8ESTE

Reaction of porcine pancreatic elastase with 7-substituted 3-alkoxy-4-chloroisocoumarins: design of potent inhibitors using the crystal structure of the complex formed with 4-chloro-3-ethoxy-7-guanidino-isocoumarin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE PANCREATIC ELASTASE
publication title Reaction of porcine pancreatic elastase with 7-substituted 3-alkoxy-4-chloroisocoumarins: design of potent inhibitors using the crystal structure of the complex formed with 4-chloro-3-ethoxy-7-guanidinoisocoumarin.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase(serine proteinase)
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1990-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8estE01
1C2EA 1BBRH 2GX4A 1JIMA 1UK2A 3RDZA 3MNSA 2D8WA 1DX5M 2EI6A 1FY8E 1G3CA 5L6NH 2YNBA 1LHDH 2BY6X 2WPLS 1SGPE 1EJMA 1ZSLA 1DDJA 1BBRK 1G30B 2VJ1A 2OCVB 3SI3H 1QHRB 3BV9B 1V2QT 3KF2A 1XUJA 5A0AE 5AVDA 4I8LA 2H1UA 5FX6A 3BTWE 3TVJB 3LOXA 2ZZUH 1HIAB 2O8MA 1DM4B 1V2RT 1TNGA 2J94A 1EZXC 2ALPA 1BQYA 2ZFRH 4BTIB 8KME2 1VCWA 3SV6A 2FS8A 2Z94A 4K8BA 5FHTA 1P2OA 1IQLA 3PO1B 1ARCA 3ZVAA 3ZZCA 4X8UH 5EQRA 5EODA 2ALVA 4CR9A 2GKVE 5CMXH 1GMDG 3MOCA 3UNQA 1P10A 1RTFB 2Y5GA 4GHTA 2VINA 1MTVA 1AY6H 2Q6FA 1C1UH 2ZFQH 2B5TB 5A8ZA 2GZ8A 3K6YA 1BBRE 2W7UA 1ZMLA 1SGNE 2FDAA 1G32B 1K1LA 2WPIS 4F4OC 1EQ9A 1T4VH 2ANMH 1G3DA 1XUHA 3QLPH 1P3CA 1C2LA 2BOKA 1ZTLA 1TBRH 1NFYA 1GBTA 3A88A 4KELA 1TONA 3GDVA 1DE7H 4Y6DA 4THNH 4BTTB 3UPEA 1A5GH 1P2MA 2V3OH 3PO1C 1O3LA 2VGCB 4DG4A 3NK8A 1FY4A 3Q77A 4AFQA 2ZCLP 5E2PA 1O2PA 4K69A 1EAWA 3HK3B 1V2KT 1ABIH 1K28D 1TMUH 1GBHA 5AFYH 3MO3A 2QYIA 3PB1E 1HAIH 1O2RA 2GMTB 2XC0A 2ANKH 1BA8B 1HV7A 2KAIA 4XDEA 1TNJA 4UONA 2BVXH 3O8RA 3K9XB 1MMJN 2UUJB 3M36A 3SU6A 1C1WH 1C5QA 3U98H 3UWJH 2FLBH 5EXLA 5CHAB 4ISHH 3HK6B 5E8EH 1AVGH 1BRBE 3DHKH 4IC6A 3LH1A 3SUFA 2WPJS 1BTHH 1ZPZA 2FOBA 1IQHA 1ZHPA 3HATH 4ABAA 3RM2H 4BNRA 5FCKA 1RGQA 1DY9A 1TRMA 3AASA 1ETRH 1WAYB 4MTBA 2VGCC 4FUFA 1C2IA 2ZI2H 2VIQA 3RXJA 1Z8IB 2V3HH 3FAOA 1GI2A 3ZZ5A 2GMTC 2DE8A 4NIYA 3SGQE 3KQBA 1L1GA 2HOBA 3F1SB 2AS9A 2VB0A 1TIOA 1AE8H 3MU5A 3CS7A 1HAVB 3F9EA 3SQEE 4BXWA 1IQEA 3ZVGA 2XTTB 1KXEA 1O5GH 2F3CE 5CHAC 1J14A 5L2ZH 2ZTZA 1WQVH 1QJ6B 1MBQA 4O03A 3LT3A 3W95A 4SGBE 2Z7FE 1GGDB 1HAVA 2AGEX 2UUYA 5L2YH 2AMQA 1QRZA 1T7CA 1P06A 1ZSJA 2ODPA 1V2NT 2FPZA 4E7RG 1U6QA 2VIDA 5DP8A 1W8BH 1MBMA 3S9BA 1L0ZA 1O35A 5HXFA 1ZGVA 2D1JA 4AX9H 1TE0A 2GT7A 3OYPA 4KP0A 2Z6BD 4MNXA 1YF4A 2P59A 1XUKA 4KTUA 2A31A 1T8OA 5E2OA 1ZYOA 3SW2B 1E38B 3U9AH 2ZEBA 3UQOA 1C5YB 4TPIZ 4GPGA 3ZZ7A 1LHEH 1QB1A 1UMAH 4D7GA 1E36B 3NXPA 5LGOA 1X7AC 1YC0A 3EE0B 3E16B 3T62A 2C90B 5DGJA 4A7IB 4M7GA 1UTNA 4O3TA 1GGDC 2BDBA 1JMOH 7GCHF 1HJAB 2IOTA 2ZIQH 2ZHDA 4IW4E 1D6WA 2HRVA 1FIWA 1JBUH 3UOUA 1H8DH 5JB9S 1Q31A 4X1RU 1SOTA 2NU3E 2SGAA 4B73A 4DVAU 1V2ST 1P12E 1GDQA 5DP3A 3TNSA 2C93B 6LPRA 4NFEA 4LXBH 4FUGA 4FU9A 3H5CB 1YP9A 4A5TS 4MLFB 4OS1A 1KSNA 9LPRA 2XRCA 1K1PA 4ABIA 4FUHA 3UR9A 3MO9A 3QUMP 2QGRA 3U1IB 3MU1A 2F9PA 4AB8A 1G9IE 1BMNH 4K1TA 1BTYA 1AZZA 2AYWA 2C8ZB 1TNHA 4FU7A 5FPTA 1E0FD 4DW2U 1FONA 3RU4D 3OY6U 5EXMA 2UWOA 1LVYA 5C2ZA 2PWXA 1SLVB 1FUJA 1HDTH 1S6HA 1HJAC 2CHAB 4I8JA 2QAAA 1H1BA 1QJ1B 2FODA 1LHCH 3SU0A 1TA6A 4GHQA 1QCPA 1ZJKA 2ZQ2A 5LPEA 1GJBB 2P94A 4KKDA 1QQ4A 1K2I1 2FLRH 1GJDB 1SOZA 5L30H 2CGAA 1OS8A 1GJ9B 3BTDE 1P2KA 1TALA 1SHHB 1BMMH 1NO9H 3AW1A 5CE1A 3VB5A 3UFAA 3Q3XA 3T25A 4ISIH 1GJ8B 1EJNA 1WV7H 3FZZA 3GCTG 3RXKA 2G4UA 4NWKA 4WMDA 1C5VA 4ABGA 2AEIH 1FY5A 1EOLA 3AAUA 4WXIA 1OXGA 4MPXA 3V12A 2UWLA 2FOAA 4FUBA 3GY2A 3P70B 3SUEA 4DJZB 2CHAC 3F68H 2CJIA 3ITIA 1P8VC 2ZPQA 1GBBA 4UDWH 4Y76A 1L1JA 3PWBA 3SNEA 2VNTA 3EA7A 4GVUA 2ZCHP 6GCHG 1SMFE 2ZQ1A 1NZQH 3LGYA 2FZZA 1KIGH 3JZ1B 4JZ1A 1TX7A 1OWDA 1AKSB 1F7ZA 1O2QA 2HNTF 3MYWA 3IITA 4TWYA 3PTNA 1T31A 2BTCE 1V2MT 