8CGTA

Structure of cyclodextrin glycosyltransferase complexed with a thio-maltohexaose
Total Genus 230
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
230
sequence length
684
structure length
684
Chain Sequence
DPDTAVTNKQSFSTDVIYQVFTDRFLDGNPSNNPTGAAYDATCSNLKLYCGGDWQGLINKINDNYFSDLGVTALWISQPVENIFATINYSGVTNTAYHGYWARDFKKTNPYFGTMADFQNLITTAHAKGIKIVIDFAPNHTSPAMETDTSFAENGRLYDNGTLVGGYTNDTNGYFHHNGGSDFSSLENGIYKNLYDLADFNHNNATIDKYFKDAIKLWLDMGVDGIRVDAVKHMPLGWQKSWMSSIYAHKPVFTFGAWFLGSAASDADNTDFANKSGMSLLDFRFNSAVRNVFRDNTSNMYALDSMINSTATDYNQVNDQVTFIDNHDMDRFKTSAVNNRRLEQALAFTLTSRGVPAIYYGTEQYLTGNGDPDNRAKMPSFSKSTTAFNVISKLAPLRKSNPAIAYGSTQQRWINNDVYVYERKFGKSVAVVAVNRNLSTSASITGLSTSLPTGSYTDVLGGVLNGNNITSTNGSINNFTLAAGATAVWQYTTAETTPTIGHVGPVMGKPGNVVTIDGRGFGSTKGTVYFGTTAVTGAAITSWEDTQIKVTIPSVAAGNYAVKVAASGVNSNAYNNFTILTGDQVTVRFVVNNASTTLGQNLYLTGNVAELGNWSTGSTAIGPAFNQVIHQYPTWYYDVSVPAGKQLEFKFFKKNGSTITWESGSNHTFTTPASGTATVTVNWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYCLODEXTRIN-GLYCOSYLTRANSFERASE)
publication title Substrate binding to a cyclodextrin glycosyltransferase and mutations increasing the gamma-cyclodextrin production.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 230
structure length 684
sequence length 684
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8cgtA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8cgtA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 8cgtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 8cgtA01
1JRHL 5T3XE 2KKQA 4XVUC 3TESA 4E0RB 2AQ3A 1A22B 4NN6B 2YLAA 4FNLH 1ADQL 1CGVA 3PL6A 4DGVL 1RZKL 1R3KB 3VIOA 5DD6B 2HLAA 3AU1B 3IDMB 4KJWC 5HYSA 5IVZB 2BSTA 4BQ9A 1J01A 3V4PH 3STLB 5L2KE 3WFLA 3GMLA 4NN6C 4N90E 3OWEA 2CO6B 4S0TD 3MSDA 4MAYA 3L4WA 4LHUA 4XX6A 2CRMA 4PJ5A 5EIQA 1CDJA 3TA9A 4HS6A 4A6YA 4M6MH 4GG6E 4QRRB 3W9EB 4HXBH 1UR2A 4MD0A 1MW0A 5K9QG 3UBXI 4EVNB 1SEBA 2R0LL 5SWZB 4QRPE 4PV9A 5EIIB 5J3HC 1YY8A 3EO1B 2HTLD 3OKLA 3OXSA 3EYSH 2SEBB 3IU4H 3AM8C 5J1AB 1EGJH 2X4TB 5FYJU 4NNXB 2D9QB 1B6DA 4HWBA 1IEBB 1BAFL 4L3AA 1KTCA 3FQXA 1GOWA 1U8IB 1KTRL 2NW2B 3N0PB 1IEHA 3NFNA 1EQPA 5CEXB 2YPLE 3RWCA 3JV6B 3VSUA 1YEDB 4PTMA 3HZMB 4XWGL 2UY3A 2BJML 2LVEA 1D5XB 1WZAA 3QI9A 3GGWA 4I9WE 3RUGF 4HPGA 5F96H 2BVDA 3VIJA 2BVYA 1CFNA 3CHEA 3HG1E 4N5ED 1MCSA 1MUJA 4PRHB 1DUYA 3BAEL 2BHZA 1CD1A 2AJYL 1YJDL 4FP8H 4YIQA 4TUKL 5HXMA 1FYTE 3FB6A 4MXVF 1NOFA 4GSDH 3U4AA 2X4NB 3UTQA 3IETB 2PN5A 4HCRH 1WO2A 1CLOH 2HMID 4QRUA 1NCWL 2EIEA 1WDSA 2ZCLH 2ZUMA 1F5WA 4M7JH 5J9PB 3QUYB 4X7SH 4Y19B 1PAMA 3TBYA 5K9JL 1GC1H 4AMKH 3A6CL 1YEKH 2NYYD 1X4YA 1Q0YL 2J3SA 3T4YB 2VDLL 3UG4A 4J3SA 1A14L 5EZOL 1ZAGA 3OLEA 2YPKB 4HGWB 4J3UA 1RK0A 1A6WL 2CKBL 3QUYC 4O9HL 4B0MM 5HBBA 4HOZA 5I71B 1FE8L 3FOMA 3GMMB 4RAHA 1KFAH 4XCCH 5EBLA 2YK1H 4DUXA 5I1EH 2AMGA 2N7BA 1D5MB 5DEGB 1LEKB 1H15B 4NJ9H 2JIWA 5DURB 5I71C 1Q1JL 3Q6GL 3JWOL 3LAFA 4QHUA 3CX5J 4MCZA 5CSGA 3HA0A 3BQUD 1I8LC 3FCTA 1KG0B 4JFZH 3X13B 1G6VK 2VXUL 4IIQB 3RPIA 3MA7B 1J8HD 4X6FA 3VFTA 1WWAX 4Z7QF 3BKCH 4DTGH 1PKQA 1REIA 3TNNB 4LCWB 4LLAA 1H3TA 1QQDA 4G3YL 1SBBA 1BD2A 1JTPA 4X6CA 1NARA 5LGHH 1V6WA 5CQ1A 2F53A 3HC3H 1YC7A 4M8QB 4EI6A 3D0LA 4IIQC 3NN8B 2XNAB 1BPLB 5HBFA 4HJJH 4JKWA 1E6JH 3WFBL 4NKQB 4FMKA 1T6WA 1YQVH 2KBGA 4IOFC 1ZT1B 2DQGL 4KKLD 5D7JD 3CFKA 4OF7A 3VXSE 4AZCA 4XBEH 2Y23A 4RFOL 1GL4B 1XZ0A 5F6HJ 3IJHA 4PGZA 3UZVB 2J7DA 5B3JE 4Z7WE 4GI6A 1QO3A 1ZGLA 5EUOF 4K7PH 1UXWA 4TOQA 4FQQA 4OTXL 3TONA 1DQLL 4R6UA 1DBML 1WNOA 5GGUB 2HT2C 2FZ3A 4LLUB 4LMQI 4OCRL 5FCUH 1AR2A 4JFOA 5E8NB 3U79A 4OJFL 5CHNA 4UUJB 3NZHH 5A2BA 5HY9A 5K9OA 1I7UB 1TTGA 3MREB 4Y1AB 3CUPA 4YHPB 4JFDB 5CCKH 1ITCA 2NY6D 4ZSOE 3EYUL 4DJMA 1U9KA 2XQBH 5I78A 5T1LB 4LLDA 5F7DA 5JBFA 3BAIA 4OLVL 3FY1A 1F02I 4HIXH 4WGWB 4DN3L 1Y6MR 1VPOH 1E4KA 1JI2A 4PGCA 2JJWA 3WF0A 1F97A 3PHOB 4H8WH 1CLYH 5EU6A 2BY3A 4X9GA 2CXGA 3BP4A 5I77A 3PDOA 4E5XB 5ANMA 2P5ED 4PJGA 4LP4A 4MD4B 4O2EA 3DVGA 5BZDA 5FGCE 2ADFH 2VXTL 3FAWA 5A2IH 5DMKA 2JF6A 4C7FA 2VNCA 2R0KL 1QZ1A 2APTA 4DKFH 5GNYA 5F7NC 1BVKA 3QG6B 3GK8H 4Y16B 1AJ7L 4LMQE 4FG6D 2JLLA 3RNKA 4AEHH 4HS3A 4OCXH 1JRHH 1INQA 4QXTB 1GVYA 4ISVB 3KPQB 1ADQH 4EN3A 1CVSC 5LWYL 4DGVH 3S5LA 1RZKH 3DHPA 3K8MA 1Z32X 1NEUA 2K1MA 4Y16C 4ZOBA 5F8QC 2ED8A 4KJPC 1MCWM 1D9KB 2KQNA 1NSNH 1ES0B 1FVEA 4H20L 2XKNA 5KG9B 3ECQA 1YNKL 1UD3A 1RI8A 1U8KA 5DWUL 1KB9J 1A7QL 2A6JA 3F5KA 1D9KC 2YEZA 4RMWA 1UR4A 1HSAB 1NMCB 1ZA3A 2I07B 2R0LH 3VFRA 4M8VA 4K7PY 2KUTA 4UOQA 4N1HB 2CDEB 4P3CL 4ZS6C 4OLEA 5IB3B 2VLKE 1CE6B 3O3DA 4FXGB 1P7QA 3PQYB 3GJEA 1Y0LB 3JWDC 4F33B 3V7AE 1E4IA 3BZ4B 4PJXA 5FA3A 4A6YL 5HPMA 1NMCC 5E94B 4XTRD 5JOPE 1BAFH 2AJ3A 3O3BB 5JZ7C 2X4PA 4F15C 2HISA 2WZIA 1QD0A 3RVWC 1Q8MA 1FO0A 4OUUB 5IQ9A 4S1DD 4PGDB 1LP9F 1YC8A 4XWGH 1A3LL 2BJMH 2Q86B 4OGAC 4M00A 5CIPA 5E9DD 4XCNA 3WDPP 3BAEH 1HI6B 2AJYH 1YJDH 2FBOJ 2OR8A 4TUKH 5F1IB 2EADA 3FO2B 1PJ9A 4GKOA 4EDXA 1XF4A 1B6UA 1NCWH 2PXYB 3EKCA 3EYFA 3M07A 4LP5A 3H6JA 4OFIA 4ZYKA 3F12A 4ORZC 1UA7A 4P57B 4QCIA 3TN0B 1U42A 4KY1L 4RRPG 3L7FB 1W9BM 2FBJL 3BPCA 4P4RB 5K9JH 4BFGA 2R1WB 3D0VB 3A6CH 1JN6B 5J06A 2XVPA 5FKAB 1Q0YH 5HGGS 5A6KA 2VDLH 3H8NA 4NKMA 2PXYC 1A14H 