3FQNB 4ZTOH 5LGKA 3MJ7A 4GO8A 1F4XL 1SBSL 5IHSA 2AJ3A 1QNSA 3IYLW 1NAKH 3PP4H 4I18B 2PUQT 2GUOB 2V7HB 1RUQH 1TETH 2AJVH 3SOBH 2F74A 2HFFA 2HFTA 4P2CG 1MH5A 4U3XA 3PWUB 5GZNC 5JHDB 2NY5H 4PS4H 3MV8E 1QA9A 1XAUA 3RGVB 2AS5M 1BIIA 1QFWH 1A9EA 1JRHI 3MGOB 4N0CD 5F3BA 5MP6L 1Y6KR 3L5HA 1MFCH 4HOXA 3OL2A 1E3ZA 5GGTL 4XNZB 4MDIA 3A24A 4TNVF 1AXTH 5EZJA 5LAXB 4OD3L 4ZTPL 2BDNH 3V0WH 2F9BT 4P57B 2BVOB 4OM0H 3DRTB 4NZTH 1IFHH 4RAVB 4G9DB 4OLEA 2YUXA 3RWCA 2ZG1A 1K4CA 2XACC 3O9WA 3OLEA 4NYLA 5D1XB 5DJXA 4YC2C 1EEQA 4RA3A 4KY1L 4ORZC 2LVCA 5LAXA 3KG5A 3I6LD 3GJEA 1TZHB 1R75A 1ZBVA 3T0EC 3ME0A 3OGOE 4QRPE 3WSQL 2AXHA 4GAFB 5CJXA 5FYLD 4Z0XB 2CRZA 1T5XB 3STBA 1EQCA 2N4IA 3HI6H 3EYPA 5A2LH 1DWIM 3X13B 1J0YA 5DJZA 1QFWM 3SE3C 4Q6YA 4Z95L 4ZAKC 3TPUA 6CGTA 3TVMD 2BFVL 4WLCA 2AVGA 4HUMB 4PJ9D 2NSXA 2DTSA 2V5RA 1KBKA 3MRGA 4P2QD 4RE4A 5IXEA 1MFUA 2R29L 3VG9C 4DO6A 1R6VA 3FB8A 3LEVH 4DKFH 5AD0A 1MCHA 5I1KH 1GQIA 3ES6B 3FRUA 2XV6B 3O6MH 1TVHB 4L1DA 4JY6B 5D1QD 1MCPL 2AJZB 2CEQA 3HZYB 3FN0H 3HHRB 4R7NB 3WQVA 1A7PL 3CU1A 1CG9A 3O81A 3RKDC 2W92A 3D85B 3KYKH 5I1AA 2XY2A 4WEBL 1NANH 4TYUA 3EZ8A 3A67L 15C8L 4XZBA 2WBWB 4JFFA 3VI3F 1E6ZA 3CK0H 4R26L 4GXUN 1KB5H 4BZ1L 1P7HL 4LGXA 1LO2L 2VAJA 3FB7B 4NO0D 4TOQA 3GBML 4KMTH 4OKVB 5EIIB 5A2CA 1NCCL 4GG6F 2BNQE 3VJ6A 4P7QA 1ZMYA 3QIWD 5C07B 2WUCH 5CHNB 1A6UL 5FM5M 1MQ8A 2BVQA 1E4WL 4MD5B 1W2VA 1V7ML 3L3DB 4NN6B 1JPFA 4X6DF 3HI5L 1V7NL 4IOSD 4QWWD 3BQUC 4YHZH 2UV3A 1Q6CA 2UZIL 1TE1A 3I6GA 1N6UA 4OCRH 4ZS7H 1KJ2L 3CLWA 2MTPA 1UXSB 5DZNA 1ZGLM 2LAGB 3RUGA 4YZFE 3NGBC 4LU5L 1DBBL 5L2KA 1KXQA 4P23B 1XR8B 5GGUA 3WUBA 1FVEA 5E9DA 3WKML 2WC7A 1UQZA 2QHLA 3UO1L 2IALA 3BPCB 3QIUC 3X12B 1G5AA 1H0DB 2EXYD 1NGZB 5MEOB 2F5BH 2W9DH 1TJGH 2DSVA 4G9FB 5IK3B 1BGXH 3FONB 3QWOA 4PTTA 5AYUL 1P53A 4IOFD 2EDKA 2FJHA 4PJBF 2FD6H 3QFJE 3FQRA 2VMFA 3WL9A 1TA3B 4RE2A 3U7YL 3IKKA 3VXOA 4D0BA 1H09A 5K9QI 5HJ3B 1YY9C 4LKCA 3MRQB 1QACA 2WBGA 4NJAL 2OTWB 3FFDB 1YPZE 1MQKL 4F8TA 2CUMA 5IFAH 1D5BB 1F3DH 3U0TB 1JZ6A 4HZ8A 3QQ9D 5F7YC 4R7DB 1OSPH 3EJYC 2QQLL 3FO1A 3GJFK 2X7LB 4YN5A 2ZUTA 4E0RA 2PKDA 4EN3C 3SDYL 1ZBKA 5LWYL 4RWHA 5CD3B 4MXQC 2SEBA 5ISZD 1FNSH 4UV7L 4QLLA 5C0AE 1CICC 5E4EB 4Z9KB 4U6XA 3CBWA 4R7DA 2NXZB 3B5HA 2D31B 3U2SA 3DRQA 2EC9U 3NSNA 2J8UB 4HBQA 3F7RA 3PQYA 2AV7B 2B0SL 4G6ML 4PRNB 2CIIB 1JN6B 5IBTH 2VITB 4YK4C 3B2UD 4W68A 3WQ8A 4FXKA 4LCIH 5HYEA 1MJUL 1II4E 2EDHA 2AXGA 3E8UL 2XGBA 1KEGL 1ZHBB 4UT7L 1JF5A 4MD5A 5F1NA 1F3RB 3AQUA 4ATDA 1VRXA 3BN3B 4UR9A 4NO2B 4JRXD 5T1MA 1OTUC 3BISA 2FWOB 4K7PH 4L4OA 3AYSA 1QSED 4WW2A 3GEWB 1CICA 3MUJA 3QUKA 5EOQL 1JRHH 3FN9A 4UIMB 2AEPH 1H3UA 1NQBA 4ZUWA 4DVRL 3FFCB 5L2KB 3CUIA 3SCMC 2AK4A 5E9DD 3BFOA 1U8IB 1GQKA 2EPNA 3OR6A 5D6CB 2ZOLA 1YUHA 5DEFA 5DFVD 1B3WA 3THML 2ZCKH 4KRNA 3LPPA 1PW3A 5GS0D 2PF0A 4JQXA 3SDCD 4A6YH 1UWQA 4BZ1H 5FEBA 1QPXA 2Y2WA 4DTGL 3HE6A 5A2KH 3WN5B 2VXQH 1G0CA 4XRCA 5DQ9A 1SMAA 5DHXB 3VGGA 5DK0B 2R4RL 1LE9B 1MCEA 1CXFA 1MPAH 1SZNA 5ECUA 3CGTA 1BFVH 4I8DA 4PJDF 5IDIA 4HPYH 3QOMA 2OTPA 3AHXA 3BUYB 4WFHD 4AZGA 1T4KA 4LLUA 4RGNE 4G9DA 4HFWA 5E8NA 3ZT5A 2X4TA 4FZ8H 3ZTNH 3KPPA 4LCWE 1H41A 1QR4A 2G3JA 4QRSA 1FZOB 4OZFB 1HHHA 5DURB 1X1NA 1ETZB 3KLLA 3CH9A 4G8GA 2E9BA 3L5WB 4GRMA 2JIEA 2OSXA 1WVZA 1FHLA 1U2HA 5BW7A 4HK0A 4B3LA 3PN8A 5JZ7D 4D6FA 2PYEE 3QH3A 5K9QG 1XC6A 1U8JB 4JB9H 5CBAA 1XH2A 3B9KD 4GG8B 3GIZH 5ISZE 4X7TB 1DQJA 1ETZA 2NW3A 1WFTA 2C7FA 4LSTL 4NPYB 3B9KC 3KE0A 1I8MA 1JHLL 3WDHA 4PMOA 3WV0A 4KFZC 1HXJA 2VTFA 3GB7A 3NVQA 3BZ4A 5I1JL 1IL1A 1MF2L 3P4MA 1MFCL 1U3HD 4UDUB 5T3ZD 2C3VB 2XNAB 3POHA 2R15A 1OSPL 4QRRE 1GL4B 2IG2L 3MRNB 2CMRH 3VM7A 4S0TD 4QHNB 3BN9D 3LXCA 1CIUA 5LWYH 1INEL 5KSAC 2ZXBA 3SUUA 4MADA 4KUCF 3MROB 4QRRD 1MQQA 4PBWD 3BH8A 4DN4H 4Z7NE 2JJTA 3PGFL 4PGJA 5ABFA 3FTGA 3FOLA 3LMJL 2J62A 1DCLA 4EANA 2R2CA 3NCEB 1YMMA 3MCG1 2RIKA 5D8JL 3ZL4H 4NZUH 2OM5A 2DM4A 5AUMB 4DK6A 5B3JE 1XF3B 3AS2A 1QLEH 1CE6A 2GI7A 1XIWD 1TITA 5F9WB 5KSBA 1MRDL 5I19H 1WC7B 1Z5LB 4PJ8C 2Q3ZA 4FG6C 3H42L 1I1YB 1IGCH 1SM3L 4PG2C 4K7FA 3BIBX 4CNIA 2Y23A 3LEYH 4R4BB 1KN4H 3MBEC 4XNUH 3ARDA 1P7QA 5F7FA 4NCC1 1FGNL 2VE6B 5LGJB 1KCRH 4FNUA 4LP4A 3GMRA 4DVRH 3F58H 1WCQA 5GGSY 1KIRB 1OB1B 2CKBB 2PW2B 5C0JB 3GJFH 3B9VA 4UT6H 5JORA 2UWEB 4X7FC 5DRNB 4P4KA 1I1AA 5JTWA 4TUOA 4NKOB 5IESL 3M1BB 3F65A 5FYKL 1U8NB 4HIIB 2HYMA 4C7GA 4R97B 4XP4H 4EN3A 4KKAC 2KQMA 3U7WH 5DGQA 2E9MA 3TGXA 5E2TH 5BS0D 3GZAA 1WAAF 4MNMA 2ICWI 2ERJB 2VKXA 2W4XA 2P42B 1IEBB 1EDTA 2BNRD 2X4SA 5F7NC 1I1AB 1CFSA 2PI6A 1LDSA 3MLZH 1EEUA 4X4ME 4U1IB 1RIHH 2YDSA 5F9AC 2DQEL 1P4BH 5CLWA 5FGCE 4BSWA 4J3WA 3ULVL 4AK1A 3EJSA 1ITXA 3DXAB 3DX9B 4ZFZB 4ZFOA 