3U8RH 2H9EH 1YCPH 2R3UA 4CRDA 1DS2E 2HVXA 1AIXH 3W94A 3RXLA 2OP9A 1K21H 1NRRH 1W2KH 2AH4X 1MD8A 3BEFB 1OX1A 4ABJA 1XUFA 3BTQE 4I7YH 1B5GH 2XXLA 1EATA 3P95A 1TQ7B 1PQ8A 1GHAF 2SGEE 1GL0E 1Z8JB 4RKJB 1CHOG 1AUJA 1O31A 1LDTT 1TMTH 2D26C 2ZFPH 3ZVEA 3ZV9A 5JBTA 5A09A 1ELAA 1H9IE 3OU0A 1AMHA 1EPTB 4INKA 3PYHA 3F6UH 2WPHS 1FN6A 1C4U2 5GPIB 4RSPA 3VPKA 1O2UA 2AIQA 3ATKA 2BDYA 2PGQB 3ZZ9A 1EPTA 2BX3A 1QNJA 2W5EA 5F8TA 1QB6A 2GZ7A 2J9NA 2ZPSA 3BF6H 1UJ1A 3PLKA 3A86A 1AWHB 4IN1A 1Y3UA 3E0NB 4MG3A 5DP4A 3BSQA 3T28A 3RXMA 8GCHF 4AOQA 1XM1A 2FTLE 3BG8A 1FMGA 1O2HA 3S0NA 3L6PA 4Y0ZE 1O5AB 1W0ZU 1Z6EA 4ABFA 1L2EA 2ZKSA 5EW2H 1TNKA 1BIOA 5SGAE 2HPQH 1M9UA 1GBJA 1V3XA 2QIQA 3QK1A 4YM9A 1EPTC 2BY5X 2FWWA 1D3PB 5C1YA 2XYAA 1TX8A 3O8BA 3QTVH 2AMPA 1NRNH 4AFSA 4A1XA 1DWCH 3OTJE 4FXGH 1A0HB 1DANH 3ESTA 4RN6A 1C5RA 2HNTE 2ZO3H 1LTOA 2PR3A 5TCAA 1IHTH 4H6TA 1DWBH 3M5NA 3SN8A 1H8IH 1Y8TA 2B7DH 2QY0B 3MNXA 3ODDA 2RDLA 1HNEE 3L33A 3UIRA 2A5KA 1GBLA 3M5LA 1NFXA 2G5VA 4I33A 3TJVA 1BHXF 1BDAA 4OS7A 3DUXH 1O3BA 1DSTA 2PTNA 1IQFA 3TNTA 4RKOB 1YCPM 4AN7A 1YPLH 4O9VA 2OD3B 5E0GA 3SOSA 1C1MA 1TABE 1MCVA 1TPOA 2GTBA 1TGTA 3E3TA 5HYOA 1VJ9U 2Y82A 1QBOA 4O3UA 3E6PH 2ZU4A 5FX5A 1O3CA 3MH6A 3G01A 2BDIA 5EQSA 1YPJH 2XC5A 1OP0A 2A4QA 2F83A 2OC8A 3MU4A 1UVUH 3A83A 1SQOA 3E1XB 3LJOA 3ATWA 1HAZB 1TNLA 2XBXA 2ASUB 4X6PA 3RC5A 3SJIA 3UREA 2HLCA 3A81A 2NU4E 3TJNA 3M61U 1MKXK 2RG3A 4E05H 1SGIB 5PTPA 1S83A 1ID5H 2GVFA 1UK4A 1ANDA 1P2NA 3BTFE 1C9TA 1HAHH 3MNCA 5DO4H 2A32A 3I29A 3VFEA 1ELTA 2AFQB 4CR5A 3GCHB 2CN0H 1SPJA 1EAIA 3QZQA 2QXIA 3ODFA 4AZ2B 1O39A 3F9GA 1IQMA 5HM9A 1MAXA 1UO6A 3OX7U 2FOGA 3LC5A 5AF9H 1P05A 3RLYH 3H7OA 3L3TA 1IQIA 1GWAA 2HWLB 2R2WU 2A0QB 1ZTJA 1PQ7A 2FP7B 4Q7ZA 2ZDMA 1D3DB 1VCPA 4XBCA 3SV7A 1E34B 3B23B 2OBQA 2ZGCA 5A2MH 3LIWA 1LVMA 3URDA 5C1UA 2ZP0H 1V2UT 1FXYA 2GDEH 3M35A 1ETTH 1O2GH 1BOQA 3TK5A 4X1QU 4H4FA 4XE4A 4X8TH 4AFZA 2I6QA 2GD4B 1W7XH 3GCHC 1V2TT 2QF0A 4NZLA 1C2HA 4LK4A 2HPPH 1V2JT 1HBTH 2OQUA 4ZXYH 3TGIE 1O3DA 4X2WA 3QTOH 1O38A 2P93A 1KXDA 1ZZZA 3EQ0H 1C1SA 4I8GA 1BCUH 2G51A 4UEHH 1TRYA 2Y81A 1F0UA 2SNVA 4YESB 1A0LA 1SL3A 2A2QH 1PPFE 5DP7A 3BEUA 5DP6A 3KL6A 4FUEA 5C67A 2RCEA 3BTKE 1OOKB 3Q00A 4WJG2 4GSOA 1C5SA 3TITA 1MU6B 1DUEA 1CO7E 1EP6A 1GI4A 4JMYA 5DG6A 3VB3A 1HAOH 1AE5A 1LHGH 2VIPA 2ZDLA 1Y5AT 1KY9A 2A5AA 2ZF0H 4ISNA 1QURH 1GL1A 2ZDKA 1BJVA 2EEKA 1TYNA 4X2YA 2R9PA 1GBMA 4SGAE 1K9OE 1C2FA 1TPSA 2QA9E 2EC9H 2GV6A 2XC4A 2BD8A 4KTSA 4OS2A 1BTXA 3RU4T 4ESTE 1O2XA 4IS5A 2BD7A 3LGVA 2PSYA 3FP7E 1HAYB 3TPIZ 2BXTH 3EA8A 3SV9A 3P6ZB 5C20A 1T32A 2FXRA 3F9FA 2BVRH 1FY1A 3QX5H 1J16A 3FVFB 4U01A 1ETSH 4YT7H 2CXVA 5DKMA 3A8BA 7GCHG 2TIOA 1TGNA 1DVAH 5C1XA 2J95A 5JB8S 1TGSZ 3GY5A 2R0LA 1UTLM 1GI0A 3GDSA 1C2DA 2WUBA 2ZGBH 2ZDNA 4NSYA 2KAIB 3MI4A 1QQUA 3QGJA 1C2JA 1GBFA 4HGCA 4CBOA 3VEQB 2HNTC 4CRGA 1GHBF 4D7FA 1KTSB 2Y5HA 3T29A 3ZZ6A 4HFPB 4GLYA 1H9HE 3A87A 1N1LA 3RXUA 1K1OA 1ZOMA 2GT8A 1NS3A 2BVSH 4WF8A 4BAHB 3SNDA 1Y3WA 1OP2A 4X6OA 1XVOA 3AVZA 2OTVA 3SUGA 1A0JA 1DWEH 3GY8A 1Y5BT 4X2XA 1QIXB 1IOEA 2PLXA 3SNBA 2QF3A 1TOCB 3M7TA 1P04A 1MU8B 1F5RA 1Q2WA 3S9AA 5DP9A 1LPZB 1C1NA 4AGJA 3TGKE 3KQEA 1B0EA 2GCHF 1AZ8A 2SNWA 1O2JA 3MO6A 2FESH 2FI4E 3QO6A 2Z9IA 4B1TA 1HXFH 4JZDH 1AD8H 1W11U 4BXSA 1AFQB 1PQ5A 1ZMNA 1V2WT 2YNAA 2ANWA 4CRFA 1CA8B 2B8OH 4MNWA 2XNIA 3VB7A 1NRQH 1GHYH 4MQAA 3BIVH 5IDKA 1ZRKA 3LKWA 1O2ZA 1C2GA 4D8NA 1GJAB 1O5EH 2GGVB 3O8DA 4IGDA 3SU3A 1SVPA 3KHVA 2B0FA 3BTME 2OQ5A 1ESBA 1VGCB 1KXAA 1GJ5H 1XKBC 2F91A 2ZGHA 3ATIA 1C2MA 2LPRA 3QWCH 1DLKB 1A2CH 2FX6A 4BAQB 1O32A 3ZZDA 2BDGA 1ELVA 2ZPRA 1Z8GA 2W3IA 4CRBA 2OUAA 3LGWA 2JH6D 4B2AA 2VIWA 3RXOA 3PLBA 3D23A 2FYRA 2NU2E 4HZHA 4WVPE 1ZRBA 2ZU5A 1O3GA 2O9QA 1O2OA 2ODQA 3RXRA 3T2NA 1GJCB 2FS9A 3U8TH 3PM3A 1BT7A 1AFQC 2UWPA 4JK5A 1AGJA 3PMHB 1L1NA 1ACBE 1AN1E 2OC1A 4AYYB 1O2IA 4B74A 2W3KA 