3FQTB 5EZOH 4BSWA 1HXKA 1CICA 5C2UB 3S4SA 1AO7A 5H94B 1A6WH 5IBLD 3H0TA 1PX8A 1X3DA 2CKBH 4RAVB 4V2CB 3TN0C 1W1TA 4JVWA 4O9HH 1FE8H 3DMMB 3SKUD 2B0SL 2Q76A 4FQHB 1X7QA 3DROA 1MYRA 4JVUA 4U1HB 4PG9B 3DETD 3RUGB 1B3ZA 1NMAL 3HZYA 1ISVA 2OBGA 4AY1A 1M7IA 1AGDB 3B8SA 3MLTB 1Q1JH 3DMMC 3Q6GH 4UNVA 1AHWB 3VXTB 5B39A 3T0WA 3VGBA 3BGMA 3JWOH 3VFVB 5GISL 3GJFA 4F8TA 5FO7B 3PWJB 1JF5A 1KPRB 5JO5A 4J3TA 5I76A 2VXUH 2DS4A 4Q97A 4V1DD 1F2XK 1KIPB 1WWCA 5EU4A 3VW3L 4LEXL 1AHWC 4PJEE 4YFEA 5IMOB 3WEMA 1K4CB 4G43B 1MH5B 5AZ2L 4G3YH 4AT6A 1A9EA 1MWOA 1TMQA 4JZJA 3QQNA 1CYGA 4N8CL 1E4XL 4ACPA 1KTDA 1MPAL 1HWHB 5HHOA 5ISZD 3TC9A 2UVEA 4OIIL 5EC1A 4MZ3A 2E27L 3WFBH 4K71B 4U1SB 4OZFG 5E8EB 4U1IA 5ITFB 3V6OC 4POUB 2C8NA 3BVTA 4PP2B 4G8GB 2DQGH 1OT1A 3CSPA 3T3ME 4Y4HB 2NXZD 4KH2A 2FIKB 4RFOH 1AQDA 2D0GA 3BIAX 2R8SL 3QWQB 5H35B 5DEFA 4LK4A 5IWLC 1OF2B 3OB8A 4NQSA 4K71C 1M71A 4HUVA 2IXVA 3LPWA 1QW8A 4HIEB 1HHHB 4Y4HC 4P2OB 2VT0A 1DQLH 4WFHD 2X89A 4H5SB 2OLDA 3S36L 5IB2B 1ZSDB 5DRXA 5CLTA 3BD5A 3B9EA 43C9B 5IEHB 4PBXA 5I0DA 4CNIA 4OCRH 2W60A 1UEYA 3AAZB 3STBA 3CH1B 5M3WA 3IKCB 4QHNB 1HKLL 4OJFH 4FNPA 1BGGA 1Z6JT 4BQ5A 5KVMC 2GQHA 1JZ5A 4P2OC 3QFDB 4H25B 2G5RA 2X6MA 3WD2A 4URTB 4X8JA 5AAWA 3EYUH 2DM4A 5FUZL 1RK1B 3Q5YA 2QL1A 4OLVH 2YD2A 5BJTA 1OAUL 2ZKHL 4DN3H 4HD9A 3CC1A 1XGPA 4AG4L 2VLMD 3VE0B 4IRZL 3MJGX 4TX8A 2BXZA 2C4XA 3AB0B 1RUQL 2PW1B 5ERWB 3FW6A 3D18A 1G7IB 4LNRA 3VI3E 5IB4A 3B6SB 1TZHA 1XF1A 3LZFL 3O9NA 5F89B 3R06A 5FB8A 2VR4A 2DLIA 3HZKB 4M62L 3SDXE 1TFHA 4TOYL 2E9IA 3WDHA 2VXTH 4W68A 3IDGA 2CPCA 4YQXL 1MELA 2R0KH 3AB0C 2EACA 4GW5B 4H1LA 4OZHF 3G08A 3EJZC 3RX8A 4B53A 2ARWA 1FZJB 4ZFZA 1AJ7H 3MV8D 4CMMB 1KLFA 1RAMA 4RIRB 4LCCB 5K93A 1WDPA 1MHHB 3TIDB 3QHNA 3I3DA 5ESQA 4HULB 1BFOA 4WJ5A 4JIEA 5DQJB 3RGVA 2XI9A 5LWYH 5ID0A 2YFNA 3MRFA 3BAXA 5A8OA 4YN5A 5TDNA 2X7LA 3OSKA 4MDIA 4CW1A 5TF0A 1NCAL 4LCCC 4JKKA 5A6BD 4N0RA 3FT2B 3Q48A 2WUBL 4KXZI 2XWDA 2VLLB 1LG1A 2HG5A 4FFVC 4H20H 4YHKL 4NN7B 1W1VA 3CFBB 1YNKH 2C3VB 5DWUH 1HCFX 3EMZA 1A7QH 2BOBA 5C6PB 3EFFA 1QSFA 1JDCA 2GAZB 1Z9MA 4GW1B 4P3CH 4NN7C 4Y2DD 4UOW0 1CGUA 2VLJA 3BW9A 3SE4C 3OPZL 1NANH 4CVZB 4PR5B 3W0WA 2A73B 1FA2A 4PY8J 4A6YH 4MA7L 4P3WA 4NQEA 1J86A 2EDBA 2X4UB 3QFJE 3DV4A 1T89C 1H8OA 2OSLB 3QO1B 3BP7A 4APQA 2FDBP 4M61A 4LBEB 1SMAA 3VXMB 4RA3A 4WHYH 3FQUA 3SGDH 1A3LH 5E5UB 1R85A 4KDVA 2A6IB 1JWUB 1MLCA 2GIYA 2RGLA 4OGYL 5TQ0L 2VVSA 5IEKB 5C09E 3BEVA 1N5AB 5BVJB 1FO0L 2AAVA 2Z1SA 2WB5A 1OGTA 5INDA 2H2SC 2J4WL 4AYFA 3O9WA 5DHVB 5ABFB 4S1RL 3I3BA 2NY5L 2PYEA 2LU3A 4QF1B 4G9DB 4HBQA 4NBXB 5DJZA 4KY1H 1VFAB 2FBJH 3KLSA 1WAAE 5CD5C 1HKIA 3PWPB 5D2LE 4MJ6A 3I84A 1X5HA 2A3CA 1GAFL 3D3VB 4I3GA 1GGCL 3RWIB 4MNGA 2IANA 2F74B 1OP3K 1FZOA 2IF7A 1NBVL 4NIKB 4X4MA 3WKML 2J7HA 2B0SH 1P6AB 1L6XA 1IC5L 1FH8A 4WUUB 2CNCA 2R2EA 4QT5B 1LP9B 3QCUL 4S1SL 4KI5D 4AC1X 1NMAH 2IPUG 3FFCE 2DQUL 3S2CA 3U6RB 4Q7DA 5FYJD 4JLRA 2F2HA 2QKIB 2VAAB 5C0BD 1GZPA 1KJMA 2JK5B 3S9DB 5GISH 1KGCE 1L6ZA 5I15L 1B4JL 5K9KA 4HLZH 5EO9B 3OGVA 3BPNB 4U6YA 5E56A 5JW5B 1WFTA 1W72A 4JKPL 3VW3H 4LEXH 2X1IA 5AZ2H 4D72A 4PREB 2EDNA 4OZIF 1GGUA 4N8CH 1E4XH 3GSNA 1MPAH 2R23B 1U8QB 3EO0A 4P49A 2P5WD 4OIIH 4YDJB 1QKZL 4X5XB 3BPNC 4NOFA 3UDWA 2E27H 1BG4A 1IQWL 2VLRA 3UTZB 4F37K 1JUFB 1DQQB 3NABL 1PIGA 1YECL 4R0LA 2YD3A 4L4PA 2R8SH 4W84A 4MA3A 3OKDA 4Z7VE 1OINA 1SFSA 2IADA 3U7VA 4MJIA 1SJHB 2O5ZH 4U3CA 5AC5A 5C08B 3BZEA 5SX5K 4MWFB 3AXLA 4AK1A 3HCVB 3DIFA 2G3NA 4DQOL 4ENED 3EYOA 3EZ8A 3S36H 5B8CA 3CPUA 2XOTA 4X7TA 3N1MC 1HKLH 4IMKA 3ILQC 3D52A 2ZSWA 4PJHA 3X11B 2Z91A 2R15A 4MAYD 4LHUD 3FL7A 2RAMA 1CDCA 2H3NA 1PQZA 3UZQA 2D7PA 4ACZB 5FUZH 5IIEB 1DQDL 2QPUA 1LWHA 4P2QB 3EOAA 1F11A 3QHFL 3BLKA 3IFLL 1OAUH 2ZKHH 1HJSA 4F79A 1KBGL 3IDJB 1JRHI 4AG4H 1U91A 4ODWA 3RJYA 4IRZH 2E3VA 5FUCC 4DVBA 1RUQH 4POZC 2DPEA 5J6GB 4FQLL 4MJ5A 4TVDA 3LZFH 2IBZY 1MCQA 4UFJA 3PP3H 3PHQB 4M62H 2ZUUA 3UPAA 4BKLB 4TOYH 3DMMD 1Q0XL 1T1ZB 4AM0A 4AZHA 5C0IA 4UQAA 2XPKA 3MRNA 4HF5L 3NSNA 1J9YA 4YQXH 4W70A 1WKYA 1U8NB 3H9ZA 1UB6A 1URLA 4Z76B 4UMGA 5BV7L 5HGBA 4X6DE 4JZ5A 2GKIA 4LGSB 3LXCA 3OA5A 1KR1A 1XIWD 5HDQL 2CMRL 5C0ND 4ZPVB 3MV01 5DS8B 3ORJA 4KROB 3UTOA 5I73B 2GTWA 4MVBD 3EDKA 2AK4E 3PZNA 1U8LA 3VX1A 4E2OA 1NCAH 3E0GA 4XNYL 1JGVL 3KR3L 3RNQA 1MFVA 1UYWL 3WQ8A 4MDJA 1CT8A 2WUBH 5EFFA 1HOCB 2XJ7A 3U0WL 3O3EB 1W3HA 4YHKH 4BK5A 2HTKD 1W2PA 4KROC 1FP9A 1AGBA 5I73C 1G7MB 3CVIL 4C59B 4G7VL 4WWID 3F8UB 5EN2A 3CFEA 3GSQA 1AKJD 1I1YB 3BPOB 2H8PB 2P46B 5IKCA 1I9JL 1H0DB 1YZZA 4L3EB 4UDUA 3PWNB 4G8GD 3RVXD 4L5FL 2X10A 3NA9L 2GTZB 4RX4D 3OPZH 4A4AA 1DN2A 1JNHB 4WVRA 4OZHB 2QLYA 2DF3A 3D69A 3BPOC 3ALXA 1CGXA 3CHFA 3RWFB 4MA7H 2NW3A 1TQCB 3TH4T 4PTWA 1EZVX 4LKCB 4RE4A 5F7HA 5E8DL 1MRFL 1OB0A 4CADA 2R0ZL 4X4YB 5GGVL 4M80A 1P69B 5H37G 1LJYA 1MXGA 1AD0A 1TQCC 1CDHA 3CSYB 1VAHA 4OGYH 3L2LA 5TQ0H 1EDTA 1ZHNB 4JAWA 3PWVB 3NUKA 3AY4A 4FQCL 1I9IL 5LYRA 1FO0H 4BUHA 3RQ3A 2NXYB 3F7YB 3BSHA 3GJFK 3LPFA 1HIML 3VA6A 5GGRA 2J4WH 1CXEA 2P24A 3UEQA 5GJSL 1SJEA 1XR9A 3BZDA 3ESUF 4LPYA 4S1RH 2NY5H 4HDIB 2PTTA 1I85A 3KPRD 5FIEA 2ESVE 2F19L 2NXYC 4J4PC 3KPNA 2ARJA 3QJHA 3RWEB 4GZJA 5IQ7L 5KSUA 1G7HB 1GAFH 3TCLB 