8CHOA

Crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and enzyme mechanism of Delta 5-3-ketosteroid isomerase from Pseudomonas testosteroni.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
total genus 34
structure length 125
sequence length 125
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1998-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 8choA00
2R4IA 4K1UA 1JN5A 2XRXB 1CQSA 3B4OA 3MHEA 3F9SA 4OUQA 2GBWB 3SOYA 2HMNB 1K41A 4H3UA 4J8TA 3FKAA 1WQLB 1O7WB 2HMOB 3E99A 2JQ5A 3K0ZA 5EVHA 1OUNA 4WYKB 2W2CA 4HM8B 3MG2A 2B1XB 4N3VA 1W6YA 1IDPA 2YFIB 2HMLB 5IG3A 2STDA 3GRDA 1W02A 1JKGB 3G0KA 3ROBA 4L8OA 1NWWA 1OF5A 2CHCA 3JUMA 3LYGA 4IIAA 3VGNA 1BUQA 1GY7A 3H3HA 4XB5A 3EBTA 5KP4A 2BMQB 2XR8B 3B8LA 3CNMA 3GZYB 5G2GA 8CHOA 3FGYA 4X2OA 1OHPA 2GEXA 3EX9A 1STDA 1ASKA 5FW5A 1GS3A 3NHXA 1O7HB 1QMAA 1DMNA 2OWPA 5BVBA 1TP6A 5KP1A 3FSDA 5KP3A 3JUQA 1OGXA 1E97A 3Q90A 2Z7AA 3FH1A 4XDWA 3HK4A 5IENA 3DXOA 2Z76A 3F40A 1A2KA 3F14A 3F7XA 3OV4A 4HZBB 4Q53A 1ZX2A 3LZAA 5AIGA 5BXQA 3MKIA 3OX9A 4OVMA 4HM1B 1OPYA 3NXJA 3K7CA 4FCMA 3GZBA 4HJLB 2BMRB 3WMDA 4GB5A 5AEUB 6STDA 2F98A 3KKGA 4LEHA 1QJGA 2CKFB 4RZMA 1OGZA 3IPTA 1Q40A 3ER7A 2GEYA 1AR0A 2HMKB 1EG9B 5IERA 3EQQB 5STDA 3DUKA 1OHSA 2RCDA 3FZWA 2QGUA 3NV0A 2I9WA 3G16A 4HM6B 5D83A 1JB4A 2B24B 3F8XA 3JUPA 4PEJA 3T8NA 4HVNA 2XSHB 4I4KA 4J9AA 1Z1SA 4LGQA 3EBYA 3EN8A 3B7CA 3OWUA 5DRVA 3UJMA 5JPUA 2F86B 3NUVA 1OCVA 1C7HA 7STDA 1UUWB 5D82A 1GY5A 3RGRA 5IG4A 1W01A 3EN1B 3SEDA 2YFLB 1JKGA 3DM8A 2GBXB 5AIHA 5DREA 1NDOB 4KVHA 2GXFA 3NV0B 3NM2A 4XBYA 1S5AA 3BB9A 1NU3A 3BLZA 3B4PA 5AI1A 3T8UA 1E3VA 5D81A 4XDVA 3MG1A 4CDLA 1OH0A 3DZLA 5AIIA 3GWRA 3EF8A 3CPOA 4HM2B 1VZZA 4L8PA 1ZO2A 4HZ9B 5IEPA 1JB5A 4HM0B 3H51A 1JB2A 1GY6A 1ULIB 1OF5B 2A15A 3FF0A 4HM3B 3EJVA 2INXA 3HZPA 3MYTA 4WP5A 3M8CA 4WYKA 4XBXA 3OWYA 2IMJA 5IG5A 3DMCA 3F7SA 4ORLA 5IEOA 3GZXB 2BMOB 4STDA 1TUHA 4XBTA 4FCJA 5TGNA 3JUNA 3JUOA 4R9LA 5CLKA 1DMMA 3UNLA 3D9RA 1E3RA 2XSOB 4HM5B 1W00A 3MG3A 3KE7A 3EC9A 3NBRA 4MJDA 5CXOA 4L7KA 2RGQA 3SOAA 2RFRA 1HKXA 1DMQA 2Z77A 2PZVA 1GYBA 3CNXA 3I0YA 5CF1A 3KZTA 1O7GB 4LMIA 4HKVB 2YFJB 4XM4A 3S5CA 1Q40B 2BNGA 3MSOA 5AEWB 1ULJB 2K54A 4X2HA 4R9KA 2F99A 3VSYA 3RGAA 3OXAA 1Q42A 2HMJB 1JN5B 1O7NB 3G8ZA 1ISKA 1U5OA 3EHCA 1O7MB 3HX8A 3FLJA 1UUVB 3ECFA 3STDA 5CF2A 4WWUC 4HM4B 3FF2A 3KSPA 4R1KA 4K1VA 5HGRA 5IF6A 5JPPA 1O7PB 5AIFA 1SJWA 3A76A 3GZRA 5CK6A 2QIYA 3F8HA 4U13A 3CU3A 5IG0A 2HMMB 2UX0A 1OHOA 4HM7B 3OWSA 1EA2A
chains in the Genus database with same CATH superfamily
1YGWA 1RRLA 4K1UA 1JN5A 2XRXB 1CQSA 2MC8A 3DGYA 3F9SA 1QAFA 1RGAA 4GSPA 2RSXA 2OTJ3 1OUNA 1GMPA 2W56A 2O3OA 1W6YA 2E2VA 1IDPA 3IJEB 2YFIB 3D5IA 3LTDA 2STDA 5IG3A 4GL6A 2QA43 2BO9B 1HYFA 3ROBA 3CC73 1NWWA 1OF5A 3JUMA 4IIAA 1NB5I 1RCLA 3H3HA 5KP4A 2BMQB 2Y73A 3PCSA 1LRAA 3FGYA 1ASKA 1N8QA 2BIRA 1M9GA 4RNTA 1BSCA 1DMNA 3NX0A 3BIRA 2BHMA 1OGXA 2CFLA 1JBTA 5IENA 1BNEA 1ROAA 1YGEA 1ZX2A 1ZS7A 3WOEB 3CCQ3 4OVMA 1RSNA 4HBRA 1S723 4CJNA 1TFKA 5ELJA 2H0IA 3GZBA 2BMRB 1YJW3 2RBIA 3HOHA 3U97A 4RZMA 2AADA 3IPTA 1Q40A 2CFWA 1UI8A 2GEYA 3LTAA 3X42A 3AGOA 2ML6A 3NBJA 4FCZA 3DUKA 1BRSA 3SX1A 4NPBA 2KXGA 1TRQA 3FZWA 5D83A 1HZ1A 3G16A 3PS8A 1PU4A 4PEJA 2B24B 1BOXA 2E2TA 2F4YA 3NM7A 4HVNA 4J9AA 3T8NA 4BL3A 1Z1SA 1VQN3 1I70A 3EBYA 1IVWA 5JPUA 1KSIA 1JJ22 1NO3A 3WR2A 1I0VA 1GY5A 4JF8A 3AMOB 1TFOA 3OW22 1X1YA 3EN1B 3KSED 4ZM8A 1WMOA 1N8R4 2CIUA 1C54A 1NDOB 1JZOA 4FMCA 1BANA 2CG1A 1NU3A 3B4PA 4KT3B 3D79A 4EYCA 1BNFA 5M18A 1B2UA 2W56B 1TTOA 9RNTA 3CCJ3 3DZLA 1JBSA 3EF8A 1VZZA 1MWUA 4HZ9B 6RNTA 4JRFA 4HM0B 3H51A 1RLSA 1DVDA 1FW7A 3DGMA 1W2B2 4HM3B 4WYKA 4WP5A 3WODG 3HZPA 1QVG2 3DGNA 1X1UA 1IYYA 5IG5A 3TDGA 3DMCA 1K28A 3F7SA 4ORLA 5GSPA 2OQEA 3GZXB 2BMOB 1Y4KA 4O8SA 1RJOA 4FCJA 3WDGB 3JUNA 3S28A 3DY5A 4CCVA 1W2ZA 1VQQA 4MMYB 1DMMA 1UGIA 3PCRA 4HM5B 1W00A 3MG3A 1IQXA 3NBRA 2V1LA 1I3FA 2GU1A 1FYSA 4MJDA 3EB8A 1GYBA 2W6JH 3I0YA 5CF1A 5IW9A 1A67A 5EEOA 4N6TA 1D6ZA 1Q40B 2PNCA 1ULJB 2K54A 1RGLA 2F5WA 2W03A 2IUKA 1ISKA 3G4S3 3CCR3 4BU4A 1BNSA 3PXMA 4N6UA 5CF2A 4WWUC 4HOHA 5HGRA 5JPPA 1I2GA 2WGQA 3GZRA 2QIYA 3PYJA 2WGOA 2E2UA 2R4IA 1UUGB 2KF5A 3B4OA 1AV4A 1AVKA 2FGTA 4J8TA 1K41A 3S29A 1WQLB 1IT8A 2HMOB 3E99A 2JQ5A 3K0ZA 4HM8B 2B1XB 