4IS6B 4I3RH 1EX0A 4MQXC 3TZVA 3AREA 2ADGA 2VLRA 5CUSL 4P2RE 5J8OA 4ZUSA 1GGBL 4Y5VC 3P4NA 4F8XA 1SMDA 2YBTA 1UACH 1FFQA 4JQIH 4M1CC 5EZIL 4EI5C 4ZFOB 1HH6B 3CFEA 4AM0B 1G6RH 4PLJC 5EU7E 2VIRB 4F57H 3TT3H 3UX9B 5D7LA 1G7LB 4ORGA 4NSBA 1Q6DA 2D7MA 4NKIL 4MAUH 4X7CC 4QXUH 1XEDA 1F11B 3JWOH 3M8OL 3D4YA 3WIIH 2Q20A 5JA8B 1JF1A 2EC9T 1AY1H 4YHZL 4K7FB 2A1WL 1CTOA 4ZNEA 3QPQC 2DL9A 1FNAA 5EU3B 4C55A 1A21A 1N7MH 4JZNB 4WJ5B 5IEHA 2ZJSL 4XNYL 1GC1C 1OQXA 4KUZL 4YHIB 3VD4A 1JIBA 1NMCC 2P5EE 3STLB 5ICZA 3GMRB 4FNQA 5DUBB 5DUML 3NSXA 4PTUB 4I77L 2X4UA 2XA3A 4HUXB 4QXGL 2A6DA 2XTLA 4B7IA 4F7TA 4F8QA 2DLGA 1KENL 4PJDB 2AABH 1XSKA 3WD2A 5EBLB 5CD5D 2OW7A 4AZCA 1SVZA 3L1OL 2FL5A 3KPMB 4TVPD 5EFFA 3F7YA 2IH3A 2NX5D 2NXZD 4HK0B 4U6HA 4GUPA 2Y7QB 3CSBA 3UG3A 3WKZA 2NY2B 5CS7A 4F9PC 2WCSA 4WHCA 5HHME 4NRYB 3C87A 1NLBL 3JV5A 5DJAA 1I8KB 2GSGA 3MRPA 1UWIA 3V4UL 2VLJA 1IGIL 4HWBA 1MEXL 3CVHB 1WWWX 1N3NA 3MLVL 1Z9OA 2YSSB 3KPSD 1J0KA 3APGA 3AXHA 2GJJA 3RMEA 3O2VH 2VDQH 5IW1A 4MXWL 4AEIL 1Q0XL 4U6YA 3W4RA 1GGIL 2W9EL 4KAQL 4W5ZA 5I3DA 5E6ZA 4GLRI 5JMOC 1GONA 3PZTA 5HDQL 4D0CA 3DXAD 3WD5H 5IESH 4TTDC 2XN0A 5EN2A 4LSSH 1G6VK 4XBPB 2DQIL 3NA9H 4ERSL 4ONHA 4OZFA 3SDXF 3HG5A 3U7WL 1CLOL 3DXAE 4PPTA 3VXRD 4UDTA 4WFFE 3VWKA 5EU4A 4LCWD 2GFBB 5DMJB 1IRAY 2H32A 2AEQH 4RNRA 2A6KA 4ZAKD 3V7MA 1EEYB 1TTFA 1ZA3B 5DUPH 3BRGC 1EGZA 3LV3A 5CZXC 2FYVA 5A3HA 4O51B 2QADB 2IFFH 3FAWA 4JFHE 2EH8H 4X9FA 1L0XA 4LFHG 4LP5A 4Z7WF 5EUKB 3IAGC 4JPKH 2YSSA 1DQML 5D9NA 2N1KA 4QTIL 3BXWA 5AEAA 1MIMH 3WFCL 1QO3B 1FPTH 4P57A 2LTQB 3MA7A 4H0IA 5GS0L 5CZVL 3AICA 3CO4A 2CH8A 1E6XM 3DSFH 4G7VL 4NUGH 3NUKA 1RZJC 4JM2C 2Z93A 5EOCL 3GYCA 1HT6A 4A6YL 4I5BB 3P73B 4YJZL 1FQ9C 1UB6B 5F3BB 2HJLA 4DGVH 2CXKA 1L0QA 1J05B 2EDFA 3AHVA 1TDQA 1BFNA 1S7UA 3MSDA 3LRKA 5GS2D 1YYLH 3C5JA 4Z7VE 5AYIA 5F6HJ 4M1CD 3S88H 2EJ1A 1CDGA 5TF1H 1DLHA 4UIKH 3DDGA 3UJTH 4BYHA 5HNNA 3TONA 3K81A 4M6MH 5DQJA 1QSEE 4D3CL 3UTOA 4CD7A 4QRPD 1A64A 4E0RB 4HQQL 2P8LA 1U91A 5A8OA 4HGMA 2DQFB 1KG0B 4NDMA 4OCSL 4F9LC 1ZGLP 5D1ZB 2J5LC 3IFLH 1T2QL 5BV7L 2HJFB 1GZQA 3QQ3B 5TH2A 3WFLA 2P8MB 3DYPA 3PWLA 2HVMA 5L0QC 4LVNC 1AQMA 1XF2B 3QHMA 4Z78B 2Q7YA 3K80A 2F1BA 5FHAL 1GOMA 4N0UB 3LIZH 5D1ZC 4PRHD 4G8EA 1U91B 3MJ9A 3WDJA 4K9EL 4MNQD 1D5XA 5D1ZA 3DVGA 3V7AE 3JV6B 1OTTD 4HAFA 2WIMA 2VDPH 1B3XA 5FUCE 1E72M 1YJDH 3BESR 1IQDB 1U3ZA 4OD1H 5H37G 1W72B 5A6MA 2M1KA 3CXDL 4JFXA 5FFLA 4NP4L 4PJEE 4EI6A 5HHMD 4RFNC 4CW1B 5IW6B 5EORH 3BGFB 1X3DA 2R2HA 4ZAKA 1UJ3A 1FV1B 2IBGA 2CKSA 5HHXL 1BZ7A 2E27L 3LMJH 3OKDB 1J8HA 1VSCA 1WWCA 4GKZA 1B4JH 5GGVY 1CF8L 2HWZL 1J1XH 4HJJH 2BNUA 3POCA 3GH4A 5DC4B 3EFFB 3AXXA 1RMFH 1M1SA 5DEGB 3QCUH 1DTUA 4PJ8D 3RA7L 5E1QA 2Z92B 1ADQL 1YEEH 4OCYH 2NY5C 1FZMB 3FT4A 3C08L 1Y18B 2C5DC 3AM8A 3PTKA 4H0HB 4YHPB 3QUXA 3MREA 2AKRB 1LQSR 3NFPB 2ZNWA 4OKVA 2P5EB 1I9JL 3PZQA 2AJVL 3SOBL 5CKAA 5DRZA 5FOBB 3OG4B 3OKNA 4GRMB 2R2BA 3O11A 2L7UA 2BVPB 4I0PC 2BY1A 1U58B 1RUAL 3V6ZA 3WHE0 1HINL 3ZDZE 3D2UA 4KHTL 1MHCA 2DWEB 3OJMB 5EOTB 3SE9L 1CVRA 5FAAA 4CVXA 2F7QA 2WHLA 1JPGB 3A5VA 4E9LA 3DMMB 1OTUD 5HHOA 3QZWA 4LVHB 1AI1H 5EZLA 4K2UH 4HA1A 1A7QH 3IDUA 4GJTB 3UBXA 3EW3B 3LPWA 3T3PE 3OAUH 1TJIH 3HNSL 1FPTL 3LKPA 3VOCA 5C1MB 2VSCA 2H26B 4J8RA 5JIHA 4PRHA 3ZDXF 3L3HB 3GHEH 4LIQH 3BT2L 3DETD 4FQXC 1CFTA 4NO3A 1T5WA 3S3SA 1JFQL 1FL3B 1P7KB 5JZ7C 4WNQB 5F6IB 4RBPH 3KLSA 3OX8A 3QHZL 1ACYH 4K3DL 5CSUA 3CH1B 5D9SA 1EFXD 2KBGA 2XKNB 4RCAA 2PW1A 4W81A 1S46A 5T5NF 1T6VN 5FUOH 4AH2A 1E6JL 1EBPA 1FG9C 3AFLA 3BH8B 1NEUA 3NN8B 4M93B 4EDWL 1KV3A 1U41A 1VF8A 2DYPB 3S3JA 5KTEL 4XV0A 1PX8A 4ZODA 5IVXB 1K4DA 2ZG2A 1RZGA 1IAMA 2HVKA 1KBGH 5FECA 3R06A 1AQDA 5FCUL 4EIZC 3EMZA 5KS9A 2OYMA 4OD2B 4PJXB 4QLKA 4AD0A 1QSZA 4LYRA 1AR2A 4JZ5A 2KKQA 2O5ZH 1QR1A 1MCLA 2A9MH 4WU7A 5E56A 4HAGA 1S7WB 1CZ1A 4MDPA 4W8BA 2XWTA 4KVCH 2VX5A 1J9YA 3LIZL 3GMQA 4HULB 1YY9D 2BY0A 5J4MA 3HC4H 3MZGB 2XFFA 3ARGB 1NC4B 2B5IC 3IKCA 3QO0A 1N7ML 3QUKB 4P5TA 4TXEA 2ZUMA 2VX7A 1DSFL 3HAEA 1HCVA 3PP4L 3VXPA 4G43B 2PETA 1XF4B 2QQKH 1FC2D 3BAXA 4UQCA 4K3HA 2UY5A 4QXGH 3HPJA 3X14B 2XQYG 3IXTA 2NX5E 3F7VB 4H8VA 4HK3J 5HHXH 5J6HA 3BXNB 4M9PA 1JYWA 1EOMA 3K8MA 1EEZB 2ADJB 3W26A 1WBYB 3KYMA 3CZGA 5E8OA 1K4DB 5EA0H 3N9GH 3CIVA 1KGCD 1FBIL 2JJVA 1V7MH 4WY7L 2VLKB 4Y16B 5HGAA 1J05A 2E9IA 3FFDA 1HI6A 4HZLB 4J7RA 2CKRA 3QCTL 2Y8VA 4LLQA 1OGAB 3KDMB 1JWMB 4XVSH 3VDBA 2C3VA 4AT6A 4UFKA 4CVWA 2X89D 2UYLB 1JZ3A 3TIEB 3MACH 4HH8A 1BX2A 4YHLH 4QO1A 3CHDA 2HJKB 3C09B 1P4LB 5MEOA 1U92B 5FYJL 1JK8A 2AGJL 5C07A 2WPGA 2CITA 1OGAA 1BAFL 1NGWA 4AEFA 3EDDA 1C12B 2KZWA 4OJFL 3U36B 4NHUA 4EKJA 1IGIH 4MQTB 5AYUH 4WF7A 1BF2A 3VFMB 4KHTH 