4GAWA 1NRPH 4Y0YE 3SU1A 1ANCA 1UHBB 4X6NA 4YOIA 1HB0B 1GHAG 1VGCC 3UTUH 1T8MA 3STIA 1PPHE 1E37B 2ZHQH 3SU2A 1UHBA 2HGTH 2O8WA 3RC4A 1WUNH 3SU5A 2ZTYA 5GCHF 4MNVA 2GCTB 3LGUA 1KLIH 4X1PU 1NROH 3ZZBA 2ZECA 2JETB 3KIDU 2D2DA 3EGKH 4XSKU 3ATMA 2G81E 3CP7A 1O5BB 1A46H 3GISB 5J4SA 4IMQA 1SHYA 3Q3KA 1Y59T 2WYGA 1MH0A 1AQ7A 2IPHA 2DE9A 3VXFH 1SG8B 3B9FH 2V6NA 1Z8RA 1A5HA 3GY4A 1DFPA 4CH2B 1G3EA 2H9TH 7KMEH 1LVOA 8GCHG 2Q6GA 5FBEA 2JH5D 3HKJB 3S7HB 1Z1IA 3SJOA 5FPYA 2RA3A 5JBAS 3B8JA 3HPTB 1NM6A 2BHGA 3FFGA 4XBBA 2P8OB 3T27A 4YZUA 1PPEE 3RXIA 3R0FA 4JYVH 3A85A 1P2IA 2CF8H 3SUDA 3GCNA 5A8XA 1LPGB 1ZHMA 2GCTC 2JETC 3GCOA 2VVCA 1EXFA 4DOQA 3RUOA 2PHBA 2C8WB 4Q80A 2A5IA 2O8LA 2EI8A 5JYIA 4QT8C 4J2YB 3VB6A 1EB1H 3FZDA 1V2LT 4I8HA 2Z3CA 1MQ5A 1TBZH 1LHFH 1FY3A 3VB4A 5E0HA 5T6DA 1TB6H 1HCGA 1UCYH 2H5DA 1P0SH 2P8OC 4TWWA 3RXPA 1JIRA 4J1YA 2BD4A 4FVBA 4AFUA 1OKXA 1O2KA 4ZXXH 1QRWA 4YOJA 4IN2A 4E06H 2FX4A 1UCYK 4R8TB 3NZIA 2P3FH 2J4IA 3BTHE 1AU8A 2EI7A 3SGBE 2FOHA 1GI5A 1PPZA 1QGFA 3MU0A 5LPFA 1SGTA 2OC0A 3QN7A 5EW1H 1JRTA 3SJ9A 1O3NA 2JH0D 1UK3A 1YCPK 5EU8A 1DLEA 1ELDE 1UVOA 1WYKA 2TBSA 1ZTKA 1S82A 3MHWU 3ZV8A 1O3HA 1EB2A 1P02A 3TU7H 4ZMAH 4I31A 3RLWH 3E0PB 4JCNA 3NKKA 4MDSA 4K8YA 4DCDA 1GDNA 4GCHF 4XOJA 3LGTA 2PFEA 1NPMA 3LC3A 2PUXB 4BAMB 3FP6E 2BD2A 1DXWA 1VCQA 2Q6DA 3BEIB 1LO6A 4NA7A 4Y7BA 4Y10E 1J9CH 1O5DH 1SSXA 4BAKB 4U2WA 1UCYE 1OYTH 3DFLA 1O0DH 3S7KB 2QXGA 1ZJDA 3A7WA 3A7ZA 3PROA 2PKSB 4X8SH 3PMJA 3SHCH 1Y3YA 2BLWA 2NWNA 4H42U 1C4Y2 3O8CA 1F5KU 1TGBA 2G5NA 3PV4A 2XW9A 1FJSA 1F0TA 1TLDA 8ESTE 3GICB 1WBGB 4AORA 3RXCA 4I32A 3V7TA 4K1SA 1C5WB 1GCDA 3P92A 1P3EA 1PJPA 1O2LA 2OLGA 4Q2KA 1OWKA 1AVXA 1ARBA 1THRH 1GMCG 3A7TA 4K2YA 2FOEA 1KXFA 1P03A 3ZVDA 1TPAE 2XWBI 1PYTC 1V6DA 4OGYA 3QGNB 1KYNA 4AB9A 4LZ1H 3DFJA 2ZU2A 1INCA 2JKHA 1GBKA 1T8NA 1SQTA 2ZTXA 2VIOA 2BDAA 1SLXB 4IMZA 1MTWA 1CQQA 5J4QA 3RXGA 3GY6A 5IYTA 5T6GA 4JYUH 1TGCA 1HUTH 2PKSC 1QBNA 2ZA5A 3LH3A 3S9CA 1MTSA 1GDUA 1ANBA 1K22H 1YPMH 2Y5FA 2K1QA 4Y8XA 2BY7X 1GBEA 4ABHA 2G55A 1FLEE 1FPHH 2G00A 1RD3B 3D65E 4Z6AH 4A1TA 2A4RA 1EOJA 1O2VA 2UUFB 1FDPA 4Y7AA 4YT6H 1PPGE 3TH4H 1QTFA 1BTUA 4YTAA 1IQGA 1W10U 1RJXB 5EOKA 1IQKA 2BMGB 2ZGJA 2A4GA 3RM0H 4YLUA 1BRCE 2UUKB 2GP9B 2ZU3A 1ZR0A 1KXCA 1A7SA 1CBWB 3M3TA 2AIPA 5A0CA 1QL9A 2TGTA 4UFFH 2EA3A 5FXLA 4NSVA 1ZGIA 3E8LA 2XBVA 4UFEH 5A8YA 3D49H 4ZKSU 2BZ6H 1CT2E 4K3JA 1YYY1 5JBCS 4ZHMU 1EKBB 1BTWA 2VWLA 1SFIA 3C27B 2NU0E 1HFDA 2GDDA 4R0IA 5BRRE 4NZQA 1LQEA 1HPGA 2R0KA 2TGPZ 2P3UB 3A8AA 4CREA 1TQ0B 1BRAA 2THFB 1EZSC 1HJ8A 1BRUP 2PTCE 4B2CA 2QXHA 1YBWA 4AG1A 1SI5H 1N8OB 4ZROA 4MNYA 1XUIA 3KGPA 1NY22 5F6MA 2Y80A 3ZZ4A 1RS0A 1QFKH 5FAHA 1LKBA 3UNRA 1QJ7B 2BLVA 4YOGA 5EGMA 2I6SA 3OSYA 2WUCA 1D9IA 3GY7A 1MCTA 1SGYE 3K6ZA 3BTGE 2WV4A 2G52A 4B71A 1GHBG 3EDXB 5GIBA 4XFQA 1FIZA 1K1MA 2FO9A 2C3SA 1L4ZA 2CMYA 3GY3A 3TIUA 1CT0E 2RA0A 2ZDVH 1GI8B 1S6FA 1GMCF 2Z9GA 3ZVBA 5F8ZA 3RXAA 1QBVH 3ENSB 4PROA 1G3BA 4CRCA 1T8LA 1HYLA 2QV1A 2M5TA 1C5OH 1N8OC 1AUTC 4H6SB 1C4V2 2WINI 4VGCB 1GBIA 1GHZA 2ZHEH 3KEEA 3P8GA 2VH0A 5DPAA 2DUCA 1W13U 5TJXA 4JZFH 3DA9B 9ESTA 4Y8ZA 1FAKH 2FOCA 4MPVA 1UVSH 3BTEE 2PV9B 3V3MA 1VJAU 2V35A 3TJUA 3WY8A 2GCHG 1LQDB 1S0QA 1UTJA 3NCLA 3RXHA 4ISLA 1E35B 2GZ9A 3RC6A 1GI1A 3DT0H 1MUEB 2Q1JA 2VWMA 4JZEH 1TRNA 3I77A 4D9QA 1QL7A 3SO3A 4U30A 1DSUA 3UOPA 4ABBA 1F2SE 4ZHAA 5I46H 1RFNA 2OXSA 2J2UA 5GXPA 1P2JA 1ZPCA 5BPEA 2OC7A 3LGIA 3MH4A 4TYDA 2QXJA 2IJOB 3LDXH 1BUIA 1PFXC 3KQCA 1D3TB 1OPHB 2WPKS 4VGCC 3PMAB 2BLOA 1EUFA 1AI8H 1VITF 1BJUA 1GVLA 3SBKA 1P9SA 2Y7XA 1LCYA 4WXVA 5DP5A 4OS6A 1O2MA 1TNIA 5EQQA 3RMOH 1JWTA 5TCCA 4MPWA 4FUDA 1HLTH 5AHGH 4KGAA 5C3NA 2BD9A 4NFFA 2XBWA 3M37A 2FOFA 1EASA 3RU4E 1BB0B 3A84A 2PGBB 1ZSKA 1CE5A 1LKAA 1W14U 4A92A 3KCGH 1HIAA 5I25A 1C1VH 1XXFA 1VZQH 1GI6A 2LNCA 2VIVA 3IG6B 1MTNB 1OWEA 3CS0A 3C1KA 3RXQA 3PTBA 