1GGCH 2Q8BL 2ZP0T 1A7NL 1FCCA 2DLGA 1JTOA 3VXQA 3S37L 5GGTA 5I1DA 2Z4QA 5IBTL 1X6NA 2VDQL 1NBVH 5GS0D 3SKNA 5BRPA 4G9FA 3WKMH 1ND0A 1IC5H 1XF2A 3AMDA 2W0FB 4PJBF 3FT4B 3QCUH 4S1SH 4E41E 2DYPA 5EU5A 5HI3D 4NSKB 2DQUH 1R3KA 4I0CC 5D8JL 2P48B 5B38A 4F7CB 4J27A 3AU1A 3IDMA 1CFQB 5LQBL 5HD8D 4S2SB 5KS9B 2VC2L 2XSBA 1OSEA 3STLA 3G04B 1P4LB 5I15H 4BQ4A 4LX4A 1B4JH 4OM1L 1TR1A 4YHEA 3KYOB 4JKPH 3MV7E 3AM8A 2RB8A 1G9NL 2WKLA 4GFTB 4QRRA 3W9EA 1QOKA 2GFBA 1H3WM 5SWZA 4Z9KB 3VU2A 4IDJL 1KQZA 1MHEB 2AERT 1QKZH 2A38A 4OLYL 2HFTA 2DBLL 1GOIA 1K9EA 2SEBA 3MMEA 1IQWH 3UBXG 3O6FB 3C8KB 5J1AA 5J1SC 1NP0A 3ZE0F 2O92A 3WUGA 1W72L 4NNXA 3NABH 5KZCB 1IEBA 1YQ2A 1YECH 3F7QA 3K46A 3GIVB 3WH6A 2NW2A 3GBNL 5MENA 3V9FA 2PC8A 4GG8B 4U1LB 2XTJB 5CEXA 3O6FC 3JV6A 2AV7A 4KRPB 3HZMA 1P7HL 1FNLA 4GKLA 1IGYB 1HKKA 1IM9B 4NUJA 4PRHA 4DQOH 3TBTB 1CFVL 1G6RL 5CFHA 2XTJC 3KXFE 4KRPC 1HT6A 1RVFL 4FTVD 2VC9A 4C56B 5JOFB 1KIRB 1N2RB 2X4NA 3OZOA 2VTFA 3IETA 3O41B 2C7UB 2AQ2A 5IVXF 1XF5B 1X5ZA 2X2YA 5IB5A 3C08L 4JRYA 1JGEA 1E28B 4M43L 1DQDH 5J9PA 3QUYA 2RJMA 1P53A 2BV9A 3ZHDA 1E6SM 5CGYC 3QHFH 5MERB 1QRNB 3IFLH 4PMOA 1WICA 2H2PD 1E3XA 1KBGH 4GZIA 8A3HA 1OY3B 2YXFA 2OXGA 4PJ8D 4OKVA 5TGBB 1WV7T 2OSWA 3DXAB 3QH3B 3W81A 4FQLH 1WCBA 1I1FA 1I4FB 4OGXL 4PRDA 3GMMA 4KU1A 4XNQA 3CSBA 4JCMA 1Q0XH 2HT3D 3DURB 4HF5H 4WUUD 1I8LA 5IFJB 1D5MA 1L7IL 4CCDA 2YLLA 1LEKA 1C5DB 5BV7H 5E1AB 4FMVA 1BFNA 3OQ3B 5HDQH 3TNMB 2W62A 2CMRH 3AS2A 3UAJC 2HH0L 1ODAA 4ELMB 4F9LA 4KK8C 5JHDE 3EGSB 4PJCF 4P9HL 4HZAA 3X13A 4IIQA 4H1LH 3SEPA 4XPFL 4N8PA 3LKSB 4XNYH 5FDWB 3ROLB 1DBBL 1JGVH 1F3DJ 3KR3H 1S7TA 4GAFB 4KK5C 5FK9A 3TNNA 1UYWH 1OTSC 3EDEA 5CJOL 1JF1A 5I19L 1TTUA 3U0WH 4M8QA 3VH8B 3WL0A 2B7DT 3VRLF 3CVIH 3NN8A 3CVHA 4G7VH 4WFED 3BKYL 1BBDL 5HVFB 3QEGL 2OJEB 5DMIL 4X9HA 3SGDI 1T0OA 1I9JH 2K7QA 3QXTA 4YBQC 3PZQA 4M02A 4L5FH 5JXEC 2PI6A 1AO7D 1ERNA 1WTGT 2AXGB 2IBGA 3NA9H 3QPXL 2JTDA 1VFBB 1BLNB 3VVGA 3MGTB 5CAYB 1T20B 3SN6N 2APWA 4OAWB 4X4XB 4WIQA 5E8DH 1MRFH 3GSWB 2R0ZH 4P46D 4TTDC 2NTSP 5GGVH 1DP0A 2QQNL 1TIUA 5GGUA 3IF1A 4MNMA 2AXFA 3KWWB 2IG2L 4LLUA 1FNFA 4LAJH 4PJ5E 3U4BL 4UZSA 4QNPE 4P5TD 5E2VL 3FN3A 1CECA 4UUJA 1JNEA 1I7UA 3VFSB 3G5VB 4YHPA 4Y1AA 3OKMB 5C0FA 1I7ZB 2ZCHL 4JFDA 4FQCH 1I9IH 3SDAA 4QRSB 3VGGA 1KYOK 1ISZA 3ZKNC 1CS6A 5T1LA 3QQ4A 5C0AD 1HIMH 2P49B 1IAII 4HX1B 4XPTL 5E2JA 5GJSH 5BO1L 3GUTA 1YYLL 1NGPL 3GBEA 5JOEA 3PHOA 4ZE5A 4XBPA 2F19H 1WWBX 1L0PA 2NZIA 5IQ7H 1GOHA 4QRQB 4E5XA 4YEFA 4BQCA 3JTSA 4MD4A 3AS1A 2Q8BH 4H26A 1A7NH 1V05A 5DK0B 5GRWA 4I48B 3S37H 2E40A 4E8CA 4NZJA 1B2YA 5IBTH 2VDQH 5BRZB 3C5SB 1NJ9B 3QG6A 3GMQB 5LGJB 3CZGA 1DWJM 1QSVA 4ZFFA 5GRYA 3EYPA 4MDPA 1E4XI 3V7AG 2BNRB 4ISVA 3KPQA 2X89D 5D8JH 5GGTL 1SJVA 1VDGA 4GAJL 4HJ0C 1VADB 1W0VB 4MCYA 5LQBH 4IOIB 2EE6A 1E6QM 2VC2H 1O6IA 1DDHB 1BZ9B 1WB0A 3X3GL 4OM1H 3HE7D 4FFWC 3SDDA 4OUEA 2KH2B 4M6OL 1G9NH 3A47A 4Z7OE 4JRXB 2WVSA 3NFPA 2HWZL 4YHZL 5AZEL 1FIEA 3ULSB 4IDJH 4NBZB 4OLYH 5IB3A 2DBLH 5GGVY 1LL7A 4M1DL 3ULVF 2I60L 1MFCL 1W72H 3BZ4A 4WI4A 4K68A 5E94A 2MHAB 2E9LA 3W5NA 3NIGF 3O3BA 2J75A 4IJ3B 4PJBB 2VX5A 4ZUTA 4ZDHB 2ZE0A 3GBNH 1G9HA 4LPCA 2V3EA 4OUUA 3MSGA 3ZJKA 5ACMA 2CR6A 2Q86A 1CZ1A 1PKQE 4JM2F 4IJ3C 1N3NB 1NFDF 3DX9A 2DT1A 1BD2E 5ELIA 5ACZB 1CFVH 1G6RH 4NNYB 4EI5A 2EABA 2F53E 1RVFH 5F1IA 3VFPA 3FO2A 4ONGL 3QEHB 2EYSA 5KVEL 4U4BA 2F54D 1NP2A 1J18A 5EOCL 4PYSA 2W9LA 2PXYA 2R2BB 3PWUA 3BH8B 1MY5A 3C08H 3FN0L 3AHVA 2OSXA 1JV5B 1TENA 3MV11 4M43H 3TN0A 3CFJA 4P4RA 4WI9A 2R1WA 4DGYL 4B15A 1QSFD 2W9EL 4NZDA 2ICWB 2ATPA 2ID5A 3P9WB 3FQTA 2YDRA 1LWRA 5ESVB 2P4AB 5CJXC 3MTRA 3AGVA 4OGXH 2Z31B 2FEDD 5D2NB 4CRPA 5F7UA 4R7NA 1XGUB 2W67A 4U1HA 4K9EC 3A4WA 3NJ3A 1L7IH 3S35L 5A16B 3DOSA 3O3AB 1E0OB 1H3PL 3MLTA 2Z31C 3EOTL 1OGAD 5D2NC 1EAPB 2Y5TB 3MMDA 5HGDB 4FQPA 3ZT7A 2VZ1A 3VFVA 4H8VA 1M7XA 2KZ1B 2HH0H 5FO7A 4O5LL 3M6DA 5BW7A 3KWXA 4P9HH 5IVXB 4TUJB 4RGNE 4XPFH 4R4NC 2X09A 1NBZB 3FO0L 1DBBH 1K4CA 4G43A 5EU6E 2OMBA 4AZ7A 4PRAB 5M5DA 1ZT4A 5CJOH 5ANME 5I19H 4PJGE 2XFRA 2V7HB 1DQTA 2IEPA 1QVBA 3BKYH 1BBDH 4U1SA 5I16B 5E8EA 3VXUA 2EC9T 3QEGH 5DMIH 4PP2A 1U8HB 3UPCA 4Y4HA 1KLGA 3ARBB 4YWGL 2FIKA 2FSEB 5H35A 3QPXH 4ZXBB 4YR6B 1E6NA 3FKUS 2X9XA 1OF2A 4JCLA 3P4NB 4PB0L 4R27A 1F13A 3WQWA 1HHHA 4P2OA 3ARBC 5M03A 2VERN 3LEVL 1CDBA 1FFPA 4H5SA 4ZXBC 5DHYB 5IB2A 2QQNH 2CLZA 43C9A 5KSBA 5IEHA 2DQEL 3HI1B 2JE8A 2D3NA 3U4BH 3IKCA 4QHNA 5E2VH 3OJ2C 1KR0A 3ILPA 2A2QT 4B41A 3QFDA 3Q0HA 4YGVB 2CIIB 3H9SE 1EJOL 1WDRA 2ZCHH 1MCIA 2A3EA 4LHJB 1IM3B 5ECJE 3FRPA 4WY7L 3AXHA 2C3XA 4FLQA 4NX0A 4ZD3L 3EAKA 3ZYZA 2NY1B 2FNBA 3BUBA 4XPTH 3BD3A 5BO1H 1YYLH 4G80A 3TZVD 1NGPH 3BVWA 1U30A 5MI0B 5C9JA 4MYWB 4D3CL 5ERWA 1KGUA 3H3PL 5CPSA 1KCKA 4D8PA 5ADOL 2VLRD 1H9VA 1G7IA 3C09B 1ZJAA 1H0IA 1E4NA 1JGDA 2NY1C 5F89A 5A2JH 4U1KA 4P2RB 1J0HA 1H2JA 5MI0C 4AYGA 1T83A 1BQCA 4G6ML 4MJID 1FZJA 3C09C 3BT2L 3AIQA 4CMMA 3O0RL 5GXBB 1DN0B 1HL8A 2R69L 1GOOA 4LCCA 3WQVA 1MHHA 3L3DB 4PGEB 1JZ7A 1J12A 3HNSL 3QRGL 1SYVB 5DQJA 5T3ZD 3UCQA 1FQ9C 5D7KE 5GGTH 5DUBB 1OWWA 4GAJH 1A64A 1INEL 2J8UF 2FE0A 5C3LD 2VITB 3FT2A 3I6KB 5C0DB 4PMXA 1FGNL 3X3GH 3BAKA 3QQ3B 1GJUA 3D39A 1IARB 2FL5B 2YOCA 3T0DA 