1BIIB 4NQCD 5ESQA 2DYPD 3SE9H 4RISL 3IFPA 3WJJC 3GSVA 4MAYC 4N90D 4O4YH 3QQ9C 5HVHC 1E0VA 1V0KA 3GSWB 5BYWA 5IMMB 4L4TB 4L8SC 3VINA 2ZXQA 3VXNA 1R3IH 1KB9K 4S1DD 4L9LB 1WAAE 4QFUA 3KGRA 1OM0A 1XGYL 3QXVA 5A6AA 1MI5A 1XCTA 2DLEA 4PEEA 1NSNH 1AQKH 5IFJA 4LPWA 4PJ9C 2CQVA 4X9IA 4TNWK 3HJEA 3WH5A 4YFLI 1NC4A 3MYZA 5I0ZA 2WCAA 3U82B 1R46A 3QIUD 4NNXA 1TMQA 5I66A 3WUEA 4M43L 5FO7B 1FZJB 4XPFH 4KZEH 3H3KA 4PJ9B 1OAYH 3QNXB 2HJKA 5DMIL 1L4IA 3CFBA 3NPSB 4TUJA 15C8H 2AK4E 2IXUA 5CJOH 2EQDA 3HR5B 4AIEA 2H45A 5FD0A 4JLRB 3VM5A 4IEFB 4FN0A 3EYOA 1B3ZA 3NTCH 3T0ED 1KXQE 3KNBB 5EIQA 4UT9H 3WNMA 4X9YA 1RP8A 3WFBH 1C92A 3A3HA 3GSNH 3TF7C 2CR3A 4JFEA 4JRYE 3LN4A 3FAXA 1H8OA 3VWJB 2K3TA 3L5XH 4PLKD 1BZ7B 1T6WA 5CWSA 4YUEL 5K33A 1KJ3L 5EBLA 4UIMA 4K7PL 4V2BA 4GPNA 1TTUA 4Y2DD 4YEEA 3N0PB 4QHMA 4ZPTA 3VSTA 4N9GB 3TBWA 2CHNA 1VGKB 1U8HB 1NDMA 4QAWA 5IMLA 4F7PA 3G04B 1FIEA 1Q38A 43C9A 4O2CB 2PWDA 4MA1B 2CCRA 3MRLB 1DBBH 5DT7A 2IQAB 1AVAA 2ICCA 3QRGH 2VN4A 5HPCA 5KAQF 2I24N 3IVKA 2IXVA 3ECBA 4HHAB 3U79A 4F58H 1BIHA 5FYKU 2ZKHH 4K23H 2F54B 5L7XL 3MRMB 3PWVB 4QOKD 1UYWH 3VWJD 4NM8L 1LO5B 3MJ9H 4DKEH 2J7BA 2MQ3A 2NR6C 4JDTL 1DHKA 3G6MA 1OF2B 4PRIB 3B8SA 2ORBL 3QRFM 5E8NB 4M7KH 3H3PL 4Z0XA 2VJXA 1KPUA 3GM0A 3QUYC 3KPOA 1OD7A 5M17A 4FZ8L 3LS4H 3H54A 5E1HB 3ZZ1A 4P3CH 3T65B 1YJDL 2BC4B 2ZWZA 5CPQA 2VR9A 3UC0H 1E4XI 1MREL 4LRIA 1BECA 5C3TA 1FYTE 4NFBA 4GRWF 1E43A 3VXQB 1UZ6E 4NOBA 1VFAB 2OWWA 1YPZF 2W91A 3MGAA 2P43B 2Q3AA 4URTB 3C2AL 5ITBL 5KS9F 5DVKA 1J5OH 5AYQA 1H0IA 5IB1B 5E5RB 1CDHA 3UESA 1GQJA 4R27A 4N8VG 1TJHL 2Z91B 3EYQD 4EUPA 2APVA 4RWYL 1BVKB 1OPGH 2YBRB 3JTSA 4S1DC 1TVHA 3ZLQC 1S8DB 4F7CA 4GMSH 3GNRA 4YE4L 2GUYA 4IM4A 3HE7A 1BSIA 5I1EL 1KJ2H 1D5ZB 2AXFA 4Y89A 5DDHB 4YHKH 4L4PA 1INDH 4KK6C 3IJ9A 2WWMD 1UXSA 4LASL 3UERA 3NCCB 4CCCA 3HZVA 1PD6A 1QI5A 1TXKA 3EYFA 1QKZH 2XKSA 4DFIA 4JFYB 3F5WB 4PTXA 1BQUA 3SCSA 1EO5A 1XGQA 3E6FA 1EFQA 1J12A 4AZ7A 1EGJH 4NQDA 1QPKA 4G8EB 3VFVA 4KZEL 1EVTC 3KYAA 2ZCHL 3IJSA 3FQWA 1XT5A 1WFNA 2YPKA 1N5AB 1CK0L 4ZSOB 4XGZB 3KPLB 1CU4H 4OFIA 4BK5A 2ZE0A 5C0GB 2CDFA 4XAKE 4D72A 3CX2A 3GSNL 1LNUB 1A7QL 3EYVA 1EXPA 3W9DB 1OLLA 2XY1A 3NOIA 2XZCL 1MWAA 1QHPA 1TZGL 1UVQB 3U83A 1JVKA 1QFOA 3MRFA 4ZO9A 1I1RA 1T0MB 4C56A 5JW4N 4CN4A 3MXWH 5JXEA 1W3JA 2O26U 3GK8H 3PZIA 1HN1A 1YNLL 4BH7B 4NOFA 5MHSE 3VI4F 1NDGA 1R3JA 5BOPA 3O41A 1D3CA 2WLZA 2WQ8A 2XZAL 3MNWB 4BZ2H 4XVTL 4AD4A 3QULB 3HKFA 2QSTA 1IAIM 1S78D 1KJ2A 3HZ3A 3FQRB 4HKZA 2A6JA 2F53E 4D0BB 4Z6AT 3IRPX 2FJGA 3U5UA 5IROC 1U3JA 3W27A 3HE7C 2LABA 3VXUD 3LXBA 2Q76A 3C5SB 1DLFL 3QDMD 3GKWH 4H25B 3HU7A 1JN6A 2G9HA 4Z2HA 4JRYB 1M71A 3GIZL 2VC9A 3MLZL 1TCRB 3HC3H 3QG6A 1K3IA 5CJBA 3PZMA 2O5ZL 1IGJA 3IFNL 1OGTB 3JWDC 3WF4A 1WZMA 4BQ6A 3QR2A 4PV9A 1J8KA 2XVGA 3PWJB 1BWWA 1FORH 1E28B 2FATL 4TTGA 5E6IB 3JTTB 3QCVL 3C8KA 5ITFB 3N9GL 2D4DA 2QSCH 3HE6D 4E42B 3QIBC 4KGLA 1U8HA 2R0WH 4EDXB 1FFOA 3GRWL 3W0WA 1AMYA 1CDIA 2X4RB 3TT3L 3TTOA 3WJLC 1UD2A 1IM3A 3QZWB 5EZLB 4MJ6A 3BVNA 2P5WD 3MNVA 1OCQA 1JGDA 1RPQA 2YPLD 5EA0L 2FDMA 3NDZA 1CL7I 3CAFA 4PTWA 4JJ5A 3T0XA 4MDJB 1ZEAH 2AJUH 3C6LA 3O4OB 1I8KA 2GSGB 1J0IA 3MRFB 3H42H 2VLJD 4BQCA 2JJSA 2DBLH 1R7OA 3O8XD 5IQ7L 1EZVX 2W1NA 1S7TA 3VU2A 2MCPL 3WIHL 4ZTOL 3A21A 5ID0A 1QBBA 3FHAA 1OVZA 1PZ5A 1WIUA 4JL1A 3RQ3A 4AD2A 5JDJA 3OJVC 3CFKB 1P69B 4KQ3L 2IH1B 3LKOA 4FQLL 1BWMA 4JJHA 4X9BA 4EOWH 1LK3H 1NJ9B 4TUKL 1FE8H 3JZ7A 1MJ7L 1NGPL 3OXSB 4PJCE 1XMWA 2O61B 4FXGB 3QHOA 4X6DA 3MRBB 4PR5A 4F7MB 3D6GA 3G04A 5EN2B 5GGTH 5DMKA 2VDRL 1HHKA 1JGVL 2XQYK 4MS8C 2CERA 3MFFB 3QDMA 4OD3H 3JV6A 4OD2A 5KSVA 2YUWA 3CUPB 5EZOH 1KACB 3I3DA 3PXHA 1BPLB 3AYRA 4RX4A 4C83B 4KRPB 4XAKD 3N04A 5FDWA 1NLBH 3N85L 2D7PA 2I27N 1KFAH 2VR5A 4CDHA 3ZE2F 4M48L 4TNWF 1NEZA 5I1LA 1MAJA 1HJWA 5D9OA 1RIHL 1ZS2A 2E6JA 3MLXL 1EEZA 1S8DA 4OZIF 1CXEA 3QDJD 5KSAA 1TZHA 3CLEL 3HC0A 3NTCL 2I9TB 3ZSTA 2A0LD 4X7EC 5CEYA 4FNTA 4XCYA 1ND0A 5GIRA 4AEHH 5BRZB 1B2YA 1SR0A 3IDXL 3T2NH 1HSAB 4PCTA 2MPAH 1ZSDA 3OIHA 1L7TL 4ESKA 1QO3A 4OCNC 3SGDH 4IUGA 2DIBA 2ICEB 1ZK9A 4U6HB 4FF5A 3FL7A 1MCFA 3W6LA 2APXA 3V4VH 1WZKA 4Q9RH 4P5MA 1CFQA 2AQ2A 3MGTA 2HG5B 4IRJA 5GS1A 2DQUL 2HJLB 2P5WA 4P0DA 2XN2A 2EZ0D 5DJ2B 3WO4C 4D6IA 3T1WA 5K9KA 3QIUA 1HJUA 2GJXB 5D1ZD 3P30L 2P8PA 4ZXBB 1W9PA 4YBQD 3WSUA 5ENWB 4ZENA 3EO9H 1A6TA 2XRAL 3LEYL 3SE8L 3DO7A 4WFGD 3BEVA 4U1LB 2GAZB 3ALGA 3GH5A 4NZRL 3EJJX 3VFPA 3T0AA 3SBWC 1Q9OB 5KJRL 3BZFA 1Q9KB 4EJ1C 1HF6A 3SKMA 3WKNA 4NM8H 1JNJA 2OSLA 4P7OA 1CQYA 4JPKL 4I2XE 5SWZA 5KW9H 3DARA 4BK4A 3WXWH 3LZFH 1U9KA 1OT1A 4LRNH 3HLAB 4OBSA 1QSVA 1X5FA 2DS4A 3TA3D 32C2B 4MZ2A 1K8IB 1Q9KA 5ADOL 1WDSA 1MI5E 4KJYA 2B2XL 