2CG0A 4MMXB 5JBSA 1GD4A 2Y74A 1N9EA 2D1WA 2OOVA 2J8XB 4I5QA 1JZDA 3QRDA 3CCV3 1MWSA 1GY7A 2W9QA 2ZDJA 3EBTA 1UCIA 3GZYB 1R4YA 3WOFB 5FW5A 2W0QA 1JRQA 1V58A 1GS3A 2LQVA 2WOHA 2OTL3 1O7HB 1D6YA 2H0GA 1QMAA 2CK3H 4KFFA 4FMBA 1N5HA 2KCDA 1GOUA 2Z7AA 1WNHA 1DETA 4XDWA 1AQZA 2KF4A 3X41A 2Z76A 3CCL3 1PYLA 2W9PA 3F14A 4HZBB 3G713 4LYLB 3LZAA 1RNTA 1RGCA 3OX9A 1MGRA 1W4NA 1STFI 2LYXA 2XF3A 4MEIA 3K7CA 1DE3A 3MWZA 4FCMA 4GB5A 3D5GA 1JV2B 5AYSC 1OGZA 3IMAB 1EG9B 1GSPA 3EQQB 4N6OB 1RGKA 3NV0A 4NHFA 3SYUA 4OK0A 4R80A 2UGIA 2XSHB 3LMLA 4BTXA 2XGLA 2OCTA 3EN8A 2QEX3 5DRVA 2FXTA 3NUVA 1OCVA 1R4CA 3K63A 1T5YA 4EV5A 3UL5A 1UUWB 4KFEA 3SEDA 1VQ63 3BNDA 2YFLB 2C11A 5BU4A 1ROVA 5AIHA 1IQYA 4KVHA 4XBYA 2SBLA 1LOWA 3EE1A 5AI1A 1LQMB 3BNEA 4N6NB 3JVCA 1RNBA 1BNRA 3BNCA 3LXUX 4RNYA 3CMA3 5D81A 4XDVA 2XEPA 3FG3A 1M1K4 3GSPA 4HM2B 1AY7A 3X3XA 1YVSA 4J5GA 5G1KA 1B2SA 2A15A 3S67A 5D82A 1KWIA 1MNLA 1UI7A 2L4VA 5STDA 4XBXA 3OWYA 1CYUA 1X1WA 4IT7A 4STDA 1SPUA 3FCSB 5CLKA 3JUOA 4R9LA 2UUGC 3J7Yd 1IVVA 1FGTA 1E3RA 3KFQC 4KZ1A 1RN4A 7GSPA 4BTWA 3EC9A 5CXOA 5EQLA 4WFOA 3SOAA 2RFRA 1I0XA 1HKXA 4O02B 3T0UA 1DMQA 1M1XB 1BSAA 3SLUA 3V98A 1YIJ3 3CNXA 5G1LA 4ILFA 5M1AA 2K3DA 4HKVB 3LTCA 4QWTA 1IVXA 1G0TA 5BIRA 4FMAA 3S5CA 1W5ZA 1IV7A 1BSBA 4X2HA 4R9KA 3VSYA 2XFSA 3RGAA 3KIIA 1VQ53 3HIIA 1NJI4 2IY2A 3HX8A 4O3VA 1NB3I 1UUVB 3ECFA 3AGNA 2XGNA 3FF2A 2ZHXB 1BSEA 1BRIA 2BT3A 4R1KA 3X3ZA 5IF6A 1O7PB 3UL6A 1K8A4 3CC23 3QK9A 4LSOA 1SJWA 2C10A 1LOYA 1BRJA 3F8HA 1A2PA 3CU3A 2HMMB 2UX0A 3OWSA 4HAAA 3ZFZA 1PY3A 5LC6A 3N54B 2HMNB 4H3UA 4N6MA 3G6E3 3CXC2 1CEWI 2P05A 2F56A 4CPKA 4WYKB 4IPBA 3I563 1YJ93 3MG2A 1V57A 1HU9A 1BGSA 2R41A 4N3VA 1YHQ3 2HMLB 3GRDA 4EBGA 1LOVA 3BNBA 2KF3A 4L8OA 1TIJA 2SARA 2CX0A 3WHOA 2XR8B 3B8LA 1I2EA 1RMSA 8CHOA 1OHPA 1YVBI 2GEXA 1STDA 3EX9A 1B3SA 2XH9A 3NHXA 1EQKA 1MOLA 1LNHA 1VQP3 5KP1A 1OACA 3FSDA 3JUQA 2F5MA 3Q90A 1BU4A 1A2KA 3F7XA 1SIHA 3K5TA 4MMZB 2YX9A 3MKIA 1F8NA 3RDEA 1ZGXA 3Q1CA 4HM1B 4EXRA 1OPYA 3NXJA 1W6CA 1D6UA 2Q07A 1QAKA 4HJLB 5HOHA 1VQ73 3WMDA 1PFPA 2XFTA 1VQ43 2CFKA 3X3YA 1B21A 3KKGA 1SARA 1QJGA 2CKFB 1YJN3 1VQL3 3ALAA 1AR0A 5LC7A 4AKYA 1CYVA 5FGOA 1RRHA 1IVUA 4GHOA 1GMRA 3JUPA 4I4KA 3NBBA 3UJMA 1T2IA 3B7CA 3LTBA 3OWUA 1YIT3 1RGHA 3CC43 1BUJA 1N5PA 1Q7HA 3DH2A 2AAEA 3KCHA 3RGRA 1A2VA 2P0XA 1Q7Y4 5DREA 1MGWA 2P0MA 3NV0B 1UCKA 1MWRA 3BB9A 3BLZA 3T8UA 1A90A 1GOYA 1VQ93 4J5KA 1Q814 3MG1A 5ELUA 1J2BA 4CDLA 4L8PA 3CPOA 5IEPA 2KRTA 4FR9A 2CWTA 2HOHA 3FF0A 1IV9A 3EJVA 3MYTA 1FUWA 1VQO3 3D4AA 3M8CA 4K90B 1K734 2IMJA 1MWTA 2CW9A 3DGLA 5A0OB 2W04A 4O2HA 1LQGC 4XBTA 5TGNA 4BL2A 2P38A 4H61A 1GMQA 2L1SA 3SXXA 2IYJA 2GSPA 2H0HA 1UCLA 3D9RA 1RKYA 1WMNA 1NNVA 1B20A 3UB1A 4L7KA 2RGQA 1RGGA 4LZIA 3FG1A 3BU4A 4K61A 3KZTA 1GOVA 1I3IA 1O7GB 1BVIA 4KFDA 4BTYA 2Z6BA 3K9MC 3MSOA 4FMDA 1UCJA 5AEWB 4N6LA 1L5GB 3CME3 4RBNA 3OXAA 1EUIC 1JN5B 2BU4A 2P09A 3G8ZA 3EHCA 3FLJA 3LH4A 3WA3A 3STDA 3CCS3 1BNGA 4R4KA 1B2XA 4HYZA 2CWVA 5AIFA 3A76A 5CK6A 1BRHA 1W7CA 1OHOA 1T3BA 4OUQA 3MHEA 1KD14 3SOYA 2GBWB 1UW1A 3NQZA 3FKAA 5EVHA 1O7WB 5G2GA 1CH0A 4AKZA 1N9JA 2RNTA 2W2CA 3DGOA 1Q864 3S27A 3ZG0A 1G02A 3AMOA 3HIGA 1W02A 1JKGB 3G0KA 1VQ83 2JDIH 3VF1A 1FGOA 4EW5A 3LYGA 3VGNA 1SQWA 2CHCA 1BUQA 1RDSA 3HI7A 3V92A 1UDII 1Q9EA 4XB5A 3RNTA 2C4BA 3I553 2WOFA 3CNMA 1AVLA 1LVNA 3GAXA 4X2OA 7RNTA 1WTHA 3PZWA 2CWUA 1RCKA 5AYRB 3LOYA 4WHAA 1K9M4 2OWPA 5BVBA 1IT7A 1TP6A 3V99A 4DKIA 5KP3A 3AHWA 1E97A 1IQ8A 3FH1A 3HK4A 3DXOA 3F40A 3SVAA 1B27A 3OV4A 3CPW2 4Q53A 8RNTA 3CCU3 5AIGA 5BXQA 3N8BA 1BSDA 2ZA4A 1QVF2 6GSPA 1TJDA 1BRGA 3CCE3 3LT8A 1TRPA 5AEUB 1X1XA 1YNVX 2O9UX 6STDA 1JNQA 2F98A 4LEHA 3ER7A 1B2ZA 2HMKB 1RN1A 4EV2A 5IERA 1UGHI 3D3LA 1Q824 1OHSA 2RCDA 1IU7A 2QGUA 3Q2PA 2I9WA 4HM6B 2M7OA 1JB4A 3F8XA 2KAAA 3FG4A 4LGQA 3N9HA 1FZUA 2F86B 1LXEA 1C7HA 3NQYA 3A5EA 7STDA 3ZG5A 5IG4A 1RGFA 2D42A 1BIRA 1SIIA 1W01A 4BIRA 5I97A 1EEJA 4N6V0 1IK3A 1JKGA 3DM8A 2GBXB 2KF6A 1RN7A 1FGRA 2GXFA 3NM2A 1S5AA 3LT9A 1LNIA 1KQS2 1E3VA 1I2FA 2IUJA 1OH0A 5AIIA 2FNQA 3GWRA 1RHLA 1B2MA 1ZO2A 1FUSA 1VQM3 1JB5A 1JB2A 1GY6A 1ULIB 1OF5B 2OOVC 2INXA 1RGEA 5RNTA 1M904 3U1WA 2MF7A 1US1A 1LOXA 5IEOA 1G96A 1TUHA 3O8YA 1FUTA 1RTUA 3KN4A 2GU3A 5M19A 1T2HA 3UNLA 4NREA 2XSOB 1U8CB 1JBRA 1V74A 3L0RA 3KE7A 3AHSA 4TX4A 3CCM3 1I8VA 2CFGA 4AEQA 1TU5A 2Z77A 1VQK3 2PZVA 3CD63 3Q3FA 4RNZA 4LMIA 1BRNL 2CC3A 1FGQA 3PGBA 2CX1A 2YFJB 4XM4A 1KC84 2WO0A 2BNGA 2ML5A 3MPHA 3WA2X 2ZL8A 2F99A 3X40A 1Q42A 2HMJB 1YI23 1O7NB 1FGMA 1QALA 1U5OA 2K0MA 1EKMA 1O7MB 4G1MB 2CFDA 1DYUA 2CH9A 1WMPA 2OQEC 4HM4B 1BAOA 3KSPA 1BNJA 4K1VA 1BNIA 1BRKA 1W6GA 2IA7A 4EC6A 1GD3A 4U13A 5IG0A 1FA3A 1DVCA 3URPA 4HM7B 1EA2A