1O37A 4UE7H 3HGPA 1XMNB 1MQ6A 5G4BA 2ZHWH 1O5CB 1VITH 4NCYA 1NT1A 2TGDA 1OYQA 1AFEH 2TRMA 3STJA 1YPKH 2BZAA 1A4WH 2C4FH 4B76A 1AO5A 1BTPA 1QR3E 4DIHH 1TBQH 1WCZA 1YLCA 2A7CA 3RXVA 5GCHG 2BQ6B 1YLDA 3TLOA 2YOLA 2AERH 4D76A 1ANEA 1C5ZB 2ZFSA 5LH8A 4CRAA 5FPSA 3A7YA 3BIUH 4Y79A 1CU1A 1J8AA 2ZDAH 4OS5A 4X8VH 1Y5UT 3LU9B 1C5NH 3VGCB 3P8NA 4UFGH 2FM2A 3KNXA 4NA8A 1MTNC 2XCFA 1L4DA 4ZKRU 1BITA 1QL8A 1AB9B 4BOHA 3A8CA 2J38A 1S85A 1G36A 1WU1A 1SGRE 3I78A 1YPEH 1EZUC 2Z3EA 2ZFTA 1H9LB 3M5MA 3M7QA 2STBE 1ESTA 2F9BH 1GMHG 3HGNA 4DIIH 2VU8E 4WY3A 1YPHE 5K0HA 4DGJA 5B6OA 1OP8A 1PPCE 1JXPA 1ABJH 1TWXB 1P2QA 2ULLA 2F9UA 2PSXA 3RXEA 3ATLA 2G4TA 2Z9KA 2AMDA 3UY9A 2BYAX 1T4UH 3A8DA 1K1IA 3VGCC 1HAGE 3LONA 3RMNH 3RXTA 1XKAC 1EAUA 4NIWA 4X2VA 4CHAB 1O2NA 1PQAA 1A61H 2B9LA 3MNBA 1K1NA 1S81A 1AB9C 2ESTE 1J17T 1BHXB 1W0YH 2A1DB 4E7NA 1C1TA 1KDQB 2C8XB 1DICA 4DY7B 3MMGA 1AHTH 1CSOE 1GI3A 2Y7ZA 3EAJA 3GYLB 5JDUB 2P95A 3LPRA 1KDQA 4JYTA 1D6RA 1YGCH 4ZAEA 1P11E 2BM2A 4INHA 4ZHLU 5ABWA 2TGAA 2J34A 3A7VA 1WTGH 2FOMB 1O3FA 1FV9A 1O3PB 2A7HA 5HGGA 1SB1H 4ZH8A 1OWJA 1O34A 3TH2H 1KLTA 1F5LA 1QA0A 4NIXA 1PPBH 1C1QA 3K2UA 1MKWH 1C5UA 1GMDF 1V2PT 2AGIX 1SQAA 1W3CA 1WTHD 3UUZA 4CHAC 4Y11E 4A1VA 2XCNA 1TAWA 2WV5A 6ESTA 1YM0A 1BTZA 1MZDA 5DJ7A 1NRSH 2BLQA 6CHAB 1JRSA 5JBBS 3ZZ3A 1SGCA 4D9RA 1MTUA 2A4OA 4GCHG 2ZHFH 3M7UA 3FANA 2BX4A 1MKWK 1SLWB 3SU4A 1Z71A 2FEQH 1CA0B 1DWDH 1ZLRA 2ZG0H 1BMAA 1HRTH 1MZAA 2BD3A 2SGDE 5F8XA 1O2YA 3MFJA 3ZVCA 2VVVA 1RTLA 2BOHB 1GVZA 3T26A 2C8YB 4DT7B 5H4IB 4Y8YA 2WYJA 1QB9A 4X6MA 3M3SA 2OBOA 1GVKB 1O2SA 3A82A 4K5ZA 2R3YA 1FI8A 3NUMA 5C5NA 3A89A 1OSSA 1A5IA 1C5TA 1O3KA 5GWZA 1CHGA 4Z0KA 1C5MD 1TPPA 1THSH 1GJ7B 1A3BH 6CHAC 1FQ3A 1RTKA 3GDUA 8LPRA 3QDZB 2H2ZA 1N6XA 1O2WA 4NG9H 4IBLH 1DXPA 2G8TA 1GJ6A 1IQJA 4Q7XA 2VWOA 1P9UA 1ELBA 1GI7B 1O33A 1C5PA 1CA0C 3GYMA 1GI9B 1GMHF 4OS4A 3R3GB 1WQSA 1WOFA 4I8KA 3UR6A 1UTOA 4JK6A 2HALA 4F49A 3MU8A 1EX3A 3V0XA 3E90B 2ZNKH 5T3HA 1QRXA 3U8OH 4B2BA 2ZCKP 1FAXA 3SGAE 2STAE 2ZC9H 1EP5A 1BZXE 4Q7YA 1NU9A 3F9HA 3SJ8A 5T6FA 1OWIA 7ESTE 1GBCA 1SC8U 2NU1E 1SGDE 3MH7A 2SGQE 3DD2H 3RXSA 1HJ9A 5A0BA 1KXBA 1S5SA 4FU8A 1ELFA 3RMMH 1C1RA 1ZMJA 2Z9JA 4K60A 3BG4B 1THPB 2A45B 1V2VT 1FNIA 3SV2H 4WH8A 4FUCA 3TH3H 3N7OA 2VVUA 1Q3XA 3VXEH 2CF9H 1SGFA 4YO9A 3RMLH 1O3EA 5JPMH 1LMWB 3GOVB 1RIWB 1WSSH 1DITH 2IN2A 1CGIE 1H4WA 3PLPA 3TK6A 1V2OT 1B7XB 2PW8H 3A80A 5FCRA 3TK9A 2QN5T 4FUJA 1F0RA 4X1NU 2F9VA 3QZRA 3UQVA 1CT4E 4JZIA 4Y71A 1O36A 1EZQA 3SZNA 1UTKA 1QA7A 2PUQH 1W12U 3M5OA 4WH6A 2XBYA 1TMBH 4TY6A 1LVBA 1AKSA 2FI5E 1P57B 1FN8A 4ZUHA 1TA2A 3ZZAA 1GPZA 4WMFA 1FPCH 1GHXH 2BDCA 2ZWLH 5LPRA 3P8OA 1DT2A 3BG4C 2PKAB 1YKTA 2BDHA 1NESE 2H6MA 1HXEH 1O3IA 1EJAA 1F92A 1O3JA 3OY5U 1UTMA 3KQDA 2V0BA 3M3VA 4K1EA 1Z6JH 1YPHC 4ABEA 4GUXA 1RIWC 4ABDA 3K65B 2PKAA 1Y3VA 3SJKA 4CH8B 1SGQE 3H7TA 4ISOA 1O2TA 3D62A 1GJ4H 4HTCH 2SFAA 1W7GH 1O5FH 5GJ4B 1PYTD 2ILNA 3RXDA 4BTUB 5C5OA 4ZKOU 4HI3A 1C2KA 1TFXA 1O3OA 1IQNA 1O3MA 5EG4A 3P17H 4OGXA 3SNAA 5K7RA 1SGEE 4NWLA 2BB4A 2P16A 1DOJA 2GV7A 1UTPA 4X1SU 1UTQA 5ESTE 4NIVA 2XWAA 3MH5A 2BXUH 2ZU1A 3PWCA 4NGAH 5DK1A 1SR5C 1F0SA 2AGGX 2BD5A 1HAPH 1J15A 1BMLA 1XXDA 2ANYA 2W26A 3ZYEA 1P09A 1D3QB 1D4PB 1NC6A 2FMJA 1UVPA 2TPIZ 1GHVH 3SQHE 1LPKB 1Y3XA 1VR1H 3EYDA 3AAVA 1MAYA 4B75A 2O8UA 1CGJE 4TPYA 1GBDA 3ELAH 2ODYB 2QCYA 1SGFG 1HAXB 2A2XH 4UFDH 7LPRA 1OWHA 4MVNA 1SFQB 1Z1JA 3CENA 4DURA 3URCA 5ESBA 1VITG 4XBDA 3NWUA 3GCTF 4UD9H 5GDSH 5HM2A 1IHSH 1YPGH 2R2MB 4YLQH 1NFUA 5F03A 1GG6B 3RXBA 1ZHRA 3MTYA 1C9PA 4CBNA 3A7XA 4MPUA 6GCHF 3SNCA 3SI4H 3HKIB 2BQ7B 3RXFA 1DUAA 1ORFA 1XUGA 4AG2A 2FI3E 1GCTB 3BN9A 1ZPBA 3U69H 2FIRH 2CV3A 2BY8X 4X0WU 1HGTH 1K1JA 1RRKA 4NA9H 3TGJE 1G2LA 1ELCA 1IAUA 2OINA 2WPMS 1C5LH 3P8FA 1NN6A 1MKXH 1ELEE 3BTTE 5ETXA 1G2MA 4ZKNU 5EXNA 4U32A 1JOUB 2BQWB 3PMBB 2H5CA 2F9NA 1C5XB 1TOMH 