4KMTL 3JWNC 1YDPA 4AM0A 4K94H 2UVFA 4ZO6A 4DKEL 1MW3A 1JCKA 4GKNB 4WI3A 3MRKB 4BS0A 2WVTA 1MREH 3MV9E 4MQ7B 3WY1A 4U05A 2ICWA 2AV1A 3RDTC 3UBXB 3UPCA 5LYRA 4YHMH 5CMAA 5F7UA 4CCEA 1FV1A 2AJUL 4CBPA 3KYNA 3R8BB 1NANI 1T0NA 4CDGC 5E0QA 4IS6A 1TQWA 1JZ4A 4JFFB 4JFZL 1MLCA 1JJUA 2FECI 3WIHH 3KZSA 3WXVH 4AQ1B 5E2WH 3MOBL 4TQEL 4UTAH 1HSAA 2J8FA 4X4YB 4UNTA 3OX8B 1YJDC 4GXPA 3UG5A 1JMZA 4DAGH 4ZXLA 4WEUD 3RL2B 4K7PX 2D20A 4JFFD 1DQQA 4ZYKB 2A3CA 3SDDB 1OT2A 4K9EH 4WEMB 3RIFK 2C9AA 5EB9A 2PN5A 1FGVH 3PL6C 4WU5B 4F15C 1Y7VA 2EABA 2C3HA 5ITBH 2WZHA 4POZD 5IVZA 4M29A 1OCWL 1JGVH 3FKUS 5ALBH 1CBVL 3JWOL 3M8OH 4R3SB 2DQFA 3AVEA 4NNPL 2ZUQC 2LAAA 1DQQB 1P9MA 5FA3B 4F15B 3OR7B 1W9UA 4Z76A 1A6ZB 1LK2B 2H2PD 4X0KA 2AXGB 2MKLC 3SJVD 2WM0A 4OZFG 2QMJA 5DVMA 3CV5A 3AOFA 1I8MB 1RZ8B 2EO9A 2DL2A 4GKLA 4LASH 2DIEA 2ZUQB 4NQVA 1KBBA 4XPHH 2V9QA 5FM4A 5BZWB 3WLBA 2BDNL 4X6CA 3ULUE 3CZJA 4M82A 4LYQA 3TBSA 4X4XA 3CX5J 1R3HA 3O2DA 4JY4B 5D7JA 3WQ6A 4ETQB 2JLLA 5D7IF 5L2KD 1T3FB 2HKFH 5C07E 1QD0A 1KCUL 3MYJB 1KENH 3HUJE 3WDQA 3I50H 1YNKH 3SUWA 4DO5A 2VXUH 1AGCB 3S98A 2LE9A 4YNYA 7CGTA 4FOMA 1U8QB 5E9DE 3UZEA 1S7XB 3NGBB 5BJTA 3BUBA 1N59A 4RAUA 1F00I 4X5WB 1OP5H 2XZAH 4NNXB 3AMCA 3KPSA 4GZIA 2CIKA 3I84A 4D2NA 3WQ5A 1HOCB 1R3LB 4NQDD 3TN0C 1YQVH 3PBGA 1KJVA 1V02E 3SDXE 2H32B 5JW3H 3QI9C 4J12A 4HJGB 1RZFH 3MSPA 1YNLH 1FH8A 1G9NH 3O0RL 4PJXE 2V7HA 3PQYE 3VKKA 5ADPH 3BEWB 5A43C 4H20L 2IADB 4OKDA 1ECEA 3NFSH 3RX7A 3I9GH 5I1KL 5D8WA 1ND0B 2VRQA 1AFVH 1G0DA 3W11C 5F9JB 4D0CB 1C16A 3BT2H 3WUZA 3OKOA 5SWQA 4Z95H 3NA9L 3KHOA 4CUCA 5EPMB 2YC1A 2DSWA 4HKBA 3QEQB 3VGDA 4JFDD 3W5NA 5D93C 2WMKA 4B3KA 1DLFH 1UT9A 2VL4A 1IGTA 4HIIA 3M07A 2NQCA 4KRPD 3C2SA 1VENA 4PY8J 4R96B 2Y8KA 2DOCA 4OCWH 4LLWB 4XB8A 3D52A 4CD6A 4RAUB 4X5WA 5KSBE 4P46B 1YY8A 3T77B 2P8PB 2XVNA 4G9FD 2EH8L 3G5XA 3WUWG 4GG6E 2FEEL 2W60B 1F45A 2AJSL 5EFIA 1DQMH 1LNUA 2J75A 4PFEA 3WE6B 1NCBL 3UR8A 4KJWC 5D7KE 5D7JD 4OLYH 1CFQB 4LQ1A 4AIXA 4G8IB 5LCVL 3DSFL 4G7VH 3RHWK 5EU6D 4G42A 5IFHH 2V17H 4P2OB 5J57B 3I6KA 4DAGL 4PJHA 2ZX5A 4W4OC 2I60L 2OW6A 4I5BA 2XFXA 4AZHA 3NN8A 4X0VA 4OCYL 1U36A 1PG7L 2L7JA 1H3PH 1XH1A 1C08B 4XCNB 2J7CA 4Y88A 2LFGA 5DTFB 4OF7A 4HS3A 2UY2A 4P2OC 4I48A 3DVGB 1F02I 2NY1C 1SBBA 2E0PA 1AGBA 1Y0LB 5C0BB 1RIUL 4A6YB 5F1IB 2R0KL 3B9AA 3NA4A 1HH9B 1UWTA 5DSCB 4WW2F 1OGAE 1T1WA 2HN7B 4GRWH 3WHXA 3T0WA 1MFDL 5E99L 1BAGA 4MSWB 2CMRL 1IL1B 8FABA 3QDGA 2PO6C 3SURA 1NDMB 1W0WA 2VWEC 3T0EA 1A0QL 3ULVD 4U1LA 5HHVH 2EH7H 3EMCA 3UTZB 5BXFA 4PRIA 1FE8L 1XIWC 4PGBB 5HDBF 3PWJA 4XVSL 3VXSA 3NACL 2R23A 3OLDA 4PREB 5DXWA 3RM8A 5C0BE 4PJEB 3LN5A 4PJDA 3QG6B 4YXHH 1JGUH 5I16B 5GSVA 1KR0A 3CSYA 5A6LA 1FNSL 2G2RA 1IKFL 4UV7H 1YC7A 3H7BB 2G5RA 3WS6C 4HC1H 4P8UA 1GGCH 1V3LA 1AH1A 1TQTA 1KFAL 3V95A 3DX3A 3OV6A 2W62A 1KCKA 3TVMB 2PNDA 2FX9H 4NZCA 3MV7A 2VERN 4OFVA 1I7UB 2LVEA 4R0LC 5DJAB 1WBXA 1FC1A 1RZKL 4GG6B 2X4PA 2BHZA 5I8KH 2X1PA 3E8UH 4Z8FL 1L7TH 2V9TA 1RULL 4WSKA 1QI4A 5T33L 4CD5A 1A9EB 2RR3A 5BS0A 4M6OL 3LEXB 4YFLF 4BSVB 4Y2DA 1J86A 2BVYA 2DQTL 2E9LA 3DI3B 3UTZA 3QUMB 2F5AL 4XP6H 1C7SA 1ZWIB 2V3FA 1GAFH 4UV4H 5FYLE 1BOGB 1D5MA 5DVLA 4FNLL 3AS0A 4B0MM 3KWWB 5AWNL 3BJ91 1P7QB 4LLYA 1DFBL 3G9AB 3THMH 5CJOL 4OCWL 3V5DB 1VCAA 1IT0A 3S3PA 4RBPK 1HH9A 3PQYB 4WUUE 5T5FL 1I3GH 2JEPA 5JUVA 3C5ZC 2VN7A 5JORB 3VWJA 1QLFA 4F66A 2RQ8A 3G6LA 5I9QC 3MOAL 2WWMC 2OK0L 1XV8A 4LLYB 4X80L 2Z92A 5B8CA 3OAUL 4YNYB 1UH3A 3BSZH 2NYYD 5DJ6A 3RWJA 4LDOB 3QDAA 4WY7H 3EYVB 3OZ9H 4OZGE 1X5IA 3T1FB 5JIWA 2X4OB 2C7UB 4P4KD 2WXDM 3MBEB 1L7IL 5BMFL 3N15A 4UQAA 2IANB 2QJDA 2YZ8A 4UQ2B 3AB0B 4HLZG 4W6YB 1FHGA 2RFXA 3EJPA 1GORA 2GW5A 1MUJB 3VDCA 1FVDB 5DK2B 2YN3A 3IS0X 1KNOA 1LL7A 2OZ4L 3F5KA 4EKXA 1HNFA 1J01A 3QDME 3AIWA 4M1GH 3TA3A 3N1MC 2W0KA 3JVGC 3GMNA 3GMLB 4MLSA 1FL6A 4JZOA 3PDOB 3MJ9L 5CILH 4XMPL 2GJRA 4NKMB 5FF6B 3FO2A 1AGFB 5LA1A 2F58H 1HVQA 1NCTA 4WFHE 4CN1A 5E2UH 3CC5A 1U95A 1KLUB 3MRHA 3RCNA 4D9LL 2J3SA 4DQOL 2ENSA 3VA2C 3MTRA 1QA9B 4JHZA 4R8WL 1J1PH 4BH8A 3DROB 1G7PB 1HQ4B 3H3PH 2Y9RT 1CDJA 2ATPA 2CLRB 5CAYB 1L9MA 4DGYL 5E70A 1W1TA 1NCAH 3UYPA 1M53A 4YPGA 2YD4A 3K1DA 2DQDH 3T08A 1WO2A 5IBUG 1X6NA 4X7TA 5DFTA 5EFDA 1N8ZA 3E6HB 3DROA 4LLDA 1HEZB 3PABB 4F7MA 2ALWA 1QSFB 1EXUB 4M8QA 3TBTA 4URIA 5DLML 3AISA 1T21A 3A23A 1UKQA 4PRPD 3ZDZF 4DCQB 4J27A 3WNNA 4CD8A 5JW5B 4GKNA 1TJHH 1MHPL 3CCHA 4MD4A 4N0YL 5F7MC 3PDOA 1XZ0A 1XH0A 2XWTB 5H94B 1QFUH 4JFFE 1W91A 1FSKC 5ITFA 1EBAA 5DTFA 1BJ1J 4PCSA 1UVQA 4IRJC 4TULL 4LLMB 2FSEA 2XYCA 4LSRH 3TT1H 1I4FB 3L6FB 4Y19D 4LCCA 1AJ7L 3BZEA 1B2WL 1BBJA 5E1AA 3W9EB 2AJZA 2ATKB 3ZT6A 2DQTH 4AMCA 1F5WA 3JXAA 4QRQA 2J8GA 1RU9L 