chains in the Genus database with same CATH topology
1RRLA 4K1UA 1JN5A 2XRXB 1CQSA 2MC8A 3F9SA 1QAFA 2RSXA 2OTJ3 1OUNA 2W56A 2O3OA 1W6YA 2E2VA 1IDPA 3IJEB 2YFIB 5IG3A 3LTDA 2STDA 4GL6A 2QA43 1EA2A 2BO9B 3ROBA 3CC73 1NWWA 1OF5A 3JUMA 4IIAA 1NB5I 3H3HA 5KP4A 2BMQB 2Y73A 3PCSA 3FGYA 1ASKA 1N8QA 1M9GA 1DMNA 3NX0A 2BHMA 1OGXA 2CFLA 5IENA 1ROAA 1YGEA 1ZX2A 3WOEB 3CCQ3 4OVMA 4HBRA 1S723 1TFKA 5ELJA 3GZBA 2BMRB 1YJW3 3U97A 4RZMA 3IPTA 1Q40A 2CFWA 1UI8A 2GEYA 3LTAA 3X42A 2ML6A 3NBJA 4FCZA 3DUKA 3SX1A 2KXGA 3FZWA 5D83A 3G16A 3PS8A 1PU4A 4PEJA 2B24B 3T8NA 2E2TA 3NM7A 1VQN3 4HVNA 4J9AA 1Z1SA 3EBYA 1IVWA 5JPUA 1KSIA 1JJ22 1NO3A 4JF8A 1GY5A 3AMOB 1TFOA 3OW22 3EN1B 3KSED 4ZM8A 1WMOA 1N8R4 2CIUA 1NDOB 4FMCA 2CG1A 1NU3A 3B4PA 4EYCA 2W56B 3CCJ3 3DZLA 3EF8A 1VZZA 4HZ9B 4JRFA 4HM0B 3H51A 3DGMA 1W2B2 4HM3B 4WYKA 4WP5A 3WODG 3HZPA 1QVG2 3DGNA 5IG5A 3TDGA 3DMCA 1K28A 3F7SA 4ORLA 2OQEA 3GZXB 2BMOB 1Y4KA 4O8SA 1RJOA 4FCJA 3WDGB 3JUNA 3S28A 3DY5A 4CCVA 1W2ZA 4MMYB 1DMMA 3PCRA 4HM5B 1W00A 3MG3A 1IQXA 3NBRA 2V1LA 2GU1A 4MJDA 3EB8A 1GYBA 2W6JH 3I0YA 5CF1A 5IW9A 1A67A 5EEOA 4N6TA 1D6ZA 1Q40B 1ULJB 2K54A 2W03A 2IUKA 1ISKA 3G4S3 3CCR3 3PXMA 4N6UA 5CF2A 4WWUC 5JPPA 5HGRA 2WGQA 3GZRA 2QIYA 3PYJA 2WGOA 2E2UA 2R4IA 3B4OA 1AV4A 1AVKA 2FGTA 4J8TA 1K41A 3S29A 1WQLB 1IT8A 2HMOB 3E99A 2JQ5A 3K0ZA 4HM8B 2B1XB 2CG0A 4MMXB 5JBSA 1GD4A 2Y74A 1N9EA 2D1WA 2OOVA 3QRDA 3CCV3 1GY7A 2W9QA 2ZDJA 3EBTA 3GZYB 3WOFB 5FW5A 2W0QA 1JRQA 2WOHA 1GS3A 2LQVA 2OTL3 1O7HB 1D6YA 1QMAA 2CK3H 4KFFA 4FMBA 1N5HA 2KCDA 2Z7AA 1WNHA 4XDWA 3X41A 3CCL3 2Z76A 2W9PA 3F14A 4HZBB 3G713 3LZAA 3OX9A 1W4NA 1STFI 2LYXA 2XF3A 4MEIA 3K7CA 3MWZA 4FCMA 4GB5A 1JV2B 5AYSC 1OGZA 3IMAB 1EG9B 3EQQB 4N6OB 3NV0A 4NHFA 4OK0A 4R80A 2XSHB 3LMLA 4BTXA 2XGLA 2OCTA 3EN8A 2QEX3 5DRVA 2FXTA 3NUVA 1OCVA 1R4CA 3K63A 1T5YA 4EV5A 3UL5A 1UUWB 4KFEA 3SEDA 1VQ63 3BNDA 2YFLB 2C11A 1ROVA 5AIHA 1IQYA 4KVHA 4XBYA 2SBLA 3EE1A 5AI1A 3BNEA 4N6NB 3JVCA 3BNCA 3LXUX 4RNYA 3CMA3 5D81A 4XDVA 2XEPA 3FG3A 4HM2B 3X3XA 2A15A 3S67A 5D82A 1KWIA 1MNLA 1UI7A 2L4VA 5STDA 4XBXA 3OWYA 1CYUA 4IT7A 4STDA 1SPUA 3FCSB 5CLKA 3JUOA 4R9LA 3J7Yd 1IVVA 1FGTA 1E3RA 3KFQC 4KZ1A 4BTWA 3EC9A 5CXOA 5EQLA 4WFOA 3SOAA 2RFRA 4O02B 1HKXA 3T0UA 3V98A 1DMQA 1M1XB 3SLUA 1YIJ3 3CNXA 4HKVB 3LTCA 4QWTA 1IVXA 4FMAA 3S5CA 1W5ZA 1IV7A 4X2HA 4R9KA 3VSYA 2XFSA 3RGAA 3KIIA 1VQ53 3HIIA 1NJI4 3HX8A 4O3VA 1NB3I 1UUVB 3ECFA 2XGNA 3FF2A 4R1KA 1M1K4 3X3ZA 2BT3A 5IF6A 1O7PB 3UL6A 1K8A4 3CC23 3QK9A 4LSOA 1SJWA 2C10A 3F8HA 3CU3A 2HMMB 2UX0A 3OWSA 5LC6A 3N54B 2HMNB 4H3UA 4N6MA 3G6E3 3CXC2 1CEWI 2P05A 4WYKB 4IPBA 3I563 1YJ93 3MG2A 1HU9A 4N3VA 1YHQ3 2HMLB 3GRDA 4EBGA 3BNBA 4L8OA 1TIJA 2XR8B 3B8LA 8CHOA 1OHPA 1YVBI 2GEXA 1STDA 3EX9A 2XH9A 3NHXA 1EQKA 1MOLA 1LNHA 1VQP3 5KP1A 1OACA 3FSDA 3JUQA 3Q90A 1A2KA 3F7XA 1SIHA 3K5TA 4MMZB 2YX9A 3MKIA 1F8NA 3RDEA 3Q1CA 4HM1B 4EXRA 1OPYA 3NXJA 1W6CA 1D6UA 2Q07A 1QAKA 4HJLB 1VQ73 3WMDA 1PFPA 2XFTA 1VQ43 2CFKA 3X3YA 3KKGA 1QJGA 2CKFB 1YJN3 1VQL3 3ALAA 1AR0A 5LC7A 4AKYA 1CYVA 5FGOA 1RRHA 1IVUA 3JUPA 4I4KA 3NBBA 3UJMA 3LTBA 3B7CA 3OWUA 1YIT3 3CC43 1N5PA 3RGRA 1A2VA 2P0XA 1Q7Y4 5DREA 2P0MA 3NV0B 3BLZA 3BB9A 1A90A 3T8UA 1VQ93 1Q814 3MG1A 5ELUA 1J2BA 4CDLA 4L8PA 3CPOA 5IEPA 2KRTA 4FR9A 2CWTA 3FF0A 1IV9A 3EJVA 3MYTA 1FUWA 1VQO3 3M8CA 4K90B 1K734 2IMJA 2CW9A 3DGLA 5A0OB 2W04A 4O2HA 4XBTA 5TGNA 2P38A 4H61A 3SXXA 3D9RA 1RKYA 1WMNA 3UB1A 4L7KA 2RGQA 4LZIA 3FG1A 4K61A 3KZTA 1O7GB 4KFDA 4BTYA 2Z6BA 3K9MC 3MSOA 4FMDA 5AEWB 3CME3 4N6LA 1L5GB 4RBNA 3OXAA 2P09A 1JN5B 3G8ZA 3EHCA 3FLJA 3LH4A 3WA3A 3STDA 3CCS3 4R4KA 4HYZA 2CWVA 5AIFA 3A76A 5CK6A 1W7CA 1OHOA 4OUQA 3MHEA 1KD14 3SOYA 2GBWB 1UW1A 3NQZA 3FKAA 5EVHA 1O7WB 5G2GA 4AKZA 1N9JA 2W2CA 3DGOA 1Q864 3S27A 3AMOA 3HIGA 1W02A 1JKGB 3G0KA 1VQ83 2JDIH 3VF1A 1FGOA 3LYGA 3VGNA 1SQWA 2CHCA 1BUQA 3HI7A 3V92A 1DVDA 4XB5A 3I553 