3RP2A 2SGPE 4BAOB 2Z9LA 1CBWC 1Z7KA 1RXPA 4A6LA 4FVDA 1GHWH 2VH6A 2FTMA 1C1PA 2FYQA 3MWIU 2P3TB 2H9HA 3U1JB 4INLA 1GG6C 2Y6TA 1DY8A 1KLJH 1O30A 1CHOF 3TJOA 1A1RA 5FBIA 4BANB 5E0JA 1ESAA 1CGHA 2ZFFH 1ELGA 1FZZA 1P01A 1GCTC 3SORA 1S0RA 1DPOA 2QC2A 4WWYA 3UNSA 1NFWA 4O97A 1G37A 2W7SA 4LOYH 4AGKA 3T5FH 2SGFE 3FP8E 1SLUB 3SHAH 3EA9A 4LZ4B 1KTTB 1EAXA 3Q76A 4IC5A 3KN2A 1AWFH 3AW0A 1CVWH 5EPYA 5HMAA 3IWMA 2Z3DA 1AVWA 1XVMA 3ZVFA 3ZYDA 2J92A 3V13A 1N6YA 1XX9A 5AFZH 1GBAA 1NTPA 1TX6A 3E91A 4ASHA 1C1OA 1O3AA 2VWNA 4KTCA 2BY9X 1UVTH 5EPNA 1A3EH 3SV8A 2F9OA 3JZ2B 4TY7A 1QY6A 3S69A 1S84A 2A7JA 2O8TA 2ZGXH 3LJJA 3NPSA 3UWIA 1B0FA 1MD7A 4FUIA 3ZZ8A 4AYVB 3Q3YA 1SBWA 1NU7B 4WMEA
chains in the Genus database with same CATH superfamily
1C2EA 3KQ5A 1SKYE 1BBRH 2GX4A 1JIMA 3F2GA 1UK2A 3RDZA 1E79D 3MNSA 2D8WA 1DX5M 2EI6A 1FY8E 1G3CA 5L6NH 2YNBA 1LHDH 2BY6X 2WPLS 1SGPE 1EJMA 1ZSLA 1DDJA 1BBRK 1G30B 2VJ1A 1E1QD 1UW7A 2OCVB 2WHXA 3SI3H 1QHRB 3BV9B 1V2QT 3KF2A 5KECA 1XUJA 5A0AE 5AVDA 4I8LA 2H1UA 5FX6A 3BTWE 3TVJB 3LOXA 2JJ1D 2ZZUH 1HIAB 2O8MA 1DM4B 1V2RT 1TNGA 2J94A 1EZXC 2ALPA 1BQYA 2ZFRH 4BTIB 8KME2 1VCWA 4B6EA 3SV6A 2FS8A 2Z94A 4K8BA 5FHTA 1P2OA 1IQLA 3PO1B 1ARCA 3ZVAA 3ZZCA 1W0KD 4X8UH 5EQRA 5EODA 2ALVA 4CR9A 2GKVE 5CMXH 1GMDG 3MOCA 3UNQA 1P10A 5EIYA 1RTFB 2Y5GA 4GHTA 2VINA 4ZCNA 1MTVA 1AY6H 2Q6FA 4F55A 1C1UH 2ZFQH 2B5TB 5A8ZA 2GZ8A 3K6YA 1BBRE 2W7UA 1ZMLA 2AHME 1SGNE 2FDAA 1G32B 3OEED 1K1LA 2WPIS 4F4OC 1EQ9A 1T4VH 2ANMH 1G3DA 1XUHA 2IPQX 3QLPH 1P3CA 4HG6A 1C2LA 2BOKA 1ZTLA 1TBRH 1NFYA 1GBTA 3A88A 4KELA 1TONA 3GDVA 1DE7H 4Y6DA 2J97A 4THNH 4BTTB 3UPEA 1A5GH 1P2MA 2V3OH 3PO1C 1O3LA 2VGCB 1KMHB 4DG4A 3NK8A 1FY4A 3Q77A 4AFQA 2ZCLP 5E2PA 1O2PA 4K69A 1EAWA 3HK3B 1V2KT 1ABIH 1K28D 1TMUH 1GBHA 5AFYH 3MO3A 2QYIA 3PB1E 1HAIH 1O2RA 2GMTB 2XC0A 2ANKH 1BA8B 1HV7A 2KAIA 4XDEA 1TNJA 4UONA 2BVXH 3O8RA 3K9XB 1MMJN 2UUJB 3M36A 3SU6A 1C1WH 1C5QA 3U98H 3UWJH 2FLBH 5EXLA 5CHAB 4ISHH 3HK6B 5E8EH 5C17A 1AVGH 1BRBE 3DHKH 4IC6A 3LH1A 3SUFA 2WPJS 1BTHH 1ZPZA 2FOBA 1IQHA 1ZHPA 3HATH 4ABAA 3RM2H 4BNRA 5FCKA 1RGQA 3FOAA 1DY9A 1TRMA 3AASA 1ETRH 2OK5A 1WAYB 4MTBA 2VGCC 4FUFA 1C2IA 2ZI2H 2VIQA 4M9FA 3RXJA 1Z8IB 2V3HH 4F48B 3FAOA 1GI2A 3ZZ5A 2GMTC 2DE8A 4NIYA 3SGQE 3KQBA 1L1GA 2HOBA 3F1SB 2AS9A 2VB0A 1SQRA 1TIOA 1AE8H 3MU5A 3CS7A 1HAVB 3F9EA 3SQEE 4BXWA 1IQEA 3ZVGA 2XTTB 1KXEA 1O5GH 2F3CE 5CHAC 3VG8A 1J14A 5L2ZH 2ZTZA 1WQVH 1QJ6B 1MBQA 4O03A 2QF4A 3LT3A 3W95A 4SGBE 2Z7FE 1GGDB 1HAVA 2AGEX 2UUYA 5L2YH 2AMQA 1QRZA 1T7CA 1P06A 1ZSJA 2M2AA 2ODPA 1V2NT 2FPZA 4E7RG 1U6QA 2VIDA 5DP8A 1W8BH 2RDEA 1MBMA 3S9BA 1L0ZA 1O35A 5HXFA 1ZGVA 2JIZD 2D1JA 4AX9H 1TE0A 2GT7A 3OYPA 4KP0A 3W1EA 2Z6BD 4MNXA 1YF4A 2P59A 1XUKA 4KTUA 2CK3D 2A31A 1T8OA 5E2OA 1ZYOA 3SW2B 1E38B 3U9AH 2ZEBA 3UQOA 1C5YB 4TPIZ 4GPGA 3ZZ7A 1LHEH 1QB1A 1UMAH 4D7GA 1E36B 3NXPA 5LGOA 4P02A 1X7AC 1YC0A 3EE0B 3E16B 3T62A 2C90B 5DGJA 4A7IB 4M7GA 1UTNA 4O3TA 1GGDC 2BDBA 1JMOH 7GCHF 1HJAB 2IOTA 2ZIQH 2ZHDA 4IW4E 1D6WA 2HRVA 1FIWA 1JBUH 3OAAD 3UOUA 1H8DH 5JB9S 1Q31A 4X1RU 1SOTA 2NU3E 2SGAA 4B73A 4DVAU 1V2ST 1P12E 1GDQA 5DP3A 3TNSA 2C93B 6LPRA 4NFEA 4LXBH 4FUGA 4FU9A 3H5CB 1YP9A 4A5TS 4MLFB 4OS1A 1KSNA 9LPRA 2XRCA 1K1PA 4ABIA 4FUHA 3UR9A 3MO9A 3QUMP 2QGRA 3U1IB 3MU1A 2F9PA 4AB8A 1G9IE 1BMNH 4K1TA 1BTYA 1AZZA 2AYWA 2C8ZB 1TNHA 4FU7A 5FPTA 1E0FD 3DSPA 4DW2U 1FONA 3RU4D 3OY6U 2LP6A 5EXMA 2UWOA 1LVYA 5C2ZA 2PWXA 1SLVB 1FUJA 1HDTH 1S6HA 1HJAC 2CHAB 4RT1A 4I8JA 2QAAA 1H1BA 1QJ1B 2FODA 1LHCH 3SU0A 1TA6A 4GHQA 1QCPA 1ZJKA 2ZQ2A 5LPEA 1GJBB 2P94A 4KKDA 1QQ4A 1K2I1 2FLRH 1GJDB 1SOZA 5L30H 2CGAA 1OS8A 1GJ9B 3BTDE 1P2KA 1TALA 1SHHB 1BMMH 1NO9H 3AW1A 5CE1A 3VB5A 3UFAA 3Q3XA 3T25A 4ISIH 1GJ8B 1EJNA 1WV7H 3FZZA 3GCTG 3RXKA 2G4UA 4NWKA 4WMDA 1C5VA 3F0PA 2AEIH 4ABGA 1FY5A 1EOLA 3AAUA 4WXIA 1OXGA 4MPXA 3V12A 2UWLA 2FOAA 4FUBA 3GY2A 3P70B 