4MPKA 2QV2A 1JD9A 1AD9B 1RHHB 3D0LA 4WTXA 4Z7VB 1VFBB 4OF8A 2NT1A 3SDAB 3IU4L 2GFBA 1X6LA 2YD8A 3RWGA 3A6BH 2P46B 1A9BA 4DZBB 3QPQD 3DX8A 5F70A 3H8NA 3EO1B 2NXYC 3QRGL 1YYMH 4AJ0A 2GJPA 3TBVB 1NARA 4X6DB 5ID1B 1N0LA 3P9LB 5E2TL 1IFHL 1A7RL 1GHSA 3WEXB 4Y1AE 4GBXD 2MCG1 1UR2A 1V08A 5DHVB 1O5DT 2DJ4A 3FRUB 4DZBA 1ZLSH 3WIFA 2D7OA 4Z7QE 4PB0L 4NO0B 3K2MC 5DO2C 2WWDA 4Y1AD 3GSXB 4HMEA 4OI9A 1C5CH 1EJOH 1YNTB 4H5SA 1XCTB 3GK8L 4KK5D 4GSDH 3QA3B 3CDGB 4E2OA 2ZWLT 4LVEA 4U5KA 1US2A 2EXOA 3MRDB 4OFPA 1GOFA 1IC5L 4IIQC 4G6KH 4YDIL 1OAYL 5DMIH 1FL3A 4OGAD 3MANA 3V4PH 3MMUA 5I8EB 2CYGA 3ARRA 1VFBA 4LYPA 4Y1AB 3W0WD 4X5LA 3MUIA 4HX1B 1PG7W 4DUVA 1GSMA 4JPWL 3V6OC 4DVBA 5LGHH 1XD0A 1J9CT 3ULSA 2XVKA 4GAYA 2QPUA 4NKIH 2I07A 2F58L 4U1KA 1YEKH 3VXUB 3VXMB 3TVMA 1NUDA 4S3JA 2DICA 1N6VA 4LPUA 1RIVH 4WI4A 5DEGA 5EU3A 5GGQH 4MNGA 3H7LA 4GBXC 4ZDHB 2ZUNA 1KXVC 5KVGH 5CG0A 2Y25A 4APQB 2XVPA 1KIUA 1H3PL 1SJEB 1PDKA 4KZDH 4U7KA 1BHGA 1M7IB 4MB5A 1N64H 3N06B 2LTQC 4OCXH 1QBML 1IEHA 2P8LB 2SEBB 3SY0A 3BRDA 4OLVH 5DJDB 5TFSL 1ZU8A 1R3KB 1IBGL 4FQQA 4HFUL 4JFQB 2AABL 2X2IA 3NCOA 1BVNP 1T1YB 4PJDE 2QEJA 4ETYA 3DO7B 1KQYA 1F3JA 2NZ9D 1KTLB 3K8LA 1HQRB 1MFDH 5E99H 1QSFE 4ZNCD 4N0YH 2D7TL 4IRJD 4CNIB 5EZJB 1BMGA 1TQBC 4C56E 1QSFD 1C5DA 3I75A 4R4NC 3RGVD 2H3NA 5GGVH 1UD5A 5KSAD 3TO4A 4Q7DA 1JZ7A 3O2VL 4ATLA 3UTTA 4MDOA 3CSPA 2MOVA 4AT6B 2FX8H 5KVDH 2BX5A 5EUOA 1QNOA 5CEZD 3DX2A 5CJ8A 2X09A 2XM1A 3VXSD 2EEBA 4QHUA 2H3NB 2Z8RA 3BGAA 1LO5A 5IWLA 2VDLL 4RGNC 4UMGA 2FX9L 3U7YH 1K6QL 2EYRB 3VD5A 3VWKB 5HI3D 1P9MC 4EBQL 4XXDA 3CDFA 4BKLA 1T1XA 5EO1A 5IG7A 3CFJA 3RU8L 1EFXB 4I1NB 3AJ7A 2X4UB 4RGNB 2P24B 4P2RB 1P5VA 4KMLB 5EULV 4M48H 4M56A 3AZSA 4UTBH 5D7SH 3ALXA 1GPOH 4PJ8A 4PMXA 5D2NA 4PB0H 3OR7A 4XAWH 5FL1A 4F7EA 2M26A 4L4TA 4ZOBA 2OYKA 5DD3L 1NKOA 3RZWA 4RGOH 2DQIH 2NW0A 1GOHA 2FGWH 5D7IA 4U6YB 3CUHA 1QX1A 4PGCA 3EIFA 2CUIA 4OZGB 3WF1A 4QTIH 5I71C 3PZOA 1LWRA 4GRLA 4BH7A 5C70A 3KXFE 1PS3A 3WH7A 3AZRA 2ZUVA 2YUZA 3AIVA 2H2SC 1FO0B 4PJGB 2EBNA 1DL7L 5T5NG 3ZE2E 2X2JA 5D9PA 1P4IL 3D2UD 5BMFH 5IBTL 5EOCJ 1A02N 2CHOA 1WICA 2QPSA 1KBGL 3EOAA 4HUWB 4KKBD 2ZOKB 1NBZB 2DM2A 3L3HA 3FB5A 1CDBA 2WP3O 4BQ4A 3I2CH 5FKPA 5KOMC 3OF6A 2F54D 1TQCC 1XGTA 2QHRL 4MQ7A 1E4WH 4IDJL 5FXCH 3PQYD 1PLGH 4MA1C 5HGAB 1KJVB 1OSEA 1T20B 1E3XA 4HLJA 5GXBB 1AIFB 5CGYC 4W4NA 2NY4D 3W39B 3CX5K 3EOAB 3ZE1F 2XNAA 5FGSA 4POYA 3WY4A 1ORQA 3KLKA 3DMMC 1WTLA 3BN9C 4F80A 3GO1H 4HU8A 2HFGH 1YN7B 3IF1B 1YEDB 2NW3B 5BW7C 2X5PA 3PHAA 2ZOXA 2VDML 4WWKD 4Y2DB 2C26A 3ORJA 3P9WB 1U3HC 1A3HA 5I6XB 2FEDD 3OKKB 4XP9H 1A6AB 5ICYB 2WBJC 3PIQA 5E03A 4FFVC 3AY4C 4P7LA 4OCSH 1S9WB 2JJUA 4GI9A 2PTUA 4NQUA 2FD6L 2GJ6B 2KZ1B 5J9PB 1NFDF 4OV5A 2WLYA 5JPMB 2G3IA 5L6YH 1ZHLB 3HZKB 5FA4B 2IBZY 1MVYA 3N85H 4X0KB 2OCFD 4XMLH 1JV5A 5GS3A 1ZANH 2I07B 3HCVA 1N26A 1UWXH 1F6AA 4K9EC 5E95B 1HP4A 3ARDB 4Z7NF 3TH2T 1AO7D 3BPOC 1N0XH 2A77H 2O93L 5FKYA 1PFCA 4HH9B 4V1DE 2DQDL 1D9KC 4EN3D 3BVUA 2W66A 2VQ1A 3T2NL 4JQXC 3PWUA 3ZM8A 3N18A 3MBEA 4MAZA 2YRZA 4M24A 5GRYA 4UU9A 3AIEA 2R69L 4LSRL 5AUMA 2OI9B 3IFOA 1DWJM 1CXLA 1VAHA 2BXYA 3F12B 3FO9A 5HGGS 1H3VA 1PBGA 1YEHL 2HMIC 1ADQA 1CF8H 1SYTA 4WGWB 5D96B 1FP9A 3MMEB 4MZ3A 1MCSA 3IU4H 2Q7YB 5KG9B 3ES6A 3ARED 5A8MA 3HAEG 4L1HA 4BF7A 1ADQH 1BJ8A 1YEEL 3DWTA 4G8IA 4QRUA 4WKFA 1CWYA 5TJWK 5F1IA 5DRWA 3MXVH 1QBLL 1B2WH 3WF3A 2EKJA 1QRNB 1KIRA 3TZVB 1H5BC 5FOOA 3QI9D 4WIWA 5HI5C 4JDVA 1VGKA 4ODTH 4BFGA 2BNQB 2X40A 1F3JB 5F7WC 4HGWA 3EYFB 4N8VB 5ACMA 4WV1B 5IK3A 1NJ9A 3T3ME 4YX2H 3KL0A 2CIIA 4GOSA 1DBAH 4CJ1A 3NZHH 3SGKA 4LRNL 1QHOA 1LO4L 1HH6A 3CFEB 5JW4R 2I25N 4P2OD 3U2SB 3AUVA 5GRVK 1HKJA 2VLLB 1MIEL 1A6AA 4UTFA 4AIZB 3EFDL 1HNGA 1OGBA 2DSZA 4XT1C 2QQQA 4PD4J 4WCYH 1G9NC 3FFCE 4OUUA 5IQ9A 3VGFA 2GQHA 1CLCA 4UQBA 4ZE5A 4LRIC 5TF0A 4Z2IA 5EO0B 1V05A 5DC0A 5HHQA 1YMMD 3ZHKA 4X98B 5HVWA 1E4KA 2DSKA 4ACZA 1ISYA 5ENWA 3PF2A 1GW1A 2FGZA 4JM2F 4OZIB 4K3EH 3PZVA 1MJ8H 3LKQB 3VE0B 4OFDA 5DRWB 5I77A 4AZIA 3ARGD 4M1RA 1NEZG 3L4ZA 5JIIA 5I1HH 1P5UA 1F4YH 4JFDB 3QNYB 3QEQD 5HGDB 5EPMA 3GRWA 4X8JB 2JCCA 3O41B 4Y4FB 1U8PA 2X1IA 3GH7A 2NX5A 1WCBA 3VRIB 3KPSB 1QI2A 3V79C 1OY3B 2WW8A 2JIXA 4U1SB 1XH3A 3P4LA 3DGGB 4LMQE 3OHXB 5IHLB 4O02L 1W72A 5C9JB 1RSFA 3OJ2C 3ZQ9A 5BVJB 4XP9L 1H4PA 3MA9L 1GVYA 2H1PH 2QQNH 1TMCB 4Y5YC 3L4UA 3U0PB 3IXTB 2E5EA 1OP9A 3L4YA 5IVXF 4CCDA 1S7SA 3BQUA 3PHQA 5I1GH 1TIUA 5BXTA 3VH8B 4IIQA 4NZRH 4Z7UE 1UZ6F 1T22B 3FCTB 4JR9L 1MCRA 1VADB 4H7VA 1E4LA 4KI5E 3O3DB 4MNHB 5J56B 2NXYD 5CJQL 3L3OB 2AJSH 5GGSB 3WFZA 3S4SB 5BWFA 5A3ID 3WDIA 1LDPL 1OAZH 4O5LL 5D2LE 3PNWA 3LY6A 4PD4K 1H8SA 2KQNA 3EOTL 2BNJA 1VEMA 4PN2A 2NY6B 