2WOFA 3CNMA 1AVLA 1LVNA 3GAXA 4X2OA 1WTHA 3PZWA 2CWUA 5AYRB 3LOYA 4WHAA 1K9M4 2OWPA 5BVBA 1IT7A 1TP6A 3V99A 5KP3A 1E97A 1IQ8A 3FH1A 3HK4A 3DXOA 3F40A 3SVAA 3OV4A 3CPW2 4Q53A 3CCU3 5AIGA 5BXQA 3N8BA 1QVF2 3CCE3 3LT8A 5AEUB 2O9UX 6STDA 1JNQA 2F98A 4LEHA 3ER7A 2HMKB 4EV2A 5IERA 3D3LA 1Q824 1OHSA 2RCDA 1IU7A 2QGUA 3Q2PA 2I9WA 4HM6B 2M7OA 1JB4A 3F8XA 3FG4A 4LGQA 3N9HA 2F86B 1LXEA 1C7HA 3NQYA 7STDA 5IG4A 2D42A 1SIIA 1W01A 5I97A 4N6V0 1IK3A 1JKGA 3DM8A 2GBXB 1RN7A 1FGRA 2GXFA 3NM2A 1S5AA 3LT9A 1KQS2 1E3VA 2IUJA 1OH0A 5AIIA 2FNQA 3GWRA 1ZO2A 1VQM3 1JB5A 1JB2A 1GY6A 1ULIB 1OF5B 2OOVC 2INXA 1M904 3U1WA 2MF7A 1US1A 1LOXA 5IEOA 1G96A 1TUHA 3O8YA 3KN4A 2GU3A 3UNLA 4NREA 2XSOB 1U8CB 1V74A 3L0RA 3KE7A 4TX4A 3CCM3 2CFGA 4AEQA 1TU5A 2Z77A 1VQK3 2PZVA 3CD63 4RNZA 4LMIA 2CC3A 1FGQA 3PGBA 2YFJB 1KC84 4XM4A 2WO0A 2BNGA 2ML5A 3MPHA 3WA2X 2ZL8A 2F99A 3X40A 1Q42A 2HMJB 1YI23 1O7NB 1FGMA 1QALA 1U5OA 2K0MA 1EKMA 1O7MB 4G1MB 2CFDA 1DYUA 2CH9A 1WMPA 2OQEC 4HM4B 3KSPA 4K1VA 1W6GA 2IA7A 4EC6A 1GD3A 4U13A 5IG0A 1FA3A 1DVCA 4HM7B 2PNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4I A;  4K1U A;  1JN5 A;  2XRX B;  1CQS A;  3B4O A;  3MHE A;  3F9S A;  4OUQ A;  2GBW B;  3SOY A;  2HMN B;  1K41 A;  4H3U A;  4J8T A;  3FKA A;  1WQL B;  1O7W B;  2HMO B;  3E99 A;  2JQ5 A;  3K0Z A;  5EVH A;  1OUN A;  4WYK B;  2W2C A;  4HM8 B;  3MG2 A;  2B1X B;  4N3V A;  1W6Y A;  1IDP A;  2YFI B;  2HML B;  5IG3 A;  2STD A;  3GRD A;  1W02 A;  1JKG B;  3G0K A;  3ROB A;  4L8O A;  1NWW A;  1OF5 A;  2CHC A;  3JUM A;  3LYG A;  4IIA A;  3VGN A;  1BUQ A;  1GY7 A;  3H3H A;  4XB5 A;  3EBT A;  5KP4 A;  2BMQ B;  2XR8 B;  3B8L A;  3CNM A;  3GZY B;  5G2G A;  8CHO A;  3FGY A;  4X2O A;  1OHP A;  2GEX A;  3EX9 A;  1STD A;  1ASK A;  5FW5 A;  1GS3 A;  3NHX A;  1O7H B;  1QMA A;  1DMN A;  2OWP A;  5BVB A;  1TP6 A;  5KP1 A;  3FSD A;  5KP3 A;  3JUQ A;  1OGX A;  1E97 A;  3Q90 A;  2Z7A A;  3FH1 A;  4XDW A;  3HK4 A;  5IEN A;  3DXO A;  2Z76 A;  3F40 A;  1A2K A;  3F14 A;  3F7X A;  3OV4 A;  4HZB B;  4Q53 A;  1ZX2 A;  3LZA A;  5AIG A;  5BXQ A;  3MKI A;  3OX9 A;  4OVM A;  4HM1 B;  1OPY A;  3NXJ A;  3K7C A;  4FCM A;  3GZB A;  4HJL B;  2BMR B;  3WMD A;  4GB5 A;  5AEU B;  6STD A;  2F98 A;  3KKG A;  4LEH A;  1QJG A;  2CKF B;  4RZM A;  1OGZ A;  3IPT A;  1Q40 A;  3ER7 A;  2GEY A;  1AR0 A;  2HMK B;  1EG9 B;  5IER A;  3EQQ B;  5STD A;  3DUK A;  1OHS A;  2RCD A;  3FZW A;  2QGU A;  3NV0 A;  2I9W A;  3G16 A;  4HM6 B;  5D83 A;  1JB4 A;  2B24 B;  3F8X A;  3JUP A;  4PEJ A;  3T8N A;  4HVN A;  2XSH B;  4I4K A;  4J9A A;  1Z1S A;  4LGQ A;  3EBY A;  3EN8 A;  3B7C A;  3OWU A;  5DRV A;  3UJM A;  5JPU A;  2F86 B;  3NUV A;  1OCV A;  1C7H A;  7STD A;  1UUW B;  5D82 A;  1GY5 A;  3RGR A;  5IG4 A;  1W01 A;  3EN1 B;  3SED A;  2YFL B;  1JKG A;  3DM8 A;  2GBX B;  5AIH A;  5DRE A;  1NDO B;  4KVH A;  2GXF A;  3NV0 B;  3NM2 A;  4XBY A;  1S5A A;  3BB9 A;  1NU3 A;  3BLZ A;  3B4P A;  5AI1 A;  3T8U A;  1E3V A;  5D81 A;  4XDV A;  3MG1 A;  4CDL A;  1OH0 A;  3DZL A;  5AII A;  3GWR A;  3EF8 A;  3CPO A;  4HM2 B;  1VZZ A;  4L8P A;  1ZO2 A;  4HZ9 B;  5IEP A;  1JB5 A;  4HM0 B;  3H51 A;  1JB2 A;  1GY6 A;  1ULI B;  1OF5 B;  2A15 A;  3FF0 A;  4HM3 B;  3EJV A;  2INX A;  3HZP A;  3MYT A;  4WP5 A;  3M8C A;  4WYK A;  4XBX A;  3OWY A;  2IMJ A;  5IG5 A;  3DMC A;  3F7S A;  4ORL A;  5IEO A;  3GZX B;  2BMO B;  4STD A;  1TUH A;  4XBT A;  4FCJ A;  5TGN A;  3JUN A;  3JUO A;  4R9L A;  5CLK A;  1DMM A;  3UNL A;  3D9R A;  1E3R A;  2XSO B;  4HM5 B;  1W00 A;  3MG3 A;  3KE7 A;  3EC9 A;  3NBR A;  4MJD A;  5CXO A;  4L7K A;  2RGQ A;  3SOA A;  2RFR A;  1HKX A;  1DMQ A;  2Z77 A;  2PZV A;  1GYB A;  3CNX A;  3I0Y A;  5CF1 A;  3KZT A;  1O7G B;  4LMI A;  4HKV B;  2YFJ B;  4XM4 A;  3S5C A;  1Q40 B;  2BNG A;  3MSO A;  5AEW B;  1ULJ B;  2K54 A;  4X2H A;  4R9K A;  2F99 A;  3VSY A;  3RGA A;  3OXA A;  1Q42 A;  2HMJ B;  1JN5 B;  1O7N B;  3G8Z A;  1ISK A;  1U5O A;  3EHC A;  1O7M B;  3HX8 A;  3FLJ A;  1UUV B;  3ECF A;  3STD A;  5CF2 A;  4WWU C;  4HM4 B;  3FF2 A;  3KSP A;  4R1K A;  4K1V A;  5HGR A;  5IF6 A;  5JPP A;  1O7P B;  5AIF A;  1SJW A;  3A76 A;  3GZR A;  5CK6 A;  2QIY A;  3F8H A;  4U13 A;  3CU3 A;  5IG0 A;  2HMM B;  2UX0 A;  1OHO A;  4HM7 B;  3OWS A;  1EA2 A; 