3SUEA 4DJZB 2CHAC 3F68H 2CJIA 3ITIA 1P8VC 2ZPQA 1GBBA 4UDWH 4Y76A 1L1JA 3PWBA 3SNEA 2VNTA 3EA7A 4GVUA 2ZCHP 6GCHG 1SMFE 2ZQ1A 1NZQH 3LGYA 4XD7D 2FZZA 1KIGH 2PP6A 3JZ1B 4JZ1A 1TX7A 1OWDA 1AKSB 1F7ZA 1O2QA 2HNTF 3MYWA 3IITA 4TWYA 3U28C 3PTNA 1T31A 2BTCE 1V2MT 3U8RH 2JDID 2H9EH 1YCPH 2R3UA 4CRDA 1DS2E 1YLNA 2HVXA 1AIXH 3W94A 3RXLA 2OP9A 1K21H 1NRRH 1W2KH 2AH4X 1MD8A 3BEFB 1OX1A 4ABJA 1XUFA 3BTQE 4I7YH 1B5GH 3EE7A 2XXLA 5C0UA 1EATA 3P95A 2KCYA 1TQ7B 5EJ1A 1PQ8A 1GHAF 2SGEE 1GL0E 1Z8JB 4RKJB 1CHOG 1AUJA 1O31A 1LDTT 1TMTH 2D26C 2ZFPH 3ZVEA 3ZV9A 5JBTA 5A09A 1ELAA 1H9IE 3OU0A 1AMHA 1EPTB 4INKA 3PYHA 3F6UH 2WPHS 1FN6A 1C4U2 5GPIB 4RSPA 3VPKA 1O2UA 2AIQA 3ATKA 2BDYA 2PGQB 3ZZ9A 1EPTA 2BX3A 1QNJA 2W5EA 5F8TA 1QB6A 2GZ7A 2VBCA 2J9NA 2ZPSA 3BF6H 1UJ1A 3PLKA 2XNDD 1AWHB 3A86A 4IN1A 1Y3UA 3E0NB 4MG3A 5DP4A 3BSQA 3T28A 3RXMA 8GCHF 3PV2A 4AOQA 1XM1A 2FTLE 3BG8A 2J5UA 1FMGA 1O2HA 3S0NA 3L6PA 4Y0ZE 1O5AB 1QZ8A 1W0ZU 1Z6EA 4ABFA 1L2EA 2ZKSA 5EW2H 1TNKA 1BIOA 5SGAE 2HPQH 1M9UA 1GBJA 1V3XA 2QIQA 3QK1A 4YM9A 1EPTC 2BY5X 2FWWA 1D3PB 5C1YA 2XYAA 1TX8A 3O8BA 3QTVH 2AMPA 3H09A 1NRNH 4AFSA 4A1XA 1DWCH 3OTJE 4FXGH 1A0HB 1DANH 3ESTA 4RN6A 1C5RA 2HNTE 2ZO3H 1LTOA 2PR3A 5TCAA 1IHTH 4H6TA 1DWBH 3M5NA 3SN8A 1H8IH 1Y8TA 2B7DH 2QY0B 3MNXA 3ODDA 2RDLA 1HNEE 3L33A 3UIRA 2A5KA 1GBLA 3M5LA 1NFXA 2G5VA 4I33A 3TJVA 1BHXF 1BDAA 4OS7A 3DUXH 1O3BA 1DSTA 2PTNA 1IQFA 3TNTA 4RKOB 1YCPM 4AN7A 1YPLH 4O9VA 2OD3B 5E0GA 3SOSA 1C1MA 3WWBA 1TABE 4FETA 1MCVA 1TPOA 2GTBA 1TGTA 3N99A 3E3TA 5HYOA 1VJ9U 2Y82A 1QBOA 4O3UA 3E6PH 2ZU4A 5FX5A 1O3CA 3MH6A 3G01A 3OTPA 2BDIA 5EQSA 1YPJH 2XC5A 1OP0A 2A4QA 2F83A 2OC8A 3MU4A 1UVUH 3A83A 1SQOA 3E1XB 3LJOA 3ATWA 1HAZB 1TNLA 2XBXA 2ASUB 4X6PA 3RC5A 3SJIA 3UREA 2HLCA 3DCLA 3A81A 2NU4E 3TJNA 3M61U 1MKXK 2RG3A 4E05H 1SGIB 5PTPA 1S83A 1ID5H 2GVFA 1UK4A 1ANDA 1P2NA 3BTFE 1C9TA 1HAHH 3MNCA 5DO4H 2A32A 3I29A 3VFEA 1ELTA 2AFQB 4CR5A 3GCHB 2CN0H 1SPJA 1EAIA 3QZQA 2QXIA 3ODFA 4AZ2B 1O39A 3F9GA 1IQMA 5HM9A 1MAXA 1UO6A 3OX7U 2FOGA 3LC5A 5AF9H 1P05A 3RLYH 4ACBA 3H7OA 3L3TA 1IQIA 1GWAA 2HWLB 2R2WU 2A0QB 1ZTJA 1PQ7A 2FP7B 4Q7ZA 2ZDMA 1D3DB 1VCPA 4XBCA 3SV7A 1E34B 3B23B 2OBQA 1WDIA 2ZGCA 5A2MH 3LIWA 1LVMA 3URDA 5C1UA 2ZP0H 1V2UT 1FXYA 2GDEH 3M35A 1ETTH 1O2GH 1BOQA 2QE7D 3TK5A 4X1QU 4H4FA 4XE4A 4X8TH 4AFZA 2I6QA 2GD4B 1W7XH 3GCHC 1V2TT 2QF0A 4NZLA 1C2HA 4LK4A 2HPPH 1V2JT 1HBTH 2OQUA 4ZXYH 3TGIE 2L74A 3ZIAD 1O3DA 1VKYA 3QTOH 1O38A 2P93A 1KXDA 4X2WA 1ZZZA 3EQ0H 1C1SA 4I8GA 1BCUH 2G51A 4UEHH 1TRYA 2Y81A 1F0UA 2SNVA 4YESB 1A0LA 1SL3A 2A2QH 1PPFE 5DP7A 3BEUA 5DP6A 3KL6A 4FUEA 5C67A 2RCEA 3BTKE 1OOKB 3Q00A 4WJG2 4GSOA 1C5SA 3TITA 5KGOA 1MU6B 1DUEA 1CO7E 1EP6A 1GI4A 4JMYA 5DG6A 3VB3A 1HAOH 1AE5A 1LHGH 2VIPA 2ZDLA 1Y5AT 1KY9A 2A5AA 2K8IA 2ZF0H 4ISNA 1QURH 1GL1A 2ZDKA 1BJVA 2LELA 2EEKA 1TYNA 5B6LA 4X2YA 2R9PA 1GBMA 4SGAE 5EJZA 1K9OE 1C2FA 1TPSA 2QA9E 2EC9H 3OE7D 2GV6A 2XC4A 2BD8A 4KTSA 4OS2A 1BTXA 3F0OA 3RU4T 4ESTE 1O2XA 4Q63A 4IS5A 2BD7A 3LGVA 2PSYA 3FP7E 1HAYB 3TPIZ 2BXTH 3EA8A 3SV9A 3P6ZB 5C20A 1T32A 2FXRA 3F9FA 2BVRH 2KM0A 1FY1A 3QX5H 1J16A 3FVFB 4U01A 1ETSH 4YT7H 2CXVA 5DKMA 3A8BA 7GCHG 2TIOA 1TGNA 1DVAH 5C1XA 2J95A 5JB8S 1TGSZ 3GY5A 2R0LA 1UTLM 1GI0A 3GDSA 1C2DA 2WUBA 2ZGBH 2ZDNA 4NSYA 2KAIB 3MI4A 1QQUA 3QGJA 1C2JA 1GBFA 4HGCA 4CBOA 4TSFD 3VEQB 2HNTC 3DSGA 4CRGA 1GHBF 4D7FA 1KTSB 2Y5HA 3T29A 4Q4LA 3ZZ6A 4HFPB 4GLYA 1H9HE 3A87A 1N1LA 3RXUA 1K1OA 1ZOMA 2GT8A 1NS3A 2BVSH 4WF8A 4BAHB 3SNDA 1Y3WA 1OP2A 4X6OA 3UAIC 1XVOA 3AVZA 3F2FA 2OTVA 3F2HA 3SUGA 1A0JA 2V7QD 1DWEH 3GY8A 1Y5BT 4X2XA 1QIXB 5T1VA 1IOEA 2PLXA 3SNBA 2QF3A 1TOCB 3M7TA 1P04A 1MU8B 1F5RA 1Q2WA 3S9AA 5DP9A 1LPZB 1C1NA 4AGJA 4ACAA 3TGKE 3KQEA 1B0EA 2GCHF 1AZ8A 2SNWA 1O2JA 3MO6A 2FESH 2FI4E 3QO6A 4YXWD 3SYJA 2Z9IA 4B1TA 1HXFH 4JZDH 1AD8H 1W11U 4BXSA 1AFQB 1PQ5A 1ZMNA 1V2WT 2YNAA 2ANWA 4CRFA 1CA8B 