1OTTD 5DMJB 1YNTB 3SE4A 4IPNB 5C2BL 1CTNA 3BSZL 4NF7A 3WNPA 2AQ1A 1Y7VA 3DRTB 3TH3T 1PYWB 2HWZH 4YHZH 5AZEH 3RAJL 4MNQA 1HYSD 3ZR5A 1HILB 1T89A 4M5ZL 4M1DH 2I60H 3BRFA 4X7CC 5A8QA 1MFCH 4PR5A 3BCFA 1UWRA 5A6JA 2JB6B 3JWDL 1TVDA 2XG5A 4D6JA 2V5CA 2X4UA 1IAOB 3S8WA 1LL6A 4JN2A 4GZEA 1SVCP 3MO1A 2OSLA 1BX2B 5GGSA 4HC1A 3CFDB 4C7DA 4WW2F 3VXMA 1JZ3A 3C6SB 5I1GL 1XFPA 5JNYB 1MW2A 3QIUD 3MBXL 5JW4R 2NLJA 1XGQB 5FGBA 5SV3A 1IAKB 4P2YA 5SV4A 4H0GA 3F7VB 3PIQB 3SJVA 2CETA 2WZEA 5IEKA 2QMJA 1INDL 2CH8A 2UY4A 1G01A 1U93B 5HHOE 3PABA 1N5AA 4JGJA 1DANU 4ONGH 2CUHA 2ZOLB 5J8OA 5HDBF 1W8OA 5KVEH 3RM9A 2JF1A 2NR6D 5EOCH 1C90A 1CQKA 3MLUL 3FN0H 3BZFA 3L3HB 4YBHA 3CD4A 3JUYA 4QF1A 5F97E 1VFAA 3SHSA 2J8GA 5E6ID 3RPKA 4DGYH 3PWPA 4PJDB 2MWCA 3CDGB 1D6EB 2W9EH 4L4OA 3D3VA 4DGIL 1WWWX 4XNMB 2X05A 3RWIA 5DJAB 2CYGA 1P4IL 1TA3B 5E5RB 1TLKA 5C0GB 3VXRD 1XYZA 5E1QA 3P4MB 4KKNA 5FECB 4PRWA 3WN6A 2APFA 2NCMA 1QX1A 5BRZD 3ULVC 4X9IA 4QT5A 2GEEA 3LKRB 5DFWH 3RY4A 5GRVK 3S35H 1NFDB 2PO6B 2E6PA 2GJJA 3U6RA 1H3PH 3BAYA 3UTSD 3EOTH 4GRWF 2GJZA 3KPMB 1DWAM 2EE9A 1FFNA 1MHCA 4O5LH 5HHVL 3C8HA 5EO9A 2PO6C 1ZU8A 3U2SA 1IMHC 3A23A 5DO8A 3FO0H 2MKLC 1A47A 4KFZC 2VE6A 3VGFA 3V5KB 5EB8A 3HZVA 1MAML 2R23A 4MD5B 1U8QA 2L7UA 2MCPL 4YDJA 4X5XA 3O4LB 5DQDL 5ENWB 4ODTL 4HK3N 3L6FB 1TQTA 2Z8RA 1JUFA 1DQQA 4PJFA 3EZJB 3TLRA 4YWGH 4GOSA 3U0PB 1E4WL 4U1JB 1B3XA 1T5XB 4FZEL 2PCPB 1SJHA 3F5LA 3EHBC 5HYEA 3RTQB 2J2ZA 3LB6D 2KPNA 4PB0H 5C08A 1CNVA 5I2UA 1FN4B 5D93B 1YUHB 2DYPD 5FF6B 3LEVH 2J7GA 1Z9OA 3HCVA 1E4JA 5C1MB 4OCMC 1QSEB 2CLVB 3IJSA 4GXUM 4KDTA 2DQEH 3RTQC 4YXHL 4CKVX 5L9DL 2XIBA 1DHKA 4QFUA 4LGRB 5D93C 3LSOB 3T0BA 4N9OB 1A3QA 4D6DA 3X11A 1EJOH 3AROA 3L3IA 4UT9L 3TA3B 1FP8A 3K2MC 1JAEA 1XT5A 3TBSB 5BS0D 4ACZA 5IIEA 1NL0L 4AENB 4WY7H 2VLJE 4P23B 3BKML 1Z5LB 4ZD3H 2MFNA 1MCEA 2DM3A 3KPOB 3OL2A 3W0WE 1I3VA 4XHJC 1WT5A 2OMNA 1A5FL 2KDGA 4GW4B 4NQEE 1GONA 3TWCL 5CZXD 2DSVA 3TA3C 4D3CH 1R5IB 3H3PH 4ATLA 3UERA 5ADOH 4M7KL 4KV5F 5J6GA 5A8PA 2DOCA 4P23C 3PZ9A 1FG2B 5DRNB 2ZSVB 4AZ8A 4LLWB 2P8LB 1E6RA 2I26N 5D1QA 2HFEB 2GW5A 3QUZB 3UTTB 2PUQT 5MEND 1U8NA 5IFHL 1WBXA 4G6MH 4G8EA 5EBWB 2W5FA 2WZPD 4Z76A 4LSTL 3BT2H 3O0RH 3H9YA 2R69H 3ZQ9A 5GZOC 4M6NH 2BCKA 1K9FA 2Q87A 3HNSH 3QRGH 3RVVD 3QUZC 4ZPVA 2H9GA 1NQ6A 4IRJB 4HWUA 5F9DC 4Z5RA 5E6ZA 3RIKA 2M8XA 2ZCKL 2WHJA 1C16B 4L3CB 3G5XB 2PYEE 1INEH 3VGHA 2OWWA 2OTWB 2BY1A 3ZYIA 4WSJA 1EO8L 3WUBA 1QLFA 3HAEB 4IRJC 5DF0A 1FGNH 1UCBL 1E6ZA 3O3EA 4OSUL 2YL5A 4JRYD 1G7MA 1JI1A 1WEJL 5DO2C 2IANE 5C2BH 1O7VA 3CFCL 4NI3A 3BSZH 1RZIB 4X4ME 2D0HA 2DI7A 2HVMA 1H0DA 4L4TD 3RAJH 4NZRL 1AQ0A 3PWNA 4W8LA 1AD9A 2G9HB 1RUPL 3KPSE 4M5ZH 1TETL 5ILTL 3DX4A 4QRTB 2P8MB 2VQTA 3RA7L 2QHAA 2EO7A 2FO4B 3JWDH 5AYUL 5AEAA 2R1XB 2YKLL 4JEGB 3CIVA 1W9XA 1MFAL 3IFOB 3LQZB 1IC7L 1AXSB 2GSJA 3N06B 2W63A 2H32B 4LPUA 5I1GH 2ZX6A 2J6EL 3MBXH 1B0IA 3L4YA 2MCG1 1JYVA 4X98A 3CSYA 2J8UB 3EYVB 3MYZA 2ZG2A 2D22A 1ZHNA 3PWVA 3IRPX 5F7WC 1INDH 2IH3B 5DFAA 4AD2A 3VPLA 3L5HA 4PJAA 2GVYA 3LRHA 3ARUA 4HC1L 3IXAB 3EYQD 4BZYA 3F7YA 4J4PA 5C0EB 4JFHE 1XCQA 4NQCE 2EC8A 4U3XA 3MLUH 3C60A 5CP7A 1MVUA 4HDIA 3CZSA 4OF5A 1S9XA 3T4AA 2A3AA 4YPGA 1S46A 4RMVA 4HFWB 1V7NL 4X0NA 2E6JA 3FO9B 3TCLA 4DGIH 2E3ZA 4LDEB 1P4IH 2BSSB 3FO1B 1BJ1H 2B5IB 1YMMB 3K4AA 4XB8A 1T0MB 2XGIA 5HVGB 4JZNA 1FCGA 5IMLA 5IV2A 1WISA 4DN4L 1BSIA 4WW2B 1G0YR 4QHMA 1KQYA 3POHA 3FT4A 4QHKI 5DK2B 3TO4D 4TVCA 2B5IC 4NSKA 1Q4NX 3LKQB 1KPUA 4PJHE 2YD8A 5C07D 3BUPA 4PUDA 3VOCA 4ONOA 3NIDE 1CFQA 1ZHBB 3B2UC 4WW2C 3WEOA 3AIBA 4S2SA 5KS9A 4HU8A 3SGKC 4J3OC 5TDOB 1P4LA 4YHGA 3NSMA 3CC5B 3HMXL 5HHVH 1DUZA 4AH2B 3SDAD 1W3KA 3KYOA 4F2MB 3WMBA 5DT5A 3BUYB 1A02N 3BI9X 3T0EB 1CU4L 3KDMA 4RNRB 1NGZA 4YO0B 1EK3A 1MAMH 2NY4D 2MCPH 2A9NL 3DX6B 5DQDH 3OGCB 4N5UA 4ODTH 4PMVA 3C8KA 2HT4C 3T0EC 3WIHL 4UQDA 4K94C 5GZNC 3EJJX 3STZA 1NDGA 3GIVA 1E4WH 2WWMC 4FZEH 2GK1B 7CGTA 2H6PB 5EO0B 4XGZA 1L4IA 4U1LA 2F5BL 3WFHA 3U46B 3EDDA 2EDKA 4C54A 4CD6A 1ZT7B 4GRWB 4U7KA 4PLKC 1IGYA 5A40E 1L0YA 1YEGL 4LSRL 1IM9A 1CLZL 3QWOB 5DD3L 3KHQA 1S9VB 2FJGA 4HV8B 5L9DH 4YXHH 2WSPA 5JOFA 1KIRA 1N2RA 1N0XL 3CUHA 1RP9A 5KVDL 5HJ3B 1XF5A 2ZXDA 1GOQA 2NNAB 3EOYG 1ZLVK 5E4EB 1KB5B 4UT9H 3BN9D 1GOFA 1EGZA 1E28A 1ZOXA 5HVHB 3SDDD 5L88L 1DTUA 1NL0H 3LDBC 4UFKA 3BKMH 5MERA 4I2XB 2FR4B 1QRNA 4U49A 5IM7B 5JW3L 4DWHA 1A5FH 1S9WB 4DWSD 1FFRA 3TWCH 2BNQD 5E4EC 5HHNB 3UTPE 4WKFA 3WUEA 4XWOD 5HVHC 5TGBA 4TXEA 2CUMA 3DXAA 4M7KH 3F5WA 1T1YB 1V0LA 1I4FA 4N8VA 1L7TL 2GCYB 5TJWK 4EANA 2L4OA 4H88L 5IFHH 1C5DA 1Z0NA 4YZFF 3KYAA 4LSTH 4MB5A 4JM2D 3V0AC 4LCYB 5LXGL 4Z95L 4HWEL 4R7DB 2VMFA 8FABA 4ELMA 2X70B 1YYML 3MFFB 3EGSA 2H26B 2IBZX 4EI5D 3V8CA 2ZCKH 1YEJL 2ZICA 5AD0A 3LKSA 5CMAB 3ROLA 2DQDL 4CMHB 5KN5B 3WSQL 2EXOA 4U3HA 4YE4L 3GEWB 1EO8H 5D8WA 5CXPA 3OZPA 4LHUG 1OHQA 1UCBH 5JXEA 1S7UA 4OSUH 4BZ1L 3HR5B 3VH8A 4MQSB 1WEJH 4HKBA 1TCMA 4PY7B 2WMPA 2Q20A 2RBLA 3CFCH 4CMHC 3QNYB 4AEEA 3O4LD 4G9FE 4IHOB 1QR1A 1FLRL 4I13B 4OBSA 4NZRH 2BSRA 4ODHL 2CHNA 1RUPH 1TETH 5ILTH 1LQ0A 1SEQL 1VFBA 3RA7H 3V8OA 1BLNA 2UWEF 1UWXK 3RI5F 3CCHB 3TVMD 4RBPH 1T6VN 1EAJA 5AYUH 4XRCA 2FATL 2C1PB 2V5RA 3MGTA 2BP3A 4KRLB 2YKLH 