#chains in the Genus database with same CATH topology
 1YGW A;  1RRL A;  4K1U A;  1JN5 A;  2XRX B;  1CQS A;  2MC8 A;  3DGY A;  3F9S A;  1QAF A;  1RGA A;  4GSP A;  2RSX A;  2OTJ 3;  1OUN A;  1GMP A;  2W56 A;  2O3O A;  1W6Y A;  2E2V A;  1IDP A;  3IJE B;  2YFI B;  3D5I A;  3LTD A;  2STD A;  5IG3 A;  4GL6 A;  2QA4 3;  2BO9 B;  1HYF A;  3ROB A;  3CC7 3;  1NWW A;  1OF5 A;  3JUM A;  4IIA A;  1NB5 I;  1RCL A;  3H3H A;  5KP4 A;  2BMQ B;  2Y73 A;  3PCS A;  1LRA A;  3FGY A;  1ASK A;  1N8Q A;  2BIR A;  1M9G A;  4RNT A;  1BSC A;  1DMN A;  3NX0 A;  3BIR A;  2BHM A;  1OGX A;  2CFL A;  1JBT A;  5IEN A;  1BNE A;  1ROA A;  1YGE A;  1ZX2 A;  1ZS7 A;  3WOE B;  3CCQ 3;  4OVM A;  1RSN A;  4HBR A;  1S72 3;  4CJN A;  1TFK A;  5ELJ A;  2H0I A;  3GZB A;  2BMR B;  1YJW 3;  2RBI A;  3HOH A;  3U97 A;  4RZM A;  2AAD A;  3IPT A;  1Q40 A;  2CFW A;  1UI8 A;  2GEY A;  3LTA A;  3X42 A;  3AGO A;  2ML6 A;  3NBJ A;  4FCZ A;  3DUK A;  1BRS A;  3SX1 A;  4NPB A;  2KXG A;  1TRQ A;  3FZW A;  5D83 A;  1HZ1 A;  3G16 A;  3PS8 A;  1PU4 A;  4PEJ A;  2B24 B;  1BOX A;  2E2T A;  2F4Y A;  3NM7 A;  4HVN A;  4J9A A;  3T8N A;  4BL3 A;  1Z1S A;  1VQN 3;  1I70 A;  3EBY A;  1IVW A;  5JPU A;  1KSI A;  1JJ2 2;  1NO3 A;  3WR2 A;  1I0V A;  1GY5 A;  4JF8 A;  3AMO B;  1TFO A;  3OW2 2;  1X1Y A;  3EN1 B;  3KSE D;  4ZM8 A;  1WMO A;  1N8R 4;  2CIU A;  1C54 A;  1NDO B;  1JZO A;  4FMC A;  1BAN A;  2CG1 A;  1NU3 A;  3B4P A;  4KT3 B;  3D79 A;  4EYC A;  1BNF A;  5M18 A;  1B2U A;  2W56 B;  1TTO A;  9RNT A;  3CCJ 3;  3DZL A;  1JBS A;  3EF8 A;  1VZZ A;  1MWU A;  4HZ9 B;  6RNT A;  4JRF A;  4HM0 B;  3H51 A;  1RLS A;  1DVD A;  1FW7 A;  3DGM A;  1W2B 2;  4HM3 B;  4WYK A;  4WP5 A;  3WOD G;  3HZP A;  1QVG 2;  3DGN A;  1X1U A;  1IYY A;  5IG5 A;  3TDG A;  3DMC A;  1K28 A;  3F7S A;  4ORL A;  5GSP A;  2OQE A;  3GZX B;  2BMO B;  1Y4K A;  4O8S A;  1RJO A;  4FCJ A;  3WDG B;  3JUN A;  3S28 A;  3DY5 A;  4CCV A;  1W2Z A;  1VQQ A;  4MMY B;  1DMM A;  1UGI A;  3PCR A;  4HM5 B;  1W00 A;  3MG3 A;  1IQX A;  3NBR A;  2V1L A;  1I3F A;  2GU1 A;  1FYS A;  4MJD A;  3EB8 A;  1GYB A;  2W6J H;  3I0Y A;  5CF1 A;  5IW9 A;  1A67 A;  5EEO A;  4N6T A;  1D6Z A;  1Q40 B;  2PNC A;  1ULJ B;  2K54 A;  1RGL A;  2F5W A;  2W03 A;  2IUK A;  1ISK A;  3G4S 3;  3CCR 3;  4BU4 A;  1BNS A;  3PXM A;  4N6U A;  5CF2 A;  4WWU C;  4HOH A;  5HGR A;  5JPP A;  1I2G A;  2WGQ A;  3GZR A;  2QIY A;  3PYJ A;  2WGO A;  2E2U A;  2R4I A;  1UUG B;  2KF5 A;  3B4O A;  1AV4 A;  1AVK A;  2FGT A;  4J8T A;  1K41 A;  3S29 A;  1WQL B;  1IT8 A;  2HMO B;  3E99 A;  2JQ5 A;  3K0Z A;  4HM8 B;  2B1X B;  2CG0 A;  4MMX B;  5JBS A;  1GD4 A;  2Y74 A;  1N9E A;  2D1W A;  2OOV A;  2J8X B;  4I5Q A;  1JZD A;  3QRD A;  3CCV 3;  1MWS A;  1GY7 A;  2W9Q A;  2ZDJ A;  3EBT A;  1UCI A;  3GZY B;  1R4Y A;  3WOF B;  5FW5 A;  2W0Q A;  1JRQ A;  1V58 A;  1GS3 A;  2LQV A;  2WOH A;  2OTL 3;  1O7H B;  1D6Y A;  2H0G A;  1QMA A;  2CK3 H;  4KFF A;  4FMB A;  1N5H A;  2KCD A;  1GOU A;  2Z7A A;  1WNH A;  1DET A;  4XDW A;  1AQZ A;  2KF4 A;  3X41 A;  2Z76 A;  3CCL 3;  1PYL A;  2W9P A;  3F14 A;  4HZB B;  3G71 3;  4LYL B;  3LZA A;  1RNT A;  1RGC A;  3OX9 A;  1MGR A;  1W4N A;  1STF I;  2LYX A;  2XF3 A;  4MEI A;  3K7C A;  1DE3 A;  3MWZ A;  4FCM A;  4GB5 A;  3D5G A;  1JV2 B;  5AYS C;  1OGZ A;  3IMA B;  1EG9 B;  1GSP A;  3EQQ B;  4N6O B;  1RGK A;  3NV0 A;  4NHF A;  3SYU A;  4OK0 A;  4R80 A;  2UGI A;  2XSH B;  3LML A;  4BTX A;  2XGL A;  2OCT A;  3EN8 A;  2QEX 3;  5DRV A;  2FXT A;  3NUV A;  1OCV A;  1R4C A;  3K63 A;  1T5Y A;  4EV5 A;  3UL5 A;  1UUW B;  4KFE A;  3SED A;  1VQ6 3;  3BND A;  2YFL B;  2C11 A;  5BU4 A;  1ROV A;  5AIH A;  1IQY A;  4KVH A;  4XBY A;  2SBL A;  1LOW A;  3EE1 A;  5AI1 A;  1LQM B;  3BNE A;  4N6N B;  3JVC A;  1RNB A;  1BNR A;  3BNC A;  3LXU X;  4RNY A;  3CMA 3;  5D81 A;  4XDV A;  2XEP A;  3FG3 A;  1M1K 4;  3GSP A;  4HM2 B;  1AY7 A;  3X3X A;  1YVS A;  4J5G A;  5G1K A;  1B2S A;  2A15 A;  3S67 A;  5D82 A;  1KWI A;  1MNL A;  1UI7 A;  2L4V A;  5STD A;  4XBX A;  3OWY A;  1CYU A;  1X1W A;  4IT7 A;  4STD A;  1SPU A;  3FCS B;  5CLK A;  3JUO A;  4R9L A;  2UUG C;  3J7Y d;  1IVV A;  1FGT A;  1E3R A;  3KFQ C;  4KZ1 A;  1RN4 A;  7GSP A;  4BTW A;  3EC9 A;  5CXO A;  5EQL