4QDMA 1N0XL 1NC2D 2A77L 2CRIA 3GNOA 3X17A 2GTZA 3DDFA 1RUML 5IFPA 2WINA 3BC9A 3W29A 4JKLA 3WFDL 1KULA 4NRXB 1XR9A 3FQTA 3FQXB 4YEFA 3GSQA 3J8F7 5DO8A 2I9LB 3SEPA 4YHNB 2AV7A 2WIIB 2HVKB 3O4OC 2FECL 5IR1B 2Q7NA 1LE9A 3DPBA 4YFEA 2FX8L 5KVDL 1JPST 3QIWC 4QCFA 3FQTB 3ETBF 2XM2A 3U6RB 2VC2H 1QI3A 4Y4KD 4PJ7A 3C5ZA 4YE4H 1HHJB 1QNRA 1W9BM 4HK3N 5CJXC 4PYGA 1EHLL 3ZKXB 2VWEE 1UASA 1MLCB 1AHWB 4KUZH 1UKTA 5LQBL 4ZFFA 2E8ZA 3O9WC 5HYQA 4L8SA 3PIQB 3MV9A 3H0TB 4QLRA 1AHWC 1S5HA 5D7SL 2IQ9H 4OF3A 5D1QC 4YXLH 4B50A 3LD8C 2A9NH 5A6BA 4H8UA 3D3AA 4TVDA 3QEUB 2EZ0C 1GOIA 5DQ9B 2J88H 1K6QH 3L7FA 3CUFA 1YEDA 4NZJA 1XCWA 4JAMB 4RISH 5DRXA 4OLUL 1FJ1B 1AGEB 2XA8H 3HPLA 3AMDA 5FM5O 3MJGX 3NSMA 1ONQA 3IETB 4CVZA 3SKNA 4RDQF 3VFSB 4RE3A 3F7PC 1US3A 1M05A 3W5MA 5ICXA 1IGJB 4Q6IB 3ULVE 1ISZA 4XAWL 2ILLA 4RGMC 2XYLA 2JK5B 3RNQB 3UEZA 2E7HA 4NC1E 1VACB 5IHZB 1LHZA 2GEEA 2V2WB 5HD8D 4QOKE 2ESVE 1G7LA 1U92A 4R4FL 4BSWB 4A2LA 1T04B 1QBAA 1RHFA 4LPTA 3VUPA 3BIKB 1JGEA 1PQZA 2WZPD 3U7VA 2VI0A 1I8IA 1XGRB 1ZHBA 1KJ2B 3OKYA 1BQCA 4UFIA 1UA6L 4P2QA 2JFEX 3AM8C 4JQIL 1ZVSB 3RWIA 4PTVA 4LEOB 4NWUH 5D4QA 5CEZH 1U2YA 3EBVA 3QULA 1NUNB 4TUFA 5C71A 3KLHC 3TBTB 1RJZA 3V0VB 4X6DE 1EEYA 3CNKA 3L7EA 3SO3B 1A4JB 3BKMH 2DLHA 5MERA 3DXAA 1BYCA 5KVFL 4NUJA 4D6CA 4JFXB 4QHUB 3BXNA 1UXWB 2GUOA 4H26A 5B39A 5I1CL 5J0BA 2YWZA 1E28A 1G9NL 3E2HC 1IAOB 1IKNC 1IC4H 4WKAA 5C0AB 1S7RA 2OK0H 4AIOA 4H20H 4P23A 4Z78A 1JG9A 3MRCA 5FO7A 3VIPA 3PG2A 4R5EA 1U95B 4XTRD 4R90H 3II1A 2G8ZA 4N68A 1AP2B 4HT1L 2UWEF 4QGTA 2G9HB 2VX4A 3GFUA 1ZANL 1PBYA 5C7XL 2O9OA 4PLNC 4ODXA 4V1DD 1O7SA 3LAFA 3WL9B 2X9WA 1CCZA 3R1GL 3CVIL 4JKPH 3T0BA 2R9HC 2WUCL 1GCYA 4PJXA 2OL3B 4W6XB 2OSWA 1C8XA 3P0VH 2MNUA 2QADD 2XWJA 3PGDB 1BLNA 3D51A 2DJUA 2C1PB 1K8DB 2D3LA 1ZT1B 1MLBA 3BRFA 3LRLA 4QHNA 1XR8A 5KS9E 1UYQA 4M5YH 3JTSB 3SGEH 1JD7A 2PBOA 3ECQA 5ID0B 1BYAA 4LX4A 1B9ZA 2B8OT 5EFIB 2A6DB 4OLYL 3RWHA 3VG9B 5DURD 3RWDB 1OPGL 2VUYA 1BEYL 2X9YA 1G1YA 3FOLB 1W8NA 1A6PA 1CG9B 2FHCA 5DGRA 4OI8A 5IHUL 3ARBC 5DJ8A 1E6QM 4TUKH 4FXGA 4PB9H 1RAMA 3GIVB 3C2AH 4L3EE 3CLFL 5E9AA 5DHYA 3WF2A 1H5VA 1YEHH 4MCYB 1R86A 3ARBB 4KGJA 5J6GA 4FNSA 4M81A 1RIUH 5I73B 1S7TB 1C7TA 1QFWL 3WS6A 3M6DA 2BJML 2E27H 1S9YB 5T1KB 4KTYA 4PUDA 4KKLD 3SCMD 5A8NA 1UM6H 3D5HA 1IGYA 1PYWB 1DDHB 1A6TB 5C0DA 3VMPA 3QXUA 5B3NA 3BHBB 1CU4L 3F62A 1EIBA 3WLWD 4OOZA 4GQ9H 5T5FH 4OM0L 4NKDA 3VFWB 1K2DB 1UEMA 3UJIL 3NFPA 4RAHA 1MXDA 4AEEA 3WBDA 1J8HD 3W9EA 5CFHA 2YJQA 1C12A 4ZFFB 4OOUA 2PO6A 3DHPA 3LHPH 1W9VA 1AJ7H 5B22A 2RCSL 2IWGA 5JOFB 3QFJD 5CZKA 3RBGA 4Q9RL 3ZJKA 1WFUA 4NQSA 2EIDA 1SY6L 4UZUA 3WN5A 4QHLB 4JFDE 5GRXG 3S35X 4KJYB 2NY6D 1JGUL 3DRTA 1FFRA 3MRDA 4HKZB 3K4ZA 4WCYL 3TH4T 3MRPB 3CSYB 4NQXB 2YKKA 2JEQA 3B3IA 1CICD 1T89C 3MI6A 3D39D 1YYML 1GRWA 4MNLA 1P84J 4HX1A 5I74C 4KPHL 3IETA 5GHWH 4D3CH 3CZLA 1CE1H 2GITA 3EJYD 1LLOA 2OR9L 3RAJL 3U1SL 2GAZA 1NCWH 4XVUC 5BXFB 2H9GA 1CECA 3ZOAA 4HUXA 2ID5A 1BZ9B 2AOSA 3PTMA 5I1HL 1HKIA 3FY1A 3SJVB 4KRTA 2EEXA 5JNYA 1C5CL 1EJOL 1NBQA 3KPQA 3DGCR 4JVWA 3CFDB 4ELME 3DX8B 3W11D 4WFEE 5T3ZE 5CSGA 1KYOK 3OKMB 3VGBA 1T1ZA 3DRQB 2VDPL 3RRQA 3ARTA 5CP7A 3ULUD 4HSQA 1S78C 3A67H 4O2FA 2X4NA 2W65A 4YDKL 4MD0A 1KG0A 2R0WL 5EUOE 5F3HA 4OZHA 1W0YT 5MEQA 4QXWA 3TEUA 2A3EA 1YEJL 4ELMA 1DEEA 4LEXH 4F9JA 4QRSB 4MNJA 3VFRB 1K9FA 2FATH 4RAVA 3QUYD 1SYSA 5TQ0L 2B1HL 3WFEH 4HDIB 5FO9B 4RQQA 3UTSA 3ZTNL 2Y24A 4ZXBC 1WAAA 4CMHB 3BQUD 1E40A 1JP5A 1SJHA 3V0VA 1UB6A 4M7ZB 2X4OA 5KVGL 1FDLH 1EH9A 1MNUH 3NIGF 4NZDA 5SV4A 2AQ3A 4LKCB 1JXJA 5C8JB 1GPFA 4M7LL 1F97A 1XGPA 1WZAA 2V2TA 2DKUA 5CEZE 4WKHA 5DS8B 1JGEB 4BQ9A 1MY5A 1JZ5A 1JZ2A 3A6CH 4V1DB 4ZUVB 1OM3L 3TYGL 3W2DH 1E4NA 1OD8A 4FQQB 3PHOA 4LSTH 4LSUL 3MODL 4FQLH 5I66B 5TD4A 1O0VA 3TA3B 4OLWH 3SCOA 3D39A 5C08A 1IEBA 5ALCH 1ESWA 1R5IA 2R4SH 3LKPB 5DMGD 2FH6A 3TLRA 1UOKA 3PTQA 4Y16A 4XXCC 2H2PC 2MCPH 4PRDA 1XIWB 4BFBD 2ADIA 4PJBB 3AAZA 5HGBA 4D9LH 4A4AA 5EOTA 4JPVH 1OB1A 4D9RE 5F1SA 3V6FA 1GUVA 3QYCA 1FFPB 1H0DA 3KPPB 1LEKB 1XH3B 1YQ2A 1SJVA 8FABB 1CD8A 5CINL 3M46A 5SV3A 35C8L 3QHTC 5FOBA 4H0GA 2WNGA 2WMHA 1XIWA 1CLZL 4PJXF 3VGEA 3G6DL 1JXKA 3VDHA 4QHMB 4ZPTB 2J79A 4OAWA 3MREB 3BOVA 1JL8A 4FMFA 4NHUB 5AD0B 2WV3A 1CGUA 2V3EA 1MWAH 2BRRL 3DOSA 3BD4A 1LVEA 1HOCA 1R3LA 4R0LB 1HE7A 1U8OB 1NGXA 3L3KA 4JZJC 1E6NA 4Q9BA 4NT6A 1SM3H 2YL6A 2J47A 3KXFA 3PP3K 3QJHA 4HWBL 1DVFD 2IJ0C 3KVQA 2XUCA 5CPSA 5KTEH 3FT2B 3D85A 4HF5L 3KS0J 2XN9E 4J23A 4LHJB 2C0HA 4AW7A 2F54E 1RZFL 1ZJBA 4XBGA 3KJ4C 1OAKH 5E8DH 3UTSD 3AMLA 4Q74A 3HC0B 2FYYA 3QDJB 1ISWA 3B9KB 1GOQA 3ARFD 3D87B 3N17A 4TN9A 1OBAA 5K59E 4AZ5A 4YXKH 3QIWA 4WWKB 5LXGL 1WDPA 5GJSH 