4OAWA 3RJDA 1MFAH 4I0PD 1MCRA 1PD6A 1IC7H 4Z77B 4HIJB 3KWWA 5IJKA 2FX9L 1IQDA 2YA0A 4HP5A 2J6EH 1XCTB 5SWSA 1QSED 2EDJA 2DGAA 3CBWA 4GMTL 4QRRE 2ZXAA 1TMCB 1T1WA 2DIAA 3G5VA 4WV1B 3OKMA 3PN8A 5SWZE 1I7ZA 3FOLB 4LSUL 3VWKA 3KPTA 4PRIA 4Y7MA 4HC1H 4Z7UF 1US2A 2EYRB 1QI2A 1I75A 2EDEA 2JIXB 4XNUL 2UYLB 5CEYA 5IBUB 1UWGL 3VTRA 4LSVL 3TV8A 4WV1C 3ARED 3HLAA 1H09A 3NSXA 1V3LA 4BZ2L 5HGAA 3CX5K 3DRQB 2VURA 5DA0B 1Q6FA 1ZGLP 3DYOA 5AUMB 3VXUD 5JMRA 3QUMB 4QRQA 5J1TC 5FYKL 1V7NH 4PRBA 4WENB 1ONQA 4KKAC 1T22A 3G9AB 1FP5A 3BH9A 1QBML 5HHPB 3BPLB 5DHVH 1QR4A 2EH8L 2XSAA 4PRHE 1NJ9A 3VFNA 3CDFA 4DN4H 5JMOC 3GXDA 2OM5A 4UNTA 4TTGA 4JFVA 3PTQA 2CDGB 4JDZA 4HLZG 4QWWC 4JANB 5DDHB 2ICEB 5E95B 4BJLA 1HN1A 1UWSA 3BPLC 1P2CA 2WVVB 3ARFB 4ZO7A 4Z78B 1UOKA 4TVPL 3B83A 1BVNP 4WHTB 1WFNA 4NC1C 4GG6F 1PLGL 1VADA 3UZEA 4X7DC 5AG9A 1NEZB 4IOIA 3W24A 4Y19E 4PJIF 3O4OB 1OGSA 3C6LB 3I9GL 5I9QB 4KGLA 1DDHA 3ARFC 3HMXH 3MRHB 4BH8B 4NO2B 3ZSSA 3VUPA 1R5VB 2ZUYA 3C5JB 4X7FC 1CU4H 2MOVA 3O4OC 4K55A 4PMDA 3C6LC 5I9QC 4W5UA 1HHIA 3ULSA 4AZ6A 5HTSA 2J79A 2YL6A 1DZBA 2A9NH 4U33A 5BWFA 2Q7NA 3II1A 5DD0L 2IAMB 3JZ7A 3WIHH 3P9MB 1HE7A 3MRKB 2MHAA 1UVQB 3VGDA 4UILL 3BDXA 4R90L 4NJAL 4R3SA 2F18A 5BVPL 5KAQG 4XAKE 1M4KA 2YBRA 2EXYC 2FHBA 4WI2A 3MSPA 5EBAA 4NCDA 2IAMC 2F5BH 1OARL 4FQXA 5DJYB 2EKSB 1L0XA 1P1ZB 4HH9B 3X3FL 4ODXB 2CJUL 1UD2A 1YEGH 4W93A 4LSRH 4LCWE 2BOCB 1AGCB 4QOKB 1CLZH 5I1LB 1FH5L 5ACZA 4NNYA 4HMEA 1HQ4B 3TEUA 2YS4A 4GAGL 1NWSA 3WLBA 2EEBA 2GYSA 1H5BB 3MCLL 3SDCD 3QEHA 4RISL 1T66C 1N0XH 3A6BL 4E42A 3DX1A 1JIBA 5KVDH 1HF6A 3KPLA 1U3HA 2R2BA 1G7JB 3BH8A 3D39D 1WIUA 5C86A 5CJXA 1OSZA 1H5BC 5DRWB 3QDGD 5DEZA 5L88H 2G3JA 1F4YL 3PDDA 4L29A 4O4YL 3M8OL 1KIQA 5JW3H 3OKYA 5I2IB 4D6FA 2ICWA 2A0LD 3MLXL 5D1XB 1FHLA 4MNQD 3QNZA 3K4DA 1BREA 1R24A 4JFFD 4YDLB 4M7ZB 3ZTNL 1S8DB 3BVNB 2Z31A 1G7PA 5D2NA 1L7TH 2JCCB 3P4OB 2X44D 1XGUA 3UYRL 4HPYL 5D1XC 4HW6A 4DUVA 5GGQL 4HBCL 2COQA 3B2UD 2R9HC 4H88H 1EPFA 1BTCA 4TTUA 1S9YB 2NZ9C 4YDLC 2R2CA 4M7ZC 3WHE0 2GY5A 4EQ2A 3O3AA 4Y1AE 3WJLC 2YZ8A 4ETYA 5J6HB 3FT3B 4PJ9D 4JFDE 1DQJB 5LXGH 4DZ8A 4Z95H 4HWEH 1UCTA 4AD3A 2Y5TA 5HGDA 1T0NB 1IKNA 4JFYB 3S5LG 4Q2ZB 3SJVD 1YYMH 5D7LB 3RVTC 3GXIA 2PYFB 5C0CD 3QXAA 4PP1C 4C58B 2F58L 3GSOA 3VFUB 4TUJA 1YEJH 3FQWB 3V0VB 1NBZA 4TSCL 3RKDD 3MA9L 2DQDH 3WSQH 2LVCA 4YE4H 3WUFA 4Z7WA 4PRAA 2HT4D 4G8FB 5T3ZL 3I85A 4GKSB 4KK9C 4BZ1H 4ZUWA 2Q6WA 4U0QB 3SQOL 3T2OA 2BVOB 4L8BB 4CU8A 3GXPA 5I16A 1UT9A 4MGXA 3IAPA 4G42B 1FLRH 3F7RA 5K9QI 4HZ8A 1U8HA 3KYMA 1H11A 3SKOB 2V2TB 2G3IA 4ODHH 4GRMB 2X1QA 3SCUA 4UU9B 3IFPB 2A6DB 3EJPA 1CLXA 3ECBB 1KPVA 1SEQH 5JQ6L 2JF7A 2Q8XA 5KSVB 2J74A 4ZSOA 3P4NA 1G7LA 1I8MB 1QRKA 4A2LA 4XXCC 2WMHA 2FATH 2DJ4A 1IV8A 4L4VD 4JN1L 3U1SL 4KQ4L 1KT2B 4LU5L 3JV0A 2FX9H 3HI1A 3HPLB 2FX8L 1LO3L 5E08L 4K07A 3SCVA 4GMTH 5BQ7B 4YK4B 4HUWB 4YGVA 4YGAB 4F58L 1MFUA 4LSUH 5DC0A 1E6PA 4K3JL 4NPYB 2V5SA 3PQYE 5AG8A 3ISWA 4XPAL 4XNUH 1H3UA 2I24N 1UWGH 3K1DA 4LSVH 3OF6D 4YK4C 2G2RA 2IJ0C 5FFLA 4DAGL 4BZ2H 2VCBA 5SX4I 1A7PL 1FYHB 3QHTC 4KUCF 3D4YA 5IMMB 5FYKH 1V3KA 2Q1EA 3N13A 1KB3A 3S4SG 2YN3A 1J1XL 1QBMH 4P2RA 1IEAB 1UZ1A 1C3FA 1RU9L 3MUHL 1HXJA 4MA1B 4NO5B 2EH8H 3UPRA 5JR1L 3B9DA 2WSKA 1LEIB 4LFHG 2ED9A 1OLZA 1Y6KR 2BXYA 3BO8A 1DN0A 4ZUUB 2ZWLT 3MU7A 2XVNA 2CKSA 3DX8B 4PGEA 1DFBL 3O8XD 4J1UA 1IC4L 3OB0K 4MA1C 2YJQA 4TVPH 3U48A 3GMPB 4ZAKB 1FVCA 4HGKC 5DUBA 5D9SA 5B39G 3QDAA 3WIFB 1PLGH 2JJSC 2VLKA 1VACA 4W7VA 1KYOJ 4HUMB 3SUSA 2VITA 3I6KA 3BUQA 3PWLB 2EDWA 3I9GH 3QDJD 5C0DA 4N9GB 3MMUA 5F1NB 1BVLB 3C5ZD 4ZAKC 4IRSB 2FL5A 3L2MA 2EIZB 1S3KL 1YNTA 2CSPA 2R2HB 4OIFA 1RUML 5A6AA 4XMPL 1VF8A 3AMGA 2I9TB 1JYNA 5DFVC 2WMKA 1WITA 1EXPA 4NO3B 1PYWA 4NP4L 4XX1E 4IRSC 1HILA 4X5LA 1A3RL 3SO3B 1JPFB 1BAGA 5DD0H 1JPSL 4I8DA 4M7LL 3OKOB 4OUOA 4DVRL 2JB6A 3GXTA 5DZOA 4PS4L 4MXQD 3L3GB 5D1QD 1E9LA 2V5TA 3B9KB 4UILH 1IAOA 4RGMB 4R90H 2DH2A 3JXAA 4NJAH 1EERB 4MXVE 5BVPH 3PXHA 3C9NB 4L8SA 1BX2A 3SO3C 2P47B 3MNWA 3WJJC 4PMUA 1OP5K 1OARH 4LCUB 5KTEL 3X3FH 2CJUH 3B9KC 3V6OE 1OBAA 1IAKA 4QO1A 4RGMC 5E4IA 4PJIB 3F7VA 3WHXB 5HI5D 1CLVA 1FH5H 3RBSA 4MQ7B 1N59A 4GAGH 1U93A 4MJ4A 2HVJA 3MCLH 2XIIA 3GNOA 3NCOA 4M82A 2ZOLA 4RISH 1FHDA 1Q6EA 3TPKA 3A6BH 1OT2A 2IPKA 4Q6YA 2NX5B 4NKOA 5D4YA 3SPVA 2JIXD 3RWGB 1TG7A 1XGYL 2CRYA 1B1YA 1V3IA 2V9QA 5F9JB 3VWJB 2QQLL 1X5LA 4NOBA 3HPJA 1F4YH 3K8KA 3UG5A 1VB9A 4O4YH 4PJDA 3M8OH 3CDGA 1ORSB 1D6EA 1X9QA 2OW6A 3W2DL 3MLXH 3RRQA 1TA3A 1NUDA 3L3JB 1A6ZB 4JJ5B 4LPXA 8CGTA 2DQXA 3VWJC 3P4MA 3ZTNH 5FECA 5CSYA 5FYLD 1FYTB 4D9RE 4YDVB 4Y4KA 5KSBE 1JWSA 3UYRH 4PJEA 1FJ1B 4HPYH 5GGQH 4HBCH 3RI5K 4H1LG 5DA4A 1U36A 4MB4A 2ITDB 5ICZB 2XICA 4JE4B 4K9EL 3VFOB 3WL9A 4CVXB 1I3RB 3DTXB 2Y4SA 2G8ZA 3QEQB 3FTGB 1S78C 2J4GA 3VIMA 2AEPL 3CZ8A 4QHKJ 3KPMA 5EU7C 4TVUA 3AFBA 1AMYA 1KEML 2LAGB 3TGXA 3ZE2E 2PWHA 2F58H 4WNQB 2CDFB 4Q22A 1NCUA 5ICXB 4P8WA 4TSCH 3MA9H 1B9ZA 3T3MF 3OR6B 3V5KA 4DO4A 5T3ZH 3C60D 3MOQA 4LOUD 4MD5A 3IDYB 3V4UL 1ZHKB 2V3DA 3QCVL 1M6OB 4D2NA 2GI7A 2HJFB 3SQOH 2C3WA 1W91A 4ZOAA 2NQCA 3MLSL 1U2YA 5BRQA 1UR0A 5E0CA 4QLRA 1YY9C 1W9UA 4R26L 3IDYC 1ED3B 2KL6A 3U0PA 3RVUD 3QPQD 4U1JA 2N1KA 4UIKL 5FUOL 4GKNB 