A;  4WFO A;  3SOA A;  2RFR A;  1I0X A;  1HKX A;  4O02 B;  3T0U A;  1DMQ A;  1M1X B;  1BSA A;  3SLU A;  3V98 A;  1YIJ 3;  3CNX A;  5G1L A;  4ILF A;  5M1A A;  2K3D A;  4HKV B;  3LTC A;  4QWT A;  1IVX A;  1G0T A;  5BIR A;  4FMA A;  3S5C A;  1W5Z A;  1IV7 A;  1BSB A;  4X2H A;  4R9K A;  3VSY A;  2XFS A;  3RGA A;  3KII A;  1VQ5 3;  3HII A;  1NJI 4;  2IY2 A;  3HX8 A;  4O3V A;  1NB3 I;  1UUV B;  3ECF A;  3AGN A;  2XGN A;  3FF2 A;  2ZHX B;  1BSE A;  1BRI A;  2BT3 A;  4R1K A;  3X3Z A;  5IF6 A;  1O7P B;  3UL6 A;  1K8A 4;  3CC2 3;  3QK9 A;  4LSO A;  1SJW A;  2C10 A;  1LOY A;  1BRJ A;  3F8H A;  1A2P A;  3CU3 A;  2HMM B;  2UX0 A;  3OWS A;  4HAA A;  3ZFZ A;  1PY3 A;  5LC6 A;  3N54 B;  2HMN B;  4H3U A;  4N6M A;  3G6E 3;  3CXC 2;  1CEW I;  2P05 A;  2F56 A;  4CPK A;  4WYK B;  4IPB A;  3I56 3;  1YJ9 3;  3MG2 A;  1V57 A;  1HU9 A;  1BGS A;  2R41 A;  4N3V A;  1YHQ 3;  2HML B;  3GRD A;  4EBG A;  1LOV A;  3BNB A;  2KF3 A;  4L8O A;  1TIJ A;  2SAR A;  2CX0 A;  3WHO A;  2XR8 B;  3B8L A;  1I2E A;  1RMS A;  8CHO A;  1OHP A;  1YVB I;  2GEX A;  1STD A;  3EX9 A;  1B3S A;  2XH9 A;  3NHX A;  1EQK A;  1MOL A;  1LNH A;  1VQP 3;  5KP1 A;  1OAC A;  3FSD A;  3JUQ A;  2F5M A;  3Q90 A;  1BU4 A;  1A2K A;  3F7X A;  1SIH A;  3K5T A;  4MMZ B;  2YX9 A;  3MKI A;  1F8N A;  3RDE A;  1ZGX A;  3Q1C A;  4HM1 B;  4EXR A;  1OPY A;  3NXJ A;  1W6C A;  1D6U A;  2Q07 A;  1QAK A;  4HJL B;  5HOH A;  1VQ7 3;  3WMD A;  1PFP A;  2XFT A;  1VQ4 3;  2CFK A;  3X3Y A;  1B21 A;  3KKG A;  1SAR A;  1QJG A;  2CKF B;  1YJN 3;  1VQL 3;  3ALA A;  1AR0 A;  5LC7 A;  4AKY A;  1CYV A;  5FGO A;  1RRH A;  1IVU A;  4GHO A;  1GMR A;  3JUP A;  4I4K A;  3NBB A;  3UJM A;  1T2I A;  3B7C A;  3LTB A;  3OWU A;  1YIT 3;  1RGH A;  3CC4 3;  1BUJ A;  1N5P A;  1Q7H A;  3DH2 A;  2AAE A;  3KCH A;  3RGR A;  1A2V A;  2P0X A;  1Q7Y 4;  5DRE A;  1MGW A;  2P0M A;  3NV0 B;  1UCK A;  1MWR A;  3BB9 A;  3BLZ A;  3T8U A;  1A90 A;  1GOY A;  1VQ9 3;  4J5K A;  1Q81 4;  3MG1 A;  5ELU A;  1J2B A;  4CDL A;  4L8P A;  3CPO A;  5IEP A;  2KRT A;  4FR9 A;  2CWT A;  2HOH A;  3FF0 A;  1IV9 A;  3EJV A;  3MYT A;  1FUW A;  1VQO 3;  3D4A A;  3M8C A;  4K90 B;  1K73 4;  2IMJ A;  1MWT A;  2CW9 A;  3DGL A;  5A0O B;  2W04 A;  4O2H A;  1LQG C;  4XBT A;  5TGN A;  4BL2 A;  2P38 A;  4H61 A;  1GMQ A;  2L1S A;  3SXX A;  2IYJ A;  2GSP A;  2H0H A;  1UCL A;  3D9R A;  1RKY A;  1WMN A;  1NNV A;  1B20 A;  3UB1 A;  4L7K A;  2RGQ A;  1RGG A;  4LZI A;  3FG1 A;  3BU4 A;  4K61 A;  3KZT A;  1GOV A;  1I3I A;  1O7G B;  1BVI A;  4KFD A;  4BTY A;  2Z6B A;  3K9M C;  3MSO A;  4FMD A;  1UCJ A;  5AEW B;  4N6L A;  1L5G B;  3CME 3;  4RBN A;  3OXA A;  1EUI C;  1JN5 B;  2BU4 A;  2P09 A;  3G8Z A;  3EHC A;  3FLJ A;  3LH4 A;  3WA3 A;  3STD A;  3CCS 3;  1BNG A;  4R4K A;  1B2X A;  4HYZ A;  2CWV A;  5AIF A;  3A76 A;  5CK6 A;  1BRH A;  1W7C A;  1OHO A;  1T3B A;  4OUQ A;  3MHE A;  1KD1 4;  3SOY A;  2GBW B;  1UW1 A;  3NQZ A;  3FKA A;  5EVH A;  1O7W B;  5G2G A;  1CH0 A;  4AKZ A;  1N9J A;  2RNT A;  2W2C A;  3DGO A;  1Q86 4;  3S27 A;  3ZG0 A;  1G02 A;  3AMO A;  3HIG A;  1W02 A;  1JKG B;  3G0K A;  1VQ8 3;  2JDI H;  3VF1 A;  1FGO A;  4EW5 A;  3LYG A;  3VGN A;  1SQW A;  2CHC A;  1BUQ A;  1RDS A;  3HI7 A;  3V92 A;  1UDI I;  1Q9E A;  4XB5 A;  3RNT A;  2C4B A;  3I55 3;  2WOF A;  3CNM A;  1AVL A;  1LVN A;  3GAX A;  4X2O A;  7RNT A;  1WTH A;  3PZW A;  2CWU A;  1RCK A;  5AYR B;  3LOY A;  4WHA A;  1K9M 4;  2OWP A;  5BVB A;  1IT7 A;  1TP6 A;  3V99 A;  4DKI A;  5KP3 A;  3AHW A;  1E97 A;  1IQ8 A;  3FH1 A;  3HK4 A;  3DXO A;  3F40 A;  3SVA A;  1B27 A;  3OV4 A;  3CPW 2;  4Q53 A;  8RNT A;  3CCU 3;  5AIG A;  5BXQ A;  3N8B A;  1BSD A;  2ZA4 A;  1QVF 2;  6GSP A;  1TJD A;  1BRG A;  3CCE 3;  3LT8 A;  1TRP A;  5AEU B;  1X1X A;  1YNV X;  2O9U X;  6STD A;  1JNQ A;  2F98 A;  4LEH A;  3ER7 A;  1B2Z A;  2HMK B;  1RN1 A;  4EV2 A;  5IER A;  1UGH I;  3D3L A;  1Q82 4;  1OHS A;  2RCD A;  1IU7 A;  2QGU A;  3Q2P A;  2I9W A;  4HM6 B;  2M7O A;  1JB4 A;  3F8X A;  2KAA A;  3FG4 A;  4LGQ A;  3N9H A;  1FZU A;  2F86 B;  1LXE A;  1C7H A;  3NQY A;  3A5E A;  7STD A;  3ZG5 A;  5IG4 A;  1RGF A;  2D42 A;  1BIR A;  1SII A;  1W01 A;  4BIR A;  5I97 A;  1EEJ A;  4N6V 0;  1IK3 A;  1JKG A;  3DM8 A;  2GBX B;  