4AH2B 1Q9WA 3GMPA 1RU9H 3A6OA 1IQDA 1TPXC 2XOTA 5K9JL 1ZLVH 3AU1B 2BOCA 1D9KA 1JUFA 2FZ3A 4Z77A 3VXTA 2EDWA 4N0CC 5JPNB 2R39A 4NHCL 5LA2A 3QEGL 2HTKD 3SPVB 2Z31D 5DA4A 1IGFH 4YDKH 1X5HA 2FHFA 5DD0H 4GG8A 2DQEH 4WO4A 2RBLA 3DBXB 2YEZB 4HIHA 3ULVH 5CXPA 1YC8A 1KTKE 3C6LC 3WH9A 2Y07H 1ORSB 1NBYA 3D25A 4EZMA 2AP2A 5IV2A 3VGHA 2J7DA 3GUTA 4R90L 1UR1A 3G6JA 1RK1B 1IGYB 1PYWA 4H1LG 2AJYL 4A3YA 3RTQC 2I26N 1BPVA 5EZIH 3CUJA 4V2XA 1ORQB 1FAIL 2RGSA 3MQIA 3DVNA 3QI9B 5BS0E 1AD9A 2P5WB 5T1DL 3SBWA 4XC3L 5K9KB 2VSDA 4LLQB 2W0PA 3O6FA 2VDKH 4OT1L 5GRVL 3MLRH 2X8RA 4HUKB 4NIKB 1DWFM 3HRZB 5B4MD 3UZQA 4EI5A 5C0CD 5C6PB 2YFNA 4UQEA 1O7VA 3C60C 5E8OB 1K4CB 3DIFB 1P4LA 5TDPB 3FJTA 4CJ0A 6TAAA 4JCLA 1GZPA 4R97C 5DJYA 4OSUL 3RNKB 3VD9A 3AXIA 4U1IA 1GGUA 3NIDF 3JTTA 3AREC 4PBVC 5E6ID 2Q86B 3NCJH 1EDQA 3QDGB 1W1YA 1ZVHA 3MX0A 3HB3C 1I1AC 2D2OA 2XFXB 3LQZA 2DQGH 3VWKD 1NEZB 2WHKA 1NGYA 3ARXA 1MW1A 4QLJA 1R47A 4QOKA 2QKIA 3S34L 1B0IA 3CC5B 4X4XB 4MA3A 1AXSB 4MAYD 4APQA 5ISZB 5HYJA 4J28A 2VVSA 3CLFH 3L1OH 2PW2A 2YUVA 1JNDA 3P9MB 4ODVL 1I7TA 4Y5VB 1N64L 3MFGB 2F18A 4GRLC 3JUYA 2BOCB 5F1NB 3ARGC 1RK0A 3TC9A 3LMYA 1INEH 4JDVB 2ESVD 4U31A 3HPJB 4UQ9A 5B21A 1OOAA 3LSOB 3SGKC 4U1GC 3TIDB 3SUVA 3MV9B 2IGTA 1J1OL 1NGQL 3OSKA 3V4UH 5HYJB 4KHXL 4NQEE 3GJFA 4WO4B 5IVZB 4IRSC 1PY4A 1LE5B 3VXME 1JF1B 1PZ5B 4FABH 5KG9A 2XJ7A 2E9WA 1HILB 3QUZA 3SDCA 1T66D 4I0CC 5I8KL 1JFXA 4FTVA 1JNNH 4JFVA 2Q86A 4LPXA 1ZLWK 4LGPB 1OB0A 4F3FB 4PRBB 2IFGA 2Q8BH 1CL7H 2NY7L 1GOKA 3FTGB 1LO0H 4PJ7B 1FYTA 1YPZA 4KPHH 1AKJA 1CFTB 4GXUM 2XXCB 4NO3B 3HRPA 2BY3A 5GJTL 3L5IA 3KPRB 3QIBD 2W0LA 5CBEA 3AHYA 4HIEA 1ULVA 1F6FB 2B31A 1FG2A 2F53B 2DDXA 1UR9A 5IB3A 5FB8A 3RL1B 4KKLC 2XI9A 3AXLB 1LD9A 3QEGH 5MENE 3CH8A 1I1XA 4O2CA 5DUBA 1WWBX 1G7MA 4PTUA 3VXMD 3AY4A 5EC1B 4PP1D 4PYHA 3RVTD 1TQSA 5L2KE 3HZMB 4BKLB 1JYVA 5I1IL 2NY2C 2OR9H 4DKAA 4P8XA 3C6SB 3WYRA 3ULUL 1GGTA 4RIRA 1U42A 2HMID 1FNEB 1A2YA 4W8AA 4D6HA 1NH6A 4HWZB 3O45B 5EWIH 3B9KA 3BPNC 4PJ7E 4FLOA 1ZS8B 3ROOA 4AC1X 1YEJH 3EJRA 1CXHA 1FAIH 3S35L 1IAOA 4JFSA 2DJSA 4BQ3A 4M7KL 4LVOB 4X7DC 3WJLA 2D73A 5EIVA 4DJMA 2YD6A 4J2XA 4GXVH 3QISA 2BFGA 1EDGA 4ODHL 2Q76B 1UH4A 5ESVB 3ROLB 3OHXA 1UWSA 2FR4B 5LBSH 3OKNB 1E27B 4O58L 3SDXA 5GRJL 5I76B 2F7RA 2GK2A 2Y5TB 4YPJA 4MJ6B 1MNUL 5HYJE 4PMQA 1M01A 3AXLA 4P4RA 2VLRB 4DWHA 3BP7A 3LKNB 2H1PL 2QQNL 4AENA 3S97C 1ZKAA 2F19H 4N1HB 3EJZC 4DN3L 4GBXB 4HKJB 4S0SD 4YGAB 1NFIA 1RJYB 4YDVA 1OM3H 1BD2A 2EIZB 3TTSA 3R0MA 2C3WA 4WHYG 1QLRA 2FLRT 2Y06H 3IDJB 3I02B 3KEHA 1P84K 2R0KH 4CD4A 2EYSB 2UY7A 2ED9A 2FEDC 2R4SL 5ANMA 3GUTB 2YPLE 2PBGA 1C8PA 4UILL 3UTPE 3MCKB 2BOBB 4N9OB 1QG3A 3VVGA 1RZ7H 2L4OA 5KSAB 2I9TA 3VFGL 3U7AA 4BSJA 1KGWA 4YBLC 1CVSC 3A6CL 3W2DL 1RUMH 1JGLH 4HIHB 4PJAF 4QF1A 1KWGA 2B1AL 3QPXL 4L29A 4RA0C 4XCEB 3QSKB 2D1ZA 4CU7A 4KTEL 4HWNA 5T3XL 3RJXA 1AD0A 4YIQB 4G9FE 4KK6D 3U9UA 3L9RA 5AZEL 1OIFA 5IVOA 2VE6A 1OWQA 4L3AA 4LPYA 5EC1A 1LO3H 1MFBH 4ZO8A 4IM8A 1AGDA 2V5MA 4MD0B 4AYFA 5I8CA 3LX9A 3WHXB 5GZOD 1GC1L 3VGAB 1CGSL 2XIBA 3S6TA 4Y19A 3X13A 4QXTB 4TNVK 2NY3C 3RZCB 3MUAA 3FNDA 3DUSA 1LL6A 4YHYC 1WISA 8A3HA 2VQTA 1VGEH 3B6SB 4M9OA 4PUBH 5IQ7H 1CL7L 2NY7H 4WFGE 4B15A 3U36A 5JHDD 3H53A 4QY8A 5HHPB 4I48B 1QUNA 4D0DB 3RZCC 3CMJA 2IMMA 1F2XK 1FVCB 5D9SB 3T4YA 1H8NA 1M7DB 3BDYL 2W9EH 4KAQH 4NKQB 4YR6B 3HR5A 3RNKA 4S1RH 4HUVB 5JO5A 1DVFB 5IWLC 1A22B 4X4ZA 4U2ZA 1I1FA 3EHBC 4UU9B 3CCHB 4MD4B 3S5YA 5IVXA 4FTVE 4NCC2 3FQWB 4RMQA 3GHBH 4ERSH 3VO0A 1RJZB 5EZOL 1EQPA 4LBEB 1OTTC 1HKFA 3I3EA 4TTDD 4W87A 2OX5A 5HHOE 4W84A 4K2UL 3MRKA 2E7CA 4XC1H 2IPTL 3CMGA 3BGFC 3ULUH 1OSZB 1FZKA 2ADFH 3BZFB 4O2EA 4P2RD 3MLXH 4R26H 3MJ7B 1S9YA 5T1KA 4GAJH 4P9HH 4XBPA 3DUUB 1I3GL 2AJ3B 3ARYA 1H3TA 2WVVB 1JFQH 2JTDA 3VIKA 1A7PH 4ODSH 4OGAC 2IAMC 3EKCA 5E08L 2EPOA 4HV8A 3KAAA 2B4CL 3VD7A 1FSKB 5EOCH 5JBEA 4Y4KC 3V7AG 1M71B 4N5ED 2QTEA 3P11L 5DD0L 5H2BB 4KK5C 4U7SA 5GRJH 4DGVL 2RGLA 1I1FB 3TP4A 1CLYH 4XNZC 1OAUH 5J3HC 1MCCA 5IBUB 2BVOA 2OYPA 3SCNA 4LU5H 4PIRF 2C4FT 2E3VA 2ITDA 1A6UH 4R3SA 3VRJA 1OGAD 2Z31A 4GAGH 3ULSB 5I1CH 5I8OH 4G5ZL 3D69B 3HI5H 4XH2B 4P5TD 3T65A 1ZT1A 2VLKD 2W9DL 5HBBA 3PDDA 3ZE0F 4DW2H 4OZIA 1H15A 2HFFB 1CEOA 1EUTA 2FIRT 3PWPD 5CILL 4EI6B 2C7UA 1KXHA 1KFWA 1SYSB 4WK9A 2EDJA 4LVHC 4RSVA 5GISH 3LZFL 2H8PA 3D18A 3C8KB 4EAMA 3CUPA 1D2KA 2YXMA 3MOQA 4YR6A 3V8OA 1TQVA 2XIIA 3U5YA 1A1OA 1SMOA 4WNQA 1QBMH 1S7VA 3T0DA 3W0KA 3G6JE 4JREC 2B2XH 5C7XH 4GIAA 3FO1B 2GT9B 3FO0L 2O5YL 3MZTA 3Q5TA 5AZEH 2WHMA 1QLFB 2XQBH 1A2YB 5DHYB 3JUZA 1NC4D 4WW2B 3P0VL 1LO3L 4AG4H 4YHNA 3SE3A 1E56A 3EOYG 1G7JA 2VCCA 1B1YA 3RJQB 2VZ1A 5HDLA 1AQHA 5H37H 4UUJB 5DQDL 