4TNVK 1C1EL 1QP1A 1OB1A 2PCPA 3QIBB 5JQ6H 4FFZL 1I1AA 3KPPB 3G9VA 1FN4A 1YUHA 2CRZA 3V6BR 2L7JA 4JN1H 4WU5A 4KQ4H 3RY6C 3QIBC 1PEZA 4QLKA 4LU5H 2CLVA 1RD6A 3O2VL 3VXOA 2FX8H 2PW2A 3B3IB 4NQDB 4FK9A 1CGYA 1LO3H 3GM0A 5E08H 3UP1A 1WPCA 3LSOA 1PGRB 3ZSTA 3ZKSD 4XUYA 1KCSL 1T04A 3KGRA 3VI3F 4F58H 1IC1A 4I3RL 3TA3A 2ZOKB 4K3JH 3SDXF 3OAYK 2ITCB 1F4AA 1Z5LA 3DV6A 4XPAH 4PRPB 4UIMB 1NCDL 3QWRD 4DAGH 1K8IA 3D85B 2EO9A 4UFIA 5HYJB 3JTTA 1R5IA 1A7PH 4KWUA 4FN0A 2D4FA 3MV9B 4GBXA 5DJ0B 1FG2A 5DRNA 2ZSVA 4AIXA 1GOKA 4LLWA 2P8LA 3VXME 4ZUSB 1J1XH 4YDKL 1RU9H 2HFEA 3QUZA 4KKCC 1WTLA 5JR1H 5EBWA 4BFBD 4M24A 1QEWB 1AVAA 1DFBH 3Q2CA 3MBEB 1BZ7B 1MVFA 2VSDA 4IRJA 4HAGA 4LAQL 1CR9L 4Y5VA 4PCTA 3GMRB 4JFED 3SURA 3QDMB 1W9PA 5BOZG 4Q7NA 1C16A 3G5XA 3AMCA 3U4EB 1M7DB 2OTWA 1UG6A 3GXMA 1YN6B 5D1ZB 3G6AB 3WE6B 5DVKA 3PWPE 1LF1A 1ZB5A 1JWMB 3MBEC 3OTTA 3HAEA 3D3VE 2VUYA 3FJTA 4LXFA 1S3KH 1ZLUH 1HH9A 1PZ2A 1RUMH 2NY0D 4W6YB 3BESR 4XMPH 4ZS7L 3AZRA 2VZUA 4AEFA 4WW1B 2VKWA 1T4KB 3QNXA 5D1ZC 2F7OA 4G6FB 4NP4H 3OAZH 4GQRA 1O0VA 1LP9E 1NOWA 1C08B 2G9HA 1A3RH 3QIWB 1HH6B 5C09A 1JPSH 3OHXB 4BFIB 4M7LH 2XG9A 4DVRH 4PS4H 1QLEL 1EX0A 4L1DA 2R1XA 5IUSA 1MI5D 3IXTB 1NLDL 3IFOA 1SMOA 3LQZA 3QIWC 3IS1X 1AXSA 2H32A 2DSZA 1BM3L 1QA9B 3MRQB 5KTEH 2FJFB 4D6GA 4XH2B 5J12B 1UZ4A 3EYVA 4CVWA 2E7HA 5MEPA 3P3YA 3NTCL 2ZG3A 2IH3A 4XCYA 3G6JF 5D2LF 3CH9A 3HG2A 4HWZB 2WQ8A 2GT9B 3UETA 3GSUA 2HJKB 5J12C 1ZLWH 1CGTA 2PNDA 4P9ML 4PJFE 3ULUC 1XGYH 1AQMA 2QQLH 4L8DB 3HNTL 2XN9B 3U36B 1KCLA 3LD8B 4OI8A 1ZS2A 4HFWA 3GXNA 4PCSA 3FO9A 3W2DH 4JREB 1B3VA 1OTUD 3CIQA 5C08E 1I8IB 2BSSA 3MROB 1SZNA 2CBUA 3FO1A 4DK6A 5IHLB 1T0MA 3ALWA 4MSWA 3LD8C 5IW1B 2PWFA 4XC3L 2CIKA 2EZ0C 4TSAL 3ARDD 4JREC 4D0BB 3SGKA 3ULVL 4AIZB 3DVIA 4ETQB 2YZ1A 3LKQA 1BECA 2FLBT 3PXJA 4K9EH 4NO0A 5DYOA 2WVUA 3T65B 3DX7A 1VSCA 5FUCE 2AEPH 2YSSB 4UFMA 1JPGB 5JPMB 4B50A 5HPCA 1AIFB 3LPOA 4P2QE 2AJZB 5HYFA 1KEMH 1MQQA 3CC5A 4ALAL 5DFVD 2E7LC 4AH2A 4YAQB 5GS1B 2Z0BA 3OIHA 1MCKA 2G5BB 2W91A 3VWKD 4TUFA 4F2MA 2YC1B 4YHIB 3THML 3FB8B 3T0EA 4M8UA 4HA4A 3LXAA 1UADC 4YO0A 4R5EA 3V4UH 5T3XD 3QCVH 1UXSB 4PBWD 5GS1C 2ZXQA 3S3JA 4UINL 3DX6A 4GT7A 3ZTJH 3OGCA 1SBSH 3HUJF 1XCXA 3AICA 3SKMB 3W28A 1RZGB 3MLSH 5I1KL 2APXA 4R26H 2FRGP 1I1CA 1GVIA 2F1BA 5L2KD 5FUOH 2BNUB 4UIKH 2GITB 1C1EH 4N90D 3LKPA 2QHRL 4CU6A 1U92B 1ZVSA 4HU0A 3VI4F 2BFVL 4FFZH 4NFDA 3AIRA 3U46A 3VIKA 4U1NB 4RCAA 3MYJB 5DI8A 3WH7A 2XWJB 1GGBL 3UCRA 1O7AA 4I5BB 5F44A 3A3HA 1JAKA 3BIBX 3QWOA 4PJ7B 4QRPD 2FECL 4Y2OA 5DQ9B 2HTLC 1S9VA 4HV8A 1YNLL 3VO0A 3O2VH 1CFSB 1D7FA 1LGVA 3PJSB 4G6AD 1E27B 4HG4J 1U95A 3TTSA 2YWZA 3OX8B 5HJ3A 1AFVL 1KCSH 5FCSH 5D4QA 4WHCA 4I3RH 3S3SA 3BC9A 4L3EE 4NRZB 2BVEA 1CD8A 3EDFA 2VZVA 5ESAA 1CBGA 2YPLD 2DLHA 4I2XA 2FR4A 4OZHE 1BG9A 1NCDH 5IM7A 1EHLL 5AYIA 2P43B 4P2CG 3J7HA 4I9WD 1S9WA 3L7EA 3OG2A 3VIPA 4W4OC 5HHNA 4X6DF 4N5EC 2I9LB 4HQQL 3HG1D 1JL8A 1MW1A 3WYRA 2MSPA 4LLYA 1T1YA 5DGQA 4DOHB 1TVPA 2DJSA 4WWKD 1TZIB 1R34A 2XN0A 2H41A 5DJCB 3SCMD 5JORB 2AK4A 2YRLA 4YHOH 2GCYA 3KLKA 1FYTD 3FN9A 2ADJA 4N0UB 4P3DB 4YDKH 1BHGA 3MRRA 2HMIC 2ATKB 2UY5A 1IT9L 5IK3B 4LYRA 4FABL 1J1OL 4FQXD 1ADQA 2Z92A 2VIRB 1GSMA 4D0CB 4LDOB 4R7DA 5FYKE 2NYYC 2XWTB 2OZ4A 1OD7A 4LAQH 1AP2B 2X70A 5B38G 1CR9H 3BAWA 3L4TA 2H26A 2BX5A 3MNVA 5F9OL 5CMAA 1UH4A 4KAQL 3LV3A 4M1CD 1V02E 4RAUB 1U3HD 4L1HA 3LQAC 3HR5A 3BQUB 4TVPE 1XAUA 4NHCL 1P9MC 4ZS7H 1KNOB 1J8HB 3QNYA 1MVYA 1I1XA 4K2UL 3RM8A 3W39B 4IHOA 1DWFM 4FS0A 4GMSL 3RJXA 5F7FA 1R33A 2NMSA 3BQUC 4S1QL 4N0YL 3D4ZA 2M26A 3CCHA 3H7BB 1UWUA 1QLEH 1RHHB 2X4QA 5CPQA 2F61A 3SUUA 5KS9E 5D7JB 4CJ1A 5HHQA 1NLDH 1E4LA 2VDNL 1QLRB 2DLFL 3KS0H 5GSVB 3FXYA 4Z77A 1BM3H 4I77L 3R0MA 1XCTA 3HHRB 4XI5D 1EFXD 4KKLC 5D7JC 3AQUA 3NTCH 1U58B 5D7IF 1FNGB 4WV1A 3K81A 3VXSD 1C12A 3FOLA 2CITA 3UYOD 5MEQB 3VRIB 2FGLA 2EYRA 1EXUA 1KTBA 5L8JB 1P6FA 2ZOXA 4HKZA 1CWVA 4MMXC 3QFJB 2UYLA 5I8OL 3HC4L 5C9KA 1BJ1J 1HDMA 2DM7A 3HRZA 3OG4B 3KEHA 2XFXA 3MJ7B 3HC0B 2GJ6A 1FVDB 3HNTH 1H0GA 1XD1A 2NY6B 3BP5B 2XTJE 1US3A 3QUMA 2FDMA 3WN5A 1V8HA 3TBVA 5I8EB 5FO8B 3TM6A 2XY2A 3BXNB 3CTTA 5HHPA 3F7PC 2DMCA 1UACL 3NMEA 1EEQA 2NY6C 5KSAA 3MRJB 4XC3H 1FFOA 1CIDA 4TSAH 1KUMA 2CDGA 1VIWA 1B0GA 4C56E 3ULVH 2P5EB 4JANA 4NFBA 5DDHA 1A6AB 3B4NA 5E2WL 5JDSA 1R8LA 3AXXA 3EMQA 4PYHA 3ARFA 1XGTB 4CBPA 1T5WB 4OIAA 4WHTA 2W92A 2W4XA 1Q9KB 1ITXA 3G6JB 3P9LA 1K8DB 1NEZA 2P7TA 1UKOA 4JGMA 1WP6A 4BSVB 4EUPB 1G84A 5EPMB 4PLNC 3OJMB 3MRPB 1LMKA 1QRNE 3BWAA 4F7PB 3KL0A 4ALAH 1BBJB 5K33A 1KWKA 3D3AA 2FH8A 4BELD 3BVUA 3RIAK 1QNZL 5ID1B 3C5JA 3THMH 3ZHKA 3GBDA 3DXAE 4FG6C 4CN4A 3I75B 2QR0B 3DNKA 1MW3A 4KUCD 3VFMB 2O9OA 2J77A 4UINH 5EBGA 5L2JB 1YEEL 1NUGA 2IAMA 3FRUB 5I1KH 3P9MA 3MRKA 4I4WB 2FGZA 2PWGA 1TQBB 3MOAL 3QO0B 1U41A 4S3JA 2EECA 5M95B 4K94L 1S7RB 2QHRH 4ELME 4FHBD 4C57C 3WFEL 2BFVH 2ORBL 3WS6C 5T1KD 2IGTA 3TYGL 3AI0A 1P1ZA 1OGGA 1GGBH 4ODSL 4ODXA 2CRIA 1I7TB 1SM3L 1BIIA 3IDIB 2F8QA 1AGCA 1LD9B 1HEZB 3QOKA 3CJJA 1KJ2B 1YNLH 1H5BA 2VLKD 5CILL 2Y06L 4ZOEA 3SY0B 3WNLA 1HHKB 4XPHL 3RDTD 4Q0XL 2UY2A 4F9PC 2W0LA 5B3NA 3QHMA 4XTRC 4JPIB 1AFVH 3IRZA 5JOPD 5E9DB 1UQSA 1G7JA 3DUUB 5GRJL 2ADGB 2YUWA 2EEXA 