2KF6 A;  1RN7 A;  1FGR A;  2GXF A;  3NM2 A;  1S5A A;  3LT9 A;  1LNI A;  1KQS 2;  1E3V A;  1I2F A;  2IUJ A;  1OH0 A;  5AII A;  2FNQ A;  3GWR A;  1RHL A;  1B2M A;  1ZO2 A;  1FUS A;  1VQM 3;  1JB5 A;  1JB2 A;  1GY6 A;  1ULI B;  1OF5 B;  2OOV C;  2INX A;  1RGE A;  5RNT A;  1M90 4;  3U1W A;  2MF7 A;  1US1 A;  1LOX A;  5IEO A;  1G96 A;  1TUH A;  3O8Y A;  1FUT A;  1RTU A;  3KN4 A;  2GU3 A;  5M19 A;  1T2H A;  3UNL A;  4NRE A;  2XSO B;  1U8C B;  1JBR A;  1V74 A;  3L0R A;  3KE7 A;  3AHS A;  4TX4 A;  3CCM 3;  1I8V A;  2CFG A;  4AEQ A;  1TU5 A;  2Z77 A;  1VQK 3;  2PZV A;  3CD6 3;  3Q3F A;  4RNZ A;  4LMI A;  1BRN L;  2CC3 A;  1FGQ A;  3PGB A;  2CX1 A;  2YFJ B;  4XM4 A;  1KC8 4;  2WO0 A;  2BNG A;  2ML5 A;  3MPH A;  3WA2 X;  2ZL8 A;  2F99 A;  3X40 A;  1Q42 A;  2HMJ B;  1YI2 3;  1O7N B;  1FGM A;  1QAL A;  1U5O A;  2K0M A;  1EKM A;  1O7M B;  4G1M B;  2CFD A;  1DYU A;  2CH9 A;  1WMP A;  2OQE C;  4HM4 B;  1BAO A;  3KSP A;  1BNJ A;  4K1V A;  1BNI A;  1BRK A;  1W6G A;  2IA7 A;  4EC6 A;  1GD3 A;  4U13 A;  5IG0 A;  1FA3 A;  1DVC A;  3URP A;  4HM7 B;  1EA2 A; 
#chains in the Genus database with same CATH homology
 1RRL A;  4K1U A;  1JN5 A;  2XRX B;  1CQS A;  2MC8 A;  3F9S A;  1QAF A;  2RSX A;  2OTJ 3;  1OUN A;  2W56 A;  2O3O A;  1W6Y A;  2E2V A;  1IDP A;  3IJE B;  2YFI B;  5IG3 A;  3LTD A;  2STD A;  4GL6 A;  2QA4 3;  1EA2 A;  2BO9 B;  3ROB A;  3CC7 3;  1NWW A;  1OF5 A;  3JUM A;  4IIA A;  1NB5 I;  3H3H A;  5KP4 A;  2BMQ B;  2Y73 A;  3PCS A;  3FGY A;  1ASK A;  1N8Q A;  1M9G A;  1DMN A;  3NX0 A;  2BHM A;  1OGX A;  2CFL A;  5IEN A;  1ROA A;  1YGE A;  1ZX2 A;  3WOE B;  3CCQ 3;  4OVM A;  4HBR A;  1S72 3;  1TFK A;  5ELJ A;  3GZB A;  2BMR B;  1YJW 3;  3U97 A;  4RZM A;  3IPT A;  1Q40 A;  2CFW A;  1UI8 A;  2GEY A;  3LTA A;  3X42 A;  2ML6 A;  3NBJ A;  4FCZ A;  3DUK A;  3SX1 A;  2KXG A;  3FZW A;  5D83 A;  3G16 A;  3PS8 A;  1PU4 A;  4PEJ A;  2B24 B;  3T8N A;  2E2T A;  3NM7 A;  1VQN 3;  4HVN A;  4J9A A;  1Z1S A;  3EBY A;  1IVW A;  5JPU A;  1KSI A;  1JJ2 2;  1NO3 A;  4JF8 A;  1GY5 A;  3AMO B;  1TFO A;  3OW2 2;  3EN1 B;  3KSE D;  4ZM8 A;  1WMO A;  1N8R 4;  2CIU A;  1NDO B;  4FMC A;  2CG1 A;  1NU3 A;  3B4P A;  4EYC A;  2W56 B;  3CCJ 3;  3DZL A;  3EF8 A;  1VZZ A;  4HZ9 B;  4JRF A;  4HM0 B;  3H51 A;  3DGM A;  1W2B 2;  4HM3 B;  4WYK A;  4WP5 A;  3WOD G;  3HZP A;  1QVG 2;  3DGN A;  5IG5 A;  3TDG A;  3DMC A;  1K28 A;  3F7S A;  4ORL A;  2OQE A;  3GZX B;  2BMO B;  1Y4K A;  4O8S A;  1RJO A;  4FCJ A;  3WDG B;  3JUN A;  3S28 A;  3DY5 A;  4CCV A;  1W2Z A;  4MMY B;  1DMM A;  3PCR A;  4HM5 B;  1W00 A;  3MG3 A;  1IQX A;  3NBR A;  2V1L A;  2GU1 A;  4MJD A;  3EB8 A;  1GYB A;  2W6J H;  3I0Y A;  5CF1 A;  5IW9 A;  1A67 A;  5EEO A;  4N6T A;  1D6Z A;  1Q40 B;  1ULJ B;  2K54 A;  2W03 A;  2IUK A;  1ISK A;  3G4S 3;  3CCR 3;  3PXM A;  4N6U A;  5CF2 A;  4WWU C;  5JPP A;  5HGR A;  2WGQ A;  3GZR A;  2QIY A;  3PYJ A;  2WGO A;  2E2U A;  2R4I A;  3B4O A;  1AV4 A;  1AVK A;  2FGT A;  4J8T A;  1K41 A;  3S29 A;  1WQL B;  1IT8 A;  2HMO B;  3E99 A;  2JQ5 A;  3K0Z A;  4HM8 B;  2B1X B;  2CG0 A;  4MMX B;  5JBS A;  1GD4 A;  2Y74 A;  1N9E A;  2D1W A;  2OOV A;  3QRD A;  3CCV 3;  1GY7 A;  2W9Q A;  2ZDJ A;  3EBT A;  3GZY B;  3WOF B;  5FW5 A;  2W0Q A;  1JRQ A;  2WOH A;  1GS3 A;  2LQV A;  2OTL 3;  1O7H B;  1D6Y A;  1QMA A;  2CK3 H;  4KFF A;  4FMB A;  1N5H A;  2KCD A;  2Z7A A;  1WNH A;  4XDW A;  3X41 A;  3CCL 3;  2Z76 A;  2W9P A;  3F14 A;  4HZB B;  3G71 3;  3LZA A;  3OX9 A;  1W4N A;  1STF I;  2LYX A;  2XF3 A;  4MEI A;  3K7C A;  3MWZ A;  4FCM A;  4GB5 A;  1JV2 B;  5AYS C;  1OGZ A;  3IMA B;  1EG9 B;  3EQQ B;  4N6O B;  3NV0 A;  4NHF A;  4OK0 A;  4R80 A;  2XSH B;  3LML A;  4BTX A;  2XGL A;  2OCT A;  3EN8 A;  2QEX 3;  5DRV A;  2FXT A;  3NUV A;  1OCV A;  1R4C A;  3K63 A;  1T5Y A;  4EV5 A;  3UL5 A;  1UUW B;  4KFE A;  3SED A;  1VQ6 3;  3BND A;  2YFL B;  2C11 A;  1ROV A;  5AIH A;  1IQY A;  4KVH A;  4XBY A;  2SBL A;  3EE1 A;  5AI1 A;  3BNE A;  4N6N B;  3JVC A;  3BNC A;  3LXU X;  4RNY A;  3CMA 3;  5D81 A;  4XDV A;  2XEP A;  3FG3 A;  4HM2 B;  3X3X A;  2A15 A;  3S67 A;  5D82 A;  1KWI A;  1MNL A;  1UI7 A;  2L4V A;  5STD A;  4XBX A;  3OWY A;  1CYU A;  4IT7 A;  4STD A;  1SPU A;  3FCS B;  5CLK A;  