2B8OH 4MNWA 2XNIA 3VB7A 1NRQH 1GHYH 4MQAA 3BIVH 5IDKA 1ZRKA 3LKWA 1O2ZA 1C2GA 4D8NA 1GJAB 1O5EH 2GGVB 3O8DA 4IGDA 3SU3A 4Z1MD 1SVPA 5F53A 3KHVA 2B0FA 3BTME 2OQ5A 1ESBA 1VGCB 1KXAA 1GJ5H 1XKBC 2F91A 2ZGHA 3ATIA 1C2MA 2LPRA 3QWCH 1DLKB 1A2CH 2FX6A 4BAQB 1O32A 3ZZDA 2BDGA 1ELVA 2ZPRA 3FN8A 1Z8GA 2W3IA 4CRBA 2OUAA 2KCAA 3LGWA 2JH6D 4B2AA 2VIWA 3RXOA 3PLBA 2L6OA 3D23A 2FYRA 2NU2E 4HZHA 4WVPE 1ZRBA 2ZU5A 1O3GA 2O9QA 1O2OA 2ODQA 3RXRA 3T2NA 1GJCB 2FS9A 3U8TH 3PM3A 1BT7A 1AFQC 2UWPA 4JK5A 1AGJA 4B6FA 3PMHB 1L1NA 1ACBE 1AN1E 2OC1A 4AYYB 1O2IA 4B74A 2W3KA 4GAWA 1NRPH 2KFWA 4Y0YE 3SU1A 1ANCA 1UHBB 4X6NA 4YOIA 1HB0B 2K0QA 1GHAG 1VGCC 3UTUH 1T8MA 3STIA 1PPHE 1E37B 2ZHQH 3SU2A 1UHBA 2HGTH 2O8WA 3RC4A 1WUNH 3SU5A 2ZTYA 5GCHF 4MNVA 2GCTB 3LGUA 1KLIH 4X1PU 1NROH 3ZZBA 2ZECA 2JETB 3KIDU 2D2DA 3EGKH 4XSKU 3ATMA 2G81E 2QF5A 1O5BB 1A46H 2WSSD 3CP7A 3GISB 5J4SA 4IMQA 1SHYA 3Q3KA 1Y59T 2WYGA 1MH0A 1AQ7A 2IPHA 2DE9A 3VXFH 4XRNA 1SG8B 3B9FH 2V6NA 1Z8RA 1A5HA 3GS9A 3GY4A 1DFPA 4CH2B 1G3EA 2H9TH 7KMEH 1LVOA 8GCHG 2Q6GA 5FBEA 2JH5D 3HKJB 3S7HB 1Z1IA 3SJOA 5FPYA 2RA3A 5JBAS 3B8JA 3HPTB 1NM6A 2BHGA 3FFGA 4XBBA 2P8OB 3T27A 4YZUA 1PPEE 3RXIA 3R0FA 4JYVH 3A85A 1P2IA 2CF8H 3SUDA 3GCNA 5A8XA 1LPGB 1ZHMA 2GCTC 2JETC 3GCOA 2VVCA 1EXFA 4DOQA 3RUOA 2PHBA 2C8WB 2KCOA 4Q80A 2KX4A 2A5IA 2EI8A 2O8LA 5JYIA 4QT8C 4J2YB 3VB6A 1EB1H 3FZDA 1V2LT 4I8HA 3N7DA 2Z3CA 1MQ5A 1TBZH 1LHFH 1FY3A 4AC9A 3VB4A 5E0HA 5T6DA 1TB6H 1HCGA 3PV5A 1UCYH 2H5DA 1P0SH 2P8OC 4TWWA 3RXPA 1JIRA 4J1YA 2BD4A 4FVBA 4AFUA 1OKXA 3OEHD 1O2KA 4ZXXH 1QRWA 2YMSB 4YOJA 4IN2A 4E06H 2FX4A 1UCYK 4R8TB 3NZIA 3KYFA 2P3FH 2J4IA 3BTHE 1AU8A 2EI7A 3SGBE 2FOHA 1GI5A 1PPZA 1QGFA 3MU0A 5LPFA 1SGTA 2OC0A 1BMFD 3QN7A 5EW1H 1JRTA 3SJ9A 1O3NA 2JH0D 1UK3A 1YCPK 5EU8A 1DLEA 1ELDE 1UVOA 1WYKA 2TBSA 1ZTKA 1S82A 3MHWU 3ZV8A 1O3HA 1EB2A 1P02A 3TU7H 4ZMAH 4I31A 3RLWH 3E0PB 4JCNA 3NKKA 4MDSA 4K8YA 4DCDA 1GDNA 4GCHF 4XOJA 3LGTA 2PFEA 1NPMA 3LC3A 1OHHD 2PUXB 4BAMB 3FP6E 2BD2A 1DXWA 1VCQA 2Q6DA 3BEIB 1LO6A 4NA7A 4Y7BA 4Y10E 1J9CH 1O5DH 1SSXA 4BAKB 4U2WA 1UCYE 1OYTH 3DFLA 1O0DH 4RT0A 3S7KB 2YMSC 2QXGA 1ZJDA 3A7WA 3A7ZA 3PROA 2PKSB 4X8SH 3PMJA 3SHCH 1Y3YA 2BLWA 2NWNA 4H42U 1C4Y2 3O8CA 1F5KU 1TGBA 2G5NA 3PV4A 2XW9A 1FJSA 1F0TA 1TLDA 8ESTE 5CDFE 4I86A 3GICB 1WBGB 4AORA 3RXCA 4I32A 3V7TA 4K1SA 1C5WB 1GCDA 3P92A 1P3EA 1PJPA 1O2LA 2OLGA 4Q2KA 1OWKA 1AVXA 1ARBA 1THRH 1GMCG 3A7TA 4K2YA 2FOEA 1KXFA 1P03A 3ZVDA 1TPAE 2XWBI 1PYTC 1V6DA 4OGYA 3QGNB 1KYNA 4AB9A 4LZ1H 3DFJA 2ZU2A 1INCA 2JKHA 1GBKA 1T8NA 1SQTA 2ZTXA 2VIOA 2BDAA 1SLXB 4IMZA 1MTWA 1CQQA 5J4QA 3RXGA 3GY6A 5IYTA 5T6GA 4JYUH 1TGCA 1HUTH 2PKSC 1QBNA 2ZA5A 3LH3A 3S9CA 1MTSA 1GDUA 2WV9A 1ANBA 1K22H 1YPMH 2Y5FA 2K1QA 4Y8XA 2J98A 2BY7X 4RI0A 1GBEA 4ABHA 2G55A 1FLEE 2W6ID 1FPHH 2G00A 1RD3B 3D65E 4Z6AH 4A1TA 2A4RA 1EOJA 1O2VA 2UUFB 1FDPA 4Y7AA 4YT6H 1PPGE 3TH4H 1QTFA 1BTUA 4YTAA 1IQGA 1W10U 1RJXB 5EOKA 1IQKA 2BMGB 2ZGJA 2A4GA 2W6JD 3RM0H 4YLUA 1BRCE 2UUKB 2GP9B 2ZU3A 1ZR0A 3NRLA 5DSFA 1KXCA 1A7SA 1CBWB 3M3TA 2AIPA 5A0CA 1QL9A 2TGTA 4UFFH 2EA3A 5FXLA 4NSVA 1ZGIA 3E8LA 2XBVA 4UFEH 5A8YA 3D49H 4ZKSU 2BZ6H 1CT2E 4K3JA 1YYY1 5JBCS 4ZHMU 3WW7A 1EKBB 1BTWA 2VWLA 1SFIA 3C27B 2NU0E 1HFDA 2GDDA 4R0IA 5BRRE 4NZQA 1LQEA 1HPGA 2R0KA 2TGPZ 2RFKC 2P3UB 3A8AA 4CREA 1TQ0B 1BRAA 2THFB 1EZSC 5CHBA 1HJ8A 1BRUP 2PTCE 4B2CA 2QXHA 3OFND 1YBWA 4AG1A 1SI5H 1N8OB 1YWUA 4ZROA 4MNYA 1XUIA 3KGPA 1NY22 5F6MA 2Y80A 3ZZ4A 1RS0A 1QFKH 5FAHA 1LKBA 3SZEA 3UNRA 4FOUC 1QJ7B 2BLVA 4YOGA 5GNDA 5EGMA 2I6SA 3FKSD 3OSYA 3PRBA 2WUCA 1D9IA 3GY7A 2EY4C 1MCTA 1SGYE 3K6ZA 3BTGE 2WV4A 2G52A 4B71A 1GHBG 3EDXB 5GIBA 4XFQA 1FIZA 2KCPA 1K1MA 2FO9A 2C3SA 1L4ZA 2CMYA 3GY3A 5DN6D 3TIUA 1CT0E 2RA0A 2ZDVH 1GI8B 1S6FA 1GMCF 2Z9GA 3ZVBA 5F8ZA 3RXAA 1QBVH 3ENSB 4PROA 1G3BA 4CRCA 1T8LA 1HYLA 2QV1A 2M5TA 1C5OH 1N8OC 1AUTC 4H6SB 1C4V2 2WINI 