1T03L 4C58B 4MTVA 3BPOB 3IDNA 4LNRB 1HQRA 1VHPA 4P2RA 4PGDA 1ACZA 2D03L 1NLDH 3MO4A 2X1QA 4OIIH 1HVXA 1K9DA 1VGEL 2VDNL 4PUBL 1NBVL 3SGEI 4FFYL 4K8RH 2EIBA 4XB7A 4IRZL 1IZKA 2J8HA 3EYSH 2ADIB 1NCAL 5DJDA 4LCYB 4YHLL 1FL5B 3WHE1 3S37H 3VXUE 2VURA 2NX5B 1CT8B 1AR1D 2HFEB 3OZPA 3O45A 1S3KH 4CW1A 5IW6A 3VFMA 5JXAL 6A3HA 4S1RL 4ZFGL 1UG6A 3QNZB 2F61A 3TT1L 5C0FA 7A3HA 5C0RL 2DLFL 4OGYH 2BK8A 2XKNA 5EUOB 5EU5A 4BUHA 3ZYZA 2B5IB 2A74A 5DI8A 2PYEA 1DLHB 1MCWM 2V2TB 4LLUB 1NFDB 1C5DB 3REWA 3GXTA 4R96A 4HA3A 1H5BB 1UC6A 4LSDA 4NN6C 1LG1A 4RZCA 2VLKA 4PG9A 3X3GH 1GPOL 3WMSA 5HI5D 5SWSD 4OM1L 1NSNL 3SKNB 4B41A 4PJEA 3WJJA 4OQTL 1F8TH 5MENB 5GJTH 3WUWA 2UY4A 3RGHA 4GKSB 4Q97A 3W6MA 1ZSDB 3DSNA 4Y16C 2VXVL 3UJJH 1A8JH 3DV4A 4K71B 2IALB 3BPCA 2VX6A 3V6ZB 1YNKL 2CO7B 3LHPL 4FG6D 4GRWB 3IDYC 4XPFL 1C90A 2ZCKL 4XCFH 1V6WA 2EDEA 5AZ2H 2HH0H 25C8L 3DX0A 1IC1A 4LSQL 3MLUH 4K71C 2XGIA 5DFAA 4MLIA 2J7FA 4F2MB 1UWEH 1T1ZB 2ZXAA 1Q9OA 5FCZA 1WDQA 1KEMH 2HJFA 3SKUD 4EDWH 1WNOA 1UGNA 1ZLSL 4MGXA 1P7QD 4U0QB 2ZUSA 4JZOB 2R1XA 1OW0A 4OLZL 3BW9B 4PJ5B 2WMGA 3WH6A 3TBYB 3BVTA 4S3KA 4P3WA 5FYJU 4F37F 3GZKA 3S35H 3JWDL 3LKRB 2V2WA 4M6AA 1I8LC 2OP4L 4FTVB 4HZLA 4Q0XH 1B0WA 5BXPA 2BC4A 3DNKA 4C7FA 2IPUG 5K93A 1XGUA 4W7WA 4L9LC 4Y5YB 1KQZA 5LBSL 4UFMA 2OR7A 1AKJB 3AMKA 2P7TB 1WBYA 3KYMB 4MMXC 4LEOA 3UBXI 2FGLA 1KCVH 4NM4L 3HC4L 4JPWH 2B4CC 4QT5A 3FO0H 3U48A 3SN6N 1REIA 4KKAD 4MJID 4FFVD 5L88H 3FT2A 4W70A 2EDNA 4YLQT 1DSFH 4ODXB 4JDTH 1ZBCA 1HKMA 4G80B 5IOPB 5MI0C 3MROA 2CBVA 2FO1A 3EHBD 1JHLH 4CRPA 3GSXA 1YEIL 5JW5A 2JCCF 4EQ3A 3LDBB 5B8CC 2GK1A 2CKNA 4NGHH 3WD4A 1PEWA 4OIBA 4I0PD 2W9LA 5D8JH 3ZL4L 5CIPA 5CGYD 1TA3A 4ZG1A 1R8LA 1C08A 4HT1H 4FQHA 3HA0A 1MRDH 3Q1SH 5ELIA 1S3KL 2NY3D 4Q9QH 4P8WA 1ZA6A 3NIFE 5EBMB 4XHQA 4CMMB 2GYSA 3HFML 3IFPB 5SX5H 4NNYB 2NMSA 4QRRB 3MRIA 1EO8H 1NCNA 3GMMA 1A1MA 4XCCL 3HMXL 2XZZA 4J3SA 2BXZA 3TA9A 3GXNA 1NAMA 3WN5C 1BZQK 2ICWB 1X5LA 1KCRL 4FQXA 2ARJQ 4HC1A 5FYJH 2EC8A 2WCGA 3C9NA 2F1AA 5GNYA 1E27A 5I76A 2H2SD 4AQOA 2WAGA 5M03A 2MMXA 2CRMA 3ZO9A 1U3HB 2JF1A 4BELD 4EEEA 3L3DA 1V3HA 5HHQB 4JRXA 5DJ0A 3GBNH 3GHBL 1HHJA 2HAZA 2BSTB 3LD8B 5HI4D 4PV9B 4JAWA 1YMME 2HKHL 1KPVB 1H3XA 4HOZA 4J3TA 1T3FA 4LLAA 2AAVA 4H1LH 4RFEB 4NF7A 3KPMA 4NKDB 3VFWA 3I9GL 5CIPH 2RGMA 3IAQA 4LCWB 1CT8A 1AFVL 2HFEA 5HPOA 3HI1A 2X05A 2YFOA 4XCFL 4WUUB 1FH7A 5JHDA 1LO4H 1MHCB 3QUYB 4JFEB 1KTLA 4KUCD 2OL3A 3QFDA 4JM4L 1CK0H 4N8VA 4X9GA 1H49A 3AMGA 3PGDA 4X6BB 3H9HB 3WD0A 2BRRH 3GNPA 4PGDB 1U8LB 3EOBA 4PBGA 2WQRA 5D7JC 2VQUA 3WEMA 3OAYK 3S5ZA 2OR8A 3WNPA 4HWBH 1X4YA 2JALA 4D9RD 1E0XA 4NBXB 4HF5H 1JI2A 3EO0A 2OZ4A 3DBXA 1P4BL 1CFNB 5TE6L 4ODUA 3EUUA 5I17B 4UT9L 3WF0A 3MO1B 4W7VA 1JPTH 5F7EL 3F5JA 3FO2B 5GQBA 4ACZB 1OHQA 3N12A 3T04D 4XVTH 3EFFA 4QXUL 1ROWA 4Y5XA 1E15A 2F8OA 1AGCA 4OTXL 5A6KA 3V6BR 1NM9A 1G9MC 1TZ7A 4G5ZH 5LXGH 4NBZB 4JO1L 1V8HA 1ZBWA 4M8UA 1C93A 5FCSH 1UD6A 1MUJA 2XT1B 2DQCL 4NT6B 1URLA 1U8PB 4LCWA 3ULVC 5SWSB 4Z0BH 5KVEL 2J78A 3IAPA 3TH3T 2ZCLH 3SIMA 3FZUD 2ADJA 2EXYC 3TYGH 4MAUL 5IKCB 2NTSP 1YZZA 5I8OL 1JDAA 3TJHC 3T77A 3W9DA 5E5MB 3BD3A 3SCPA 1V3MA 4QRPA 3L2LA 4P23C 5CJQH 3PNWB 4IJ3C 1UWRA 1B3YA 2WNWA 2WB5A 4UNVA 1CFNA 1T7YA 2FO4B 1N5AA 3AROA 3N1AA 3DX1A 3O6LH 3GBDA 4JQVC 4HKBB 4IJ3B 1L0YA 3LB6D 3MRCB 4XP1H 4FXLA 2D03H 2YPLA 2R2EB 4MNQA 1MEXH 3BZ4B 3GB7B 5DHVH 1XCQA 3WFHA 5A1AA 1H0GA 1CLXA 2DWEA 4Y4KA 2OLDA 2X2YA 2OZ4H 5JIPA 1YEGH 5JW4Q 4AG4L 1U30A 5D93B 4R2GD 4HJ0D 2DM3A 2ERJC 4AEIH 1R33A 1AKJD 5DS8A 3GSVB 4JM2A 4KK8C 4QYOB 4XPAL 5IV2B 2YIHA 4ZOCA 1IILE 3CTTA 2RB8A 1T20A 5FGRA 5BQ7A 3OKKA 4LGRB 3WD5L 1E4KC 1J5OL 3CZ8A 2VDNH 3LQZB 5JW4M 5IP4A 5J11C 1HTYA 2CPUA 3IJHA 5IGXL 1YN7A 1UM5H 5E4EC 4N8CL 2DWDA 2NXZC 3KPQB 3K7UA 4KQ3H 5AY7A 1LQ0A 4HKXA 1JNLH 3QQ4A 3THDA 1XF1A 4JKWA 2BVQB 4FK9A 3PUCA 4YXLL 3HB3D 4HCRL 4EI5B 5F89A 3PZUA 5FIPA 1GJIA 4OB5L 2G2RB 2WYSA 4JFED 2VL5B 3QUXD 4YK4B 2EDYA 5E6IC 1PAMA 2AW2A 4ZNEE 2VCBA 2FLBT 3O2DL 4DGIH 3PWPB 1DN0B 3WNKA 4E5XB 3A47A 1BF8A 3U30C 4OLUH 4UAOB 3TYFB 4N5UA 2ENYA 4P5TB 1GAFL 4IOIB 4CADB 3RUGB 2BY2A 4UQ3B 3O8XB 1I3UA 4Y7EA 1NGQH 4WEBH 1U93A 5CKGA 1V0MA 4JAMA 5GRWA 2O9TA 3AHTA 3HCVB 3AZTA 1PG7X 3MRJB 3SE4C 4JGJA 4DK3A 2YDQA 4FQHB 1HP5A 1MIEH 2ZWYA 4JZNA 4WJ5A 4WI2A 1D5XB 3DUHA 1S5HB 1H9VA 3O9NA 4UUJA 5EBAA 5AC5A 2Y07L 4KJPD 4KVNH 4RFOL 3MV11 1UUQA 3G5YA 3RO8A 3MC0A 3MGTB 3ECBB 4HHAA 1CGXA 3NABH 5CZVH 4ONFH 3EDEA 3WIHA 1VFFA 4P2QE 2AJYH 4JFEE 4G8GE 1UZ8B 1RJLA 3U9PH 3UEQA 1V7NH 5HYIA 3MUGA 3MR9A 4LHUB 4TTUA 2ARWA 1HSBA 4ACYA 4DWSA 4HQQH 3OQ3B 3ESUF 3VFNB 3D9AL 1EFXA 1KXTB 3VSUA 3A6BL 1CD0A 3QFDB 1G01A 3BEWA 4P8VA 2ZCLL 3G5VB 4F9LA