3JUO A;  4R9L A;  3J7Y d;  1IVV A;  1FGT A;  1E3R A;  3KFQ C;  4KZ1 A;  4BTW A;  3EC9 A;  5CXO A;  5EQL A;  4WFO A;  3SOA A;  2RFR A;  4O02 B;  1HKX A;  3T0U A;  3V98 A;  1DMQ A;  1M1X B;  3SLU A;  1YIJ 3;  3CNX A;  4HKV B;  3LTC A;  4QWT A;  1IVX A;  4FMA A;  3S5C A;  1W5Z A;  1IV7 A;  4X2H A;  4R9K A;  3VSY A;  2XFS A;  3RGA A;  3KII A;  1VQ5 3;  3HII A;  1NJI 4;  3HX8 A;  4O3V A;  1NB3 I;  1UUV B;  3ECF A;  2XGN A;  3FF2 A;  4R1K A;  1M1K 4;  3X3Z A;  2BT3 A;  5IF6 A;  1O7P B;  3UL6 A;  1K8A 4;  3CC2 3;  3QK9 A;  4LSO A;  1SJW A;  2C10 A;  3F8H A;  3CU3 A;  2HMM B;  2UX0 A;  3OWS A;  5LC6 A;  3N54 B;  2HMN B;  4H3U A;  4N6M A;  3G6E 3;  3CXC 2;  1CEW I;  2P05 A;  4WYK B;  4IPB A;  3I56 3;  1YJ9 3;  3MG2 A;  1HU9 A;  4N3V A;  1YHQ 3;  2HML B;  3GRD A;  4EBG A;  3BNB A;  4L8O A;  1TIJ A;  2XR8 B;  3B8L A;  8CHO A;  1OHP A;  1YVB I;  2GEX A;  1STD A;  3EX9 A;  2XH9 A;  3NHX A;  1EQK A;  1MOL A;  1LNH A;  1VQP 3;  5KP1 A;  1OAC A;  3FSD A;  3JUQ A;  3Q90 A;  1A2K A;  3F7X A;  1SIH A;  3K5T A;  4MMZ B;  2YX9 A;  3MKI A;  1F8N A;  3RDE A;  3Q1C A;  4HM1 B;  4EXR A;  1OPY A;  3NXJ A;  1W6C A;  1D6U A;  2Q07 A;  1QAK A;  4HJL B;  1VQ7 3;  3WMD A;  1PFP A;  2XFT A;  1VQ4 3;  2CFK A;  3X3Y A;  3KKG A;  1QJG A;  2CKF B;  1YJN 3;  1VQL 3;  3ALA A;  1AR0 A;  5LC7 A;  4AKY A;  1CYV A;  5FGO A;  1RRH A;  1IVU A;  3JUP A;  4I4K A;  3NBB A;  3UJM A;  3LTB A;  3B7C A;  3OWU A;  1YIT 3;  3CC4 3;  1N5P A;  3RGR A;  1A2V A;  2P0X A;  1Q7Y 4;  5DRE A;  2P0M A;  3NV0 B;  3BLZ A;  3BB9 A;  1A90 A;  3T8U A;  1VQ9 3;  1Q81 4;  3MG1 A;  5ELU A;  1J2B A;  4CDL A;  4L8P A;  3CPO A;  5IEP A;  2KRT A;  4FR9 A;  2CWT A;  3FF0 A;  1IV9 A;  3EJV A;  3MYT A;  1FUW A;  1VQO 3;  3M8C A;  4K90 B;  1K73 4;  2IMJ A;  2CW9 A;  3DGL A;  5A0O B;  2W04 A;  4O2H A;  4XBT A;  5TGN A;  2P38 A;  4H61 A;  3SXX A;  3D9R A;  1RKY A;  1WMN A;  3UB1 A;  4L7K A;  2RGQ A;  4LZI A;  3FG1 A;  4K61 A;  3KZT A;  1O7G B;  4KFD A;  4BTY A;  2Z6B A;  3K9M C;  3MSO A;  4FMD A;  5AEW B;  3CME 3;  4N6L A;  1L5G B;  4RBN A;  3OXA A;  2P09 A;  1JN5 B;  3G8Z A;  3EHC A;  3FLJ A;  3LH4 A;  3WA3 A;  3STD A;  3CCS 3;  4R4K A;  4HYZ A;  2CWV A;  5AIF A;  3A76 A;  5CK6 A;  1W7C A;  1OHO A;  4OUQ A;  3MHE A;  1KD1 4;  3SOY A;  2GBW B;  1UW1 A;  3NQZ A;  3FKA A;  5EVH A;  1O7W B;  5G2G A;  4AKZ A;  1N9J A;  2W2C A;  3DGO A;  1Q86 4;  3S27 A;  3AMO A;  3HIG A;  1W02 A;  1JKG B;  3G0K A;  1VQ8 3;  2JDI H;  3VF1 A;  1FGO A;  3LYG A;  3VGN A;  1SQW A;  2CHC A;  1BUQ A;  3HI7 A;  3V92 A;  1DVD A;  4XB5 A;  3I55 3;  2WOF A;  3CNM A;  1AVL A;  1LVN A;  3GAX A;  4X2O A;  1WTH A;  3PZW A;  2CWU A;  5AYR B;  3LOY A;  4WHA A;  1K9M 4;  2OWP A;  5BVB A;  1IT7 A;  1TP6 A;  3V99 A;  5KP3 A;  1E97 A;  1IQ8 A;  3FH1 A;  3HK4 A;  3DXO A;  3F40 A;  3SVA A;  3OV4 A;  3CPW 2;  4Q53 A;  3CCU 3;  5AIG A;  5BXQ A;  3N8B A;  1QVF 2;  3CCE 3;  3LT8 A;  5AEU B;  2O9U X;  6STD A;  1JNQ A;  2F98 A;  4LEH A;  3ER7 A;  2HMK B;  4EV2 A;  5IER A;  3D3L A;  1Q82 4;  1OHS A;  2RCD A;  1IU7 A;  2QGU A;  3Q2P A;  2I9W A;  4HM6 B;  2M7O A;  1JB4 A;  3F8X A;  3FG4 A;  4LGQ A;  3N9H A;  2F86 B;  1LXE A;  1C7H A;  3NQY A;  7STD A;  5IG4 A;  2D42 A;  1SII A;  1W01 A;  5I97 A;  4N6V 0;  1IK3 A;  1JKG A;  3DM8 A;  2GBX B;  1RN7 A;  1FGR A;  2GXF A;  3NM2 A;  1S5A A;  3LT9 A;  1KQS 2;  1E3V A;  2IUJ A;  1OH0 A;  5AII A;  2FNQ A;  3GWR A;  1ZO2 A;  1VQM 3;  1JB5 A;  1JB2 A;  1GY6 A;  1ULI B;  1OF5 B;  2OOV C;  2INX A;  1M90 4;  3U1W A;  2MF7 A;  1US1 A;  1LOX A;  5IEO A;  1G96 A;  1TUH A;  3O8Y A;  3KN4 A;  2GU3 A;  3UNL A;  4NRE A;  2XSO B;  1U8C B;  1V74 A;  3L0R A;  3KE7 A;  4TX4 A;  3CCM 3;  2CFG A;  4AEQ A;  1TU5 A;  2Z77 A;  1VQK 3;  2PZV A;  3CD6 3;  4RNZ A;  4LMI A;  2CC3 A;  1FGQ A;  3PGB A;  2YFJ B;  1KC8 4;  4XM4 A;  2WO0 A;  2BNG A;  2ML5 A;  3MPH A;  3WA2 X;  2ZL8 A;  2F99 A;  3X40 A;  1Q42 A;  2HMJ B;  1YI2 3;  1O7N B;  1FGM A;  1QAL A;  1U5O A;  2K0M A;  1EKM A;  1O7M B;  4G1M B;  2CFD A;  1DYU A;  2CH9 A;  1WMP A;  2OQE C;  4HM4 B;  3KSP A;  4K1V A;  1W6G A;  2IA7 A;  4EC6 A;  1GD3 A;  4U13 A;  5IG0 A;  1FA3 A;  1DVC A;  4HM7 B;  2PNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...