2DQTL 3MLVL 1C8YA 2DTML 4S1DC 2WVTA 1FL6A 1E71M 3HUJB 4Y88A 5I2IA 1EHLH 4PV8A 2VJXA 1PG7X 5D1XA 2E9JA 2K3TA 2WNWA 1HVXA 1A1NB 1EA9C 3SUTA 4HQQH 3KL5A 5DRZB 4PUEA 1KB5L 5JHDA 6TAAA 4KK6D 2Z8VC 2JCCA 3TBWB 1ZE3C 5GPRA 5ITBL 3FAXA 3JSSA 4XMLL 1E4MM 1PZ5B 5SWSE 5F70A 5EC2B 3QAZB 1IT9H 5J6HA 4FABH 1J1OH 5A43C 1DQJA 4PRIE 3JBG7 5EZLA 3IGAB 4UCFA 4BQ3A 1T0NA 4NHUA 3LN5A 3FQRA 4Q2ZA 3S5YA 1C8QA 3QAZC 4QY8A 4JY4A 1QWNA 2WCSA 3VFUA 5IBLC 5F9OH 3FQWA 3V0VA 1DEEB 4KAQH 1MLBA 1UENA 3IJ9A 4QGTA 4OCNC 1FGVL 3BIKA 5T33L 2QSQA 2OZ4L 4GJTB 1NSNL 3DETC 5HDRA 4NHCH 3RIFK 4L8BA 4FLOA 4ZPTB 3CLWA 2C4FT 2A1WL 4V1DB 3Q3GB 4K2UH 2OYPA 4G42A 4JJHA 1PVHA 5IF0B 4GMSH 3BX7C 5CJQL 4S3KA 3SKOA 3TOPA 1EEYB 1GJWA 3DVNA 1XGZA 3HAEH 4S1QH 1F8TL 4N0YH 1JNDA 4NKDB 5ISZB 2BNRE 2EYTA 4QNPF 1BOGA 1V0MA 2HVKB 1FG9C 4OZGB 4Y4KD 4E9LA 1BJ8A 4Y5YB 3B2VL 2VDNH 2NXZB 4KRUA 2DLFH 1M01A 2WCGA 1KT2A 1M53A 3HPLA 2P1YA 4I77H 3WBDA 4AYSA 3U30B 4YHLL 3WMCA 4Y5YC 5EG6C 5BQ7A 1KENL 1RZ8B 4JRXE 1W0WB 2NXZC 3FZUD 1OD9A 3ZKXB 1XC6A 1W8NA 1ZANL 1EUUA 3QJFB 4WSKA 1J1PL 2H32H 3BHBA 1JHTB 3U30C 3VFGL 12E8L 2F1AA 1JPST 3PV6B 4LQFL 1HSBA 5I8OH 3HC4H 5IHBA 7TAAA 4CAGA 4M7LT 1HCVA 2YD6A 3VD9A 1CFTA 2ICWI 3ZKXC 1QUNA 4PJBE 3CLEL 4Z2IA 1MQKL 1GUVA 3A5VA 1A2YB 3GNRA 1YPZB 1A6TB 3T0AA 2VXVL 3VG9B 3MUGA 1NGQL 1UR9A 2KZWA 1ZS8B 4MADA 4ZENA 3WH9A 1GCYA 1JXKA 1QPXA 1UACH 3A4AA 4QHLB 3DUSB 1UZ6F 4XX1G 2D3VA 2GDVA 3AHYA 1I1AD 2JJSA 5D7SL 5I8CB 3VG9C 4RQQB 4ZUUA 3QUML 3ARGA 3BUTA 5E2WH 5BCAA 1V03A 3BGAA 5FOJA 5D72L 4ZAKA 2DI9A 4MX7A 5TF1L 5C0JB 5D7IB 1HWWA 1TTFA 2Y9RT 3WIFA 3MV8B 3PWLA 3T2NL 3ZDXE 2WWDA 1HJQA 3D2UA 2WUCL 3L9RB 3ZE0E 4OFYA 3MRDB 5F1NA 1BVLA 3K74B 4IRSA 4QAWA 2XM1A 3ZE1F 2R2HA 2J8OA 1QNZH 1E5JA 3X17A 3KNBB 5D2NE 1EV2E 4NO3A 1JBJA 3VXPB 1DVFA 2MJWA 1GOMA 2XVKA 1YEEH 4JFXB 4XHQA 3X12A 2DQJL 4GBXD 3VSTA 4HK3J 1OW0C 4X6CF 3KE0A 3MOAH 2XPGA 1RIHL 3L3GA 4K8RD 3B9KA 4JKMA 4K94H 1MRDL 4F57L 2GUOB 3C9NA 1XH1A 4B7LA 1HHJB 4TX6A 2Z93B 3WFEH 2ORBH 4Y2DB 4LCUA 4KVCL 1DEDA 5IVXE 1VEMA 1WK0A 1D2KA 3T2QA 3TYGH 4ODSH 5LAXA 2A83B 4LSQL 4WLCA 1SM3H 1PW3A 2YPVL 4JHZA 4J6RL 3LY6A 2DEPA 4MQ7A 2AV1B 1MXDA 4Y2DC 1E0VA 5KAQF 2IQAA 5CILH 1BF2A 1W2KT 2Y06H 3GSRB 1N0LA 3RP1A 3MUZ1 4XPHH 4Q0XH 3FFDB 3SGEH 3E6FB 4GRWH 1FV1B 5A2LH 4FXKB 2NX5A 4GLRH 1AR1D 5BXTA 5H8DA 5GRJH 3QFJD 2DQTH 3FRPG 5F9JA 3VWJA 3QXVA 2NY3D 3MLVH 2DTMH 5C7XL 1CE1L 2EXWD 5C8JB 3WY3A 1LLOA 3WLWD 2X2JA 1VGEL 3BP6B 3BOVA 4NRSA 1FHGA 4KTDL 3TFKD 3L3JA 4JJ5A 2MKWA 1X44A 4NDMB 1KB5H 3WUWA 4JAMB 4HOXA 5C09D 3W6MA 5GNZA 1FDLL 5ITBH 4F37F 4AL8L 1U2HA 1FJ1A 4XMLH 1IGTB 3ME0A 3VCLB 4QLLA 4NYLB 4RDQG 3MRIA 1KXQA 1C91A 4AIOA 4OT1L 3QEQA 4P8VA 3FTGA 4JHOA 4PMYA 2RFXB 4POYA 4PJGF 1DLHB 4DM2A 1HNFA 3VRLE 5EBMB 5EFIA 3WS3B 1HP4A 4FRWA 5CBEB 5K59E 4LYPA 3ZR6A 4WNQA 2CDFA 1KTLB 3HN3A 5ICXA 2J8FA 3LH2L 2YWYA 3AZSA 5C0BB 2NW0A 4KI5C 1FGVH 3CK0L 4OF6A 4W8AA 5T33H 1ZHKA 2OZ4H 3N9KA 4I0KA 4P2RE 3R8BB 3D9AL 3FFCD 5AYQA 2J8HA 2A1WH 2GSGA 3QCTL 2WBGA 3NAAL 5BMFH 4HS8L 3MRMB 1BYDA 2XXMB 1SYSA 5CJQH 3U5YA 1UZ8B 1F8TH 1KGCD 4GKNA 4LLMB 1NCBL 3H9SA 2P5WB 3QIBA 4XMKH 3U0TB 2FO1A 4YDIL 3KPPA 5MEOB 4Q74A 5E0FA 1E6XM 4PIRF 1CZ8L 3VILA 1QBLL 1KXVC 4WCYL 3WQ5A 1JG9A 4NT6A 4DKEL 3B2VH 2OYKA 2OWXA 1Q9LA 4NO0D 4OLZL 4UTFA 3LMJH 5D96B 1MJUL 4JFQA 4PJXF 3LIZL 2CLRA 1GH7A 2YRPA 4Q9BA 3UG3A 3KHOA 4AY0A 1CEOA 4YHLH 4Y4FD 4HK0A 4PRNA 1KENH 3TIEB 4X80L 3RZCD 2BC4B 1ZANH 1KULA 2ZX8A 2Z35A 1KBKA 1MCCA 2ZOKA 4LIQL 5D96C 2ITCA 1J1PH 2X40A 2EC9U 3VFGH 12E8H 4LQFH 3TYFA 3MRCA 4UIMA 1DE4B 4OFVA 1GW1A 3D85A 3GMLB 1OWRM 3CLEH 4ENEC 5BYWA 1S7QA 2J88L 1MQKH 4KRMB 4MAYB 4LHUB 4WO4D 4PJ5B 5DJ0A 3KLAB 2VXVH 4HS6B 1NGQH 1NDMB 3P73A 4I18B 1UKSA 4ZUSA 1R87A 4D9QE 3BJLA 4WTZA 2P42B 4PV9B 4MAYC 1YY8B 3N1QC 3WXVL 5D7SH 5F3BB 5B4MD 4HSQA 5JA9A 4I18C 3QUMH 5GNXA 3MBEA 1BZ7A 5FKYA 1KCRL 5D72H 2R1YA 3GMRA 5TF1H 3QDMA 3HE6A 4KC3B 4R96B 5BXSA 3RWCB 3U4EA 2VX4A 1M7DA 1YN6A 1BYBA 1UH2A 3T2NH 3WE6A 4ZOCA 4C83A 1XIWB 1TVBA 4N0CD 4PJDE 2WUCH 3GGWB 1KCUL 2VQ1B 3RHWK 3ULVE 4HUXB 5D9NA 2V6HA 4V2XA 1MUJB 4W87A 2VZ3A 1F00I 5JHLL 1U33A 1CD1B 4YIQB 4X8XA 4IMLA 4LLQB 1T21A 4WW1A 2BVUA 2D31B 1XIWC 2C3HA 3N85L 3TJHD 1FZMB 5C0NC 4QRUB 2K9UA 3QR2A 1C08A 2P44B 3Q5TA 3QIWA 4YEEA 2FECI 2DQJH 2D7TL 4MVBC 4D9LL 3OHXA 4BFIA 2RQ8A 2AK4D 2OL3B 1AKJB 1RIHH 1F6AA 4KMTL 1CFBA 5A8MA 1SR0A 2FJHB 2DWEB 1MRDH 2DQCL 4F57H 1IAMA 5A2KH 1NC4D 2MMXA 1HJVA 5DGRA 2HTKC 1RK0B 4G6JL 3VNYA 1TVNA 2Y07L 3Q1SL 4KVCH 1K6AA 2OP4L 1QA9A 1CXKA 3FOMB 1QBBA 2IFGA 4XH2A 4LSQH 4U7SA 2C5DC 2YPVH 2Y36L 4IS6A 4TNWF 4J6RH 2O5ZL 3RVXC 4QTHB 1ISWA 1DQML 5KBNC 1WCQA 4YJZL 2HLFD 1WFUA 3DHUA 2VQUA 1BZQK 1PG7W 2HJKA 1KGWA 1TVHB 5IFPA 4ZODA 5FL0A 4TN9A 3GNML 1ZJBA 1JK8B 2G3MA 3FCTB 4L8DA 2XN9A 3U36A 1EIBA 2DKUA 1CE1H 5C7XH 2BVPA 1XSJA 3QHZL 3VFTB 3BDBA 1E56A 1VGEH 5IGXL 3MLYL 4KTDH 4HPHA 1I8IA 1BD2B 3MROA 4ZTOL 4X6CB 3AYRA 2APBA 4EI6B 3KPRB 5IW1A 3QRFM 1FDLH 4OBRA 4AL8H 4D0BA 3P0GB 4ZO8A 3EDJA 2EEAA 1MCJA 3CFKB 5JLZB 4X6EB 2KQMA 4OT1H 3T65A 5D6CA 1WCGA 3IJHB 1JPGA 5EUOB 2ESVD 2YHGA 4HGMA 1AIFA 4OQTL 1QO3B 1YEIL 1E55A 1Q94B 4K3DL 1VKXB 3KG5A 3LRMA 4P8XA 3V5DA 4KKBD 2YC1A 5GS0C 3LH2H 5J13B 1HINL 3VINA 5GIRA 1EHXA 4NRYA 5IHUL 5CEZL 6CGTA 5CHNB 3CK0H 4E41D 5HY9B 5K9OB 1OL0A 5DJXA 1UXSA 5HI3C 2D3LA 3EJUA 3D9AH 3O45B 3UTTE 4H8HA 2PR4L 1QOXA 5J13C 3QCTH 5EOTA 3SKMA 3NAAH 1RZGA 5EFDA 4HS8H 5LGKA 1G7QA 5HD8C 2WBJA 2DIEA 2ZUSA 3RWDB 4TUOA 2GITA 1NCBH 1A0QL 4YDIH 1CTOA 5KSAD 3NPSB 1MCBA 1QHOA 1UFUA 4U1NA 3C2AL 1CZ8H 3MV7D 1LK3L 1QBLH 3MYJA 3WY1A 4WCYH 3PUCA 4DKEH 4LKXB 1QSZA 3MS8A 1KGXA 1NAMB 5BZDB 3CX2A 2G75A 4PJ7A 5DMKB 4OLZH 1CFSA 1MJUH 4QCEA 3NPSC 4ZMAT 3LIZH 1BVKB 2HJLA 2W65B 3PJSA 1E27A 3RNKB 4HS3B 3OX8A 4X80H 1INQB 4XPBL 2DIJA 3ZO0A 5JIHA 2HP4A 2F8VA 4AW7A 3U57A 3C8DA 4NRZA 4LIQH 3S5LB 4FTVB 4ERSL 25C8L 4XXDB 2JJTC 4CVUA 2Y6SD 1A4JA 3KLHD 2ZX5A 4GRLD 4ODUA 5I66B 2I9LA 1KC5L 2J88H 2XKNB 2IBBA 5IHRA 1TZIA 3KXFD 2W59A 5JORA 3WF1A 3DBXA 1X5GA 4O58L 4N0UA 3GKWL 1ZA3B 1DL7L 2J8UE 4JY6A 2CKRA 2NY7L 3IT8D 4PJ8B 4XAWL 3HG5A 3WXVH 5A3HA 1IFHL 2WAHA 2J47A 2VIRA 1WSST 4D0CA 3SCQA 4PJXB 2YA2A 2H2PC 1AP2A 1KCRH 2YIHA 4Z0XB 2X4PB 1VFFA 1S9KC 1EFQA 1RJZA 2JELL 1NC2A 4PJ8C 2EDTA 2YDSA 1NQBA 3KPSA 1SY6L 2OXHA 4P4KA 2ZUWA 1P9MA 3QUXD 4IOSD 5IG7A 4Z2JA 1E73M 1VFMA 4O51B 5CIPB 1KCUH 2HT3C 3BN3B 2QLVB 5D6DC 3BQUA 4JO1L 5HHME 2WHMA 3SBWA 4J2XA 5JHLH 1YMME 2GSIA 1J8HA 4JPVL 4YBLB 4NQTA 4JO2L 1V3HA 1WF5A 4BQ6A 3LHPL 3N85H 3NZ8A 2CKNA 4MPKA 3MR9B 3SGJC 1XF4B 5C6TL 5LA1A 5JHDD 4PG2C 4B3KA 2QEJA 2D7TH 4ZYKB 3RKPA 3F12B 4D9LH 3GRWA 4YBLC 3H7BA 2DBJA 5EZJB 3WFCL 2ADIA 4KMTH 1RHHA 4ZFMA 3PP3K 3W4RA 5I79A 2DQCH 4GLRI 4NQCA 1QLRA 3BVXA 4X6BA 4KDWA 5GSVA 3LXBA 4RSVA 3S4SB 4G6JH 1AO7B 4ATWA 4M81A 2Y07H 3Q1SH 1MWAB 4IM8A 3V6ZA 2OP4H 1OCQA 1G6RA 5DZLA 1EQCA 5EULV 5I1JL 3A21A 2Q76B 3T0EE 5HI4D 2CD0A 3DROB 2Y36H 3VDHA 1U58A 2ZNXA 1FNGA 3QDHA 1DQMH 2WPGA 1U8MB 3HZYB 5MEQA 4L4JA 4P46B 3VRIA 3WF2A 4HKXA 3MXWL 3PL6D 3VXNA 3CH8A 4P5TB 1JNJA 3GNMH 3GJFB 3HC0A 2OJZL 3H7LA 3O11B 1FVDA 5JO5B 3ROOB 3TJEL 3ULUL 1S5IL 4P46C 5I76B 4OLUL 2DH3A 2B39A 3BP5A 1JD9A 3QHZH 4PEEA 2I25N 5I8EA 5IGXH 4PJ5D 3MLYH 4U05A 4P5TC 5C0AB 3DDFA 1V6UA 5A1AA 4ZTOH 4GRWE 1NGXA 2VISB 1KTDB 3QQ9D 4N8VG 5C8BB 1LG2A 1ZBVA 5EC1B 3E6HB 3MRJA 4AIEA 3WSUA 5F6HI 4JZOB 2P5EA 2EPNA 4M9PA 1XGTA 4MLSA 3OG6B 1VHPA 2HN7B 1Q9KA 3GIZL 4FXLA 4M4RA 5IB1B 1K8DA 4NQSB 3BEWA 2V2WB 4OQTH 4EUPA 5EPMA 1YEIH 4I2XE 3KYKL 4K3DH 3RL2B 1B0RB 4F7PA 3JUZA 2YD5A 3QI9D 2HKHL 5ID1A 5DRXB 5EH1A 1HINH 1WLHA 3THDA 3I75A 5IHUH 5D5MF 5CEZH 3VH8G 4J8RA 4X5WB 4U2ZA 1WBZB 2DD8L 1Q38A 4ZUVB 5L2JA 2PB1A 2PR4H 2PBGA 5DMYA 3HE7B 3GH7A 2AXHA 1UR1A 3UJTL 3WS6A 2PETA 3NPZB 1FH7A 1GZQA 4I4WA 4JL1A 3QO0A 1HHGB 3F65A 1XGPB 1U3JA 2GDUA 1S7RA 1OM3L 1A0QH 3HE7C 2GK0B 4M93B 5FA4A 3D18B 2WIIB 3C2AH 4LNRB 1RZJC 1LK3H 2X1WL 3NACL 3ARGD 1TZHB 5FB8B 5FHBL 1I7TA 3QULB 3IDIA 3VDBA 2XA8L 1LD9A 5F6IB 4LVNB 1HKFA 3L4UA 4P7RA 4M93C 1JFXA 1KJ2A 3G08B 3SY0A 4C4KO 4I3SL 2QQQA 3S6CA 3E3QC 3BXWA 4GUPB 4JPIA 1U6AL 1IBGL 4KV5E 5ESQB 3D2UD 5F6IC 4LVNC 4XPBH 5E9DA 1BFOB 4UQ9A 3DUUA 2ADGA 5D9MA 3RGVB 1F6FB 5HDOA 3PGCB 3MRFB 5KW9L 5HHXL 1FL3B 3GBML 3RWHA 2Z8SA 2X7LB 4ATDA 4MDIB 2AGJL 4CW1B 4ERSH 1EJ6A 3U82B 3P11L 3QZWB 25C8H 4FLSA 3OJVC 1DVFD 2B1AL 2F54B 1BJMA 2JJVA 4W6XB 5TQ2L 1TJGL 3RGVC 1UHVA 1WZMA 5L6YL 1KC5H 1BD2D 4P5MB 5DRZA 1QFUL 2WXDM 1EO7A 2F53D 3MGOB 5J57B 5ICYB 2BOBB 3WFDL 5A3ID 2M2DA 4OKDA 3TBWA 2J12B 1KBBA 1A3HA 3MJ9L 4O58H 1N64L 3GKWH 1QSFB 1UD4A 2XFFA 9CGTA 1DL7H 5EC2A 1H5VA 2XTLA 4MXWL 2NY7H 1YDPA 1KLUB 1BFSA 4XAWH 1IFHH 2BVTA 3BW9B 1D6VL 4PBVC 3U5UA 1GGYA 1OQXA 2YL9A 5F9WB 3NH7L 1JNLL 3GMOA 4XT1C 2JELH 3IU3B 4UZUA 4E0RA 1SY6H 2GJ6E 4TNWK 2RCSL 2FEDC 1OGAB 4LEOB 2WNGA 5F9WC 5GS2H 4KRTA 5DD6A 2XZZA 3MOBL 3MXVL 5I1IL 5IVZA 4MHHI 4JO1H 3S7GA 3U7YL 3LQAL 2CBJA 1ACYL 1O5DT 4TSBL 3O3UN 3S6TA 4ZPTA 4JPVH 3PDGA 3Q3GA 4NC1E 4TYUA 4JO2H 3SO5A 4URIA 3LHPH 5INDB 1XEDA 3A6OA 1RSFA 1EEYA 4H8UA 4CDGC 5C6TH 3MLRL 1R6VA 2BRRL 4EVNA 4N1EA 2HVKA 4OZGA 5DJZB 5EIIA 4RGND 2B1HL 1F3RB 3EO1A 3WFCH 4M9OA 5BOPA 4ZNEA 3FHAA 5EU6D 3T77B 4HA3A 2O93L 2X4TA 4OFDA 4MNGB 3AVEA 1FZOB 3E2HB 2EAEA 1CL7L 3NCEB 1U8IA 5I1JH 3GRWL 2D73A 2EDFA 1DBKL 3NOIA 1EEUA 3WKZA 2WCAA 2R2EB 4V2BA 1YEDA 3CMOL 1Q6CA 1KXHA 1D5XA 4MDOA 4R2GD 3E2HC 1M1SA 4ZEPA 1NWUA 3RPMA 4H2CA 2WW8A 3MXWH 4EN3D 1JHTA 5F88B 3PV6A 2GK2A 2HYMA 3WNMA 1GORA 2OJZH 4UQ2B 3TJEH 3ULUH 2FLRT 1S5IH 4OLUH 4OZIB 1YPZA 1J0JA 1ZS8A 1A9BB 3U7BA 4Y19A 4PGBB 1BWMA 5DD1L 1UJ3B 3GSNB 1CDUA 2E0PA 3EO0B 1YEFL 3TZVB 3EJSA 4RE3A 4QHLA 2QADD 3H9SD 4QOKE 3T4YA 1NM9A 3DUSA 3C87A 3L5IA 4JPWL 2VLRB 1AQKL 2CQVA 1R3HB 2YPKA 4HGWA 4RQQA 1JYWA 1WUNT 4JPKL 5TPWL 4CL7A 1P7QD 5GRZA 4WFGE 1UJ3C 4R0LB 3TZVC 4ONFL 2BERA 4HOWA 4ZO9A 3ZDZE 5D7IA 5C0JA 3GIZH 3FB5B 3OKDB 1HQRB 4PYGA 4EJ1C 4MJIB 4UOZA 5DEGA 3MV8A 1U2CA 2DSUA 1H15A 1JDAA 4NRRA 3KYKH 2VDOL 3SCSA 2V5YA 3L9RA 4R0LC 3BZEB 1JNNL 3AXLB 3MRDA 4K7FB 4JB9L 4B9ZA 3MZTA 4P59L 2HKHH 3CAFA 3EYOB 1J87A 5FV2A 4XP9H 1H3XA 1KG0A 3VDCA 1AXIB 3KNBA 1WE5A 3MA7A 2JCCE 1NANI 2DD8H 4KHXL 3DJ9A 2DSKA 4LCWA 1PBGA 4JFXA 2VO5A 3UJTH 2H3NB 1PQZB 4JDTL 5D7KD 1MREL 4Y0GA 4W4NA 3RCNA 4XZWA 3I6GB 1MF2L 3EOAB 2XNAA 4IMKC 3FMGL 4LF3B 3FONB 2GUOA 4HIIB 1U91B 1ZT1A 1OM3H 1PS3A 5M94B 5D7LE 2Z93A 1OTTC 4Y2DA 1XH2A 3BAJA 2X4SB 1CICD 3WXWL