4VGCB 1GBIA 1GHZA 2ZHEH 3KEEA 3P8GA 2VH0A 5DPAA 2DUCA 1W13U 5TJXA 4JZFH 3DA9B 9ESTA 1WXRA 4Y8ZA 1FAKH 2FOCA 4MPVA 1UVSH 2JJ2D 3BTEE 2PV9B 3V3MA 1VJAU 5HKKD 2V35A 3TJUA 3WY8A 2GCHG 1LQDB 1S0QA 1UTJA 3NCLA 3RXHA 4ISLA 1E35B 2GZ9A 3RC6A 1GI1A 3DT0H 1MUEB 2Q1JA 2VWMA 4JZEH 1TRNA 3I77A 4D9QA 1QL7A 3SO3A 4U30A 1DSUA 3UOPA 4ABBA 1F2SE 4ZHAA 5I46H 1RFNA 2OXSA 2J2UA 5GXPA 2KZ4A 1P2JA 1ZPCA 5BPEA 2OC7A 3LGIA 3MH4A 4TYDA 2QXJA 2IJOB 3LDXH 1BUIA 2KR7A 1PFXC 3KQCA 3DSOA 1D3TB 1OPHB 2WPKS 4VGCC 3PMAB 2BLOA 1EUFA 1AI8H 1VITF 1BJUA 1GVLA 3SBKA 1P9SA 2Y7XA 1LCYA 4WXVA 5DP5A 4OS6A 1O2MA 1TNIA 5EQQA 3RMOH 1JWTA 5TCCA 4MPWA 4FUDA 1HLTH 5AHGH 4KGAA 5C3NA 2BD9A 4NFFA 2XBWA 3M37A 2FOFA 1EASA 3RU4E 1BB0B 2XOKD 3A84A 2PGBB 1ZSKA 1CE5A 1LKAA 1W14U 4A92A 3KCGH 1HIAA 5I25A 1C1VH 1XXFA 1VZQH 1GI6A 2LNCA 2VIVA 3IG6B 1MTNB 1OWEA 3CS0A 2WZQA 3C1KA 3RXQA 4TT3D 3PTBA 1O37A 4UE7H 3HGPA 5IK2D 1YY3A 1XMNB 1MQ6A 5G4BA 2ZHWH 1O5CB 1VITH 4NCYA 1NT1A 2TGDA 1OYQA 1AFEH 2TRMA 3STJA 1YPKH 2BZAA 1A4WH 2C4FH 4B76A 1AO5A 1BTPA 1QR3E 4DIHH 1TBQH 1WCZA 1YLCA 2A7CA 3RXVA 5GCHG 2BQ6B 1YLDA 3TLOA 2IJD1 2YOLA 2AERH 4D76A 1ANEA 1C5ZB 2ZFSA 5LH8A 4CRAA 5FPSA 3A7YA 3BIUH 4Y79A 1CU1A 1J8AA 2ZDAH 4OS5A 4X8VH 1Y5UT 3LU9B 1C5NH 2F4LA 5HIZA 3VGCB 3P8NA 4UFGH 2FM2A 3KNXA 3WWFA 4NA8A 1MTNC 2XCFA 1NBMD 1L4DA 4ZKRU 1BITA 1QL8A 2HLDD 1AB9B 4BOHA 3A8CA 2J38A 1S85A 1G36A 1WU1A 1SGRE 3F3BA 3I78A 1YPEH 1EZUC 2Z3EA 2ZFTA 1H9LB 3M5MA 3FO8D 3M7QA 2STBE 1ESTA 2F9BH 1GMHG 3HGNA 4DIIH 2VU8E 4WY3A 1YPHE 5K0HA 4DGJA 5B6OA 1OP8A 1PPCE 1JXPA 1ABJH 1TWXB 1P2QA 2ULLA 2F9UA 2PSXA 3RXEA 3ATLA 2G4TA 2Z9KA 2AMDA 3UY9A 2BYAX 1T4UH 3A8DA 1K1IA 3VGCC 1HAGE 3LONA 3RMNH 3RXTA 1XKAC 2V3MA 1EAUA 4NIWA 4X2VA 4CHAB 1O2NA 1PQAA 1A61H 2B9LA 3MNBA 1K1NA 1S81A 1AB9C 2ESTE 1J17T 1BHXB 1W0YH 2A1DB 4E7NA 1C1TA 1KDQB 2C8XB 1DICA 4DY7B 3MMGA 1AHTH 1CSOE 1GI3A 2Y7ZA 3EAJA 3GYLB 5JDUB 2P95A 3LPRA 1KDQA 4JYTA 1D6RA 1YGCH 4ZAEA 4P00A 1P11E 2BM2A 2WPDD 4INHA 4ZHLU 5ABWA 2TGAA 2J34A 3A7VA 1WTGH 2FOMB 1O3FA 1FV9A 1O3PB 2A7HA 5HGGA 1SB1H 4ZH8A 1OWJA 1O34A 3TH2H 1KLTA 1F5LA 1QA0A 4NIXA 1PPBH 1C1QA 3K2UA 1MKWH 1C5UA 1GMDF 1V2PT 2AGIX 1SQAA 1W3CA 1WTHD 3UUZA 4CHAC 4Y11E 4A1VA 2XCNA 1TAWA 2WV5A 6ESTA 1YM0A 1BTZA 1MZDA 5DJ7A 1NRSH 2BLQA 6CHAB 1JRSA 5JBBS 3ZZ3A 1SGCA 4D9RA 1MTUA 2A4OA 4GCHG 2ZHFH 3M7UA 3FANA 2BX4A 1MKWK 1SLWB 3SU4A 1Z71A 2FEQH 1CA0B 1DWDH 1ZLRA 5KEDA 2ZG0H 1BMAA 1HRTH 1MZAA 2BD3A 2SGDE 5HIYA 5F8XA 1O2YA 3MFJA 3ZVCA 2VVVA 1RTLA 2BOHB 1GVZA 3T26A 2C8YB 4DT7B 5H4IB 4Y8YA 2WYJA 1QB9A 4X6MA 3M3SA 2OBOA 1GVKB 1O2SA 3A82A 4K5ZA 2R3YA 1FI8A 3NUMA 5C5NA 3A89A 1OSSA 1A5IA 1C5TA 1O3KA 5GWZA 1CHGA 1FX0B 4Z0KA 1C5MD 1TPPA 1W0JD 1THSH 1GJ7B 1A3BH 6CHAC 1FQ3A 1MABB 1RTKA 3GDUA 8LPRA 3QDZB 2H2ZA 1N6XA 1O2WA 4NG9H 4IBLH 1DXPA 2G8TA 1GJ6A 1IQJA 1H8ED 4Q7XA 2VWOA 1P9UA 1ELBA 1GI7B 1O33A 1C5PA 1CA0C 3GYMA 1GI9B 1GMHF 4OS4A 1H8HD 3R3GB 1WQSA 1WOFA 4I8KA 3UR6A 1UTOA 4JK6A 2HALA 4F49A 3MU8A 1EX3A 3V0XA 3E90B 2ZNKH 5T3HA 2GJGA 1QRXA 3U8OH 4B2BA 2ZCKP 1FAXA 3SGAE 2STAE 2ZC9H 3AK5A 4ASUD 1EP5A 1BZXE 4Q7YA 1NU9A 3F9HA 3SJ8A 5T6FA 1OWIA 7ESTE 1GBCA 1SC8U 2NU1E 1SGDE 3MH7A 2SGQE 3DD2H 3RXSA 1HJ9A 5A0BA 1KXBA 1S5SA 4FU8A 5C94A 1ELFA 3RMMH 1C1RA 1ZMJA 2Z9JA 4K60A 3BG4B 1THPB 2A45B 1V2VT 1FNIA 3SV2H 4WH8A 3UB0A 4FUCA 3TH3H 3MQKC 3N7OA 2VVUA 1Q3XA 3VXEH 2CF9H 1SGFA 4YO9A 3RMLH 1O3EA 5JPMH 1LMWB 3GOVB 1RIWB 3N7EA 1WSSH 1DITH 2IN2A 1CGIE 1H4WA 3PLPA 3TK6A 1V2OT 1B7XB 2PW8H 3A80A 5FCRA 3TK9A 2QN5T 4FUJA 1F0RA 4X1NU 2F9VA 3QZRA 3UQVA 1CT4E 4JZIA 4Y71A 1O36A 1EZQA 3SZNA 1UTKA 4OM9A 1QA7A 2PUQH 1W12U 3M5OA 4WH6A 2XBYA 1TMBH 4TY6A 1LVBA 2YMSD 1AKSA 2FI5E 1P57B 1FN8A 4ZUHA 1TA2A 3CNRA 3ZZAA 1GPZA 4WMFA 1FPCH 1GHXH 2BDCA 2ZWLH 5LPRA 3P8OA 1DT2A 3BG4C 2PKAB 1YKTA 2BDHA 1NESE 2H6MA 1S6LA 3PRDA 1HXEH 1O3IA 1EJAA 1F92A 1O3JA 3OY5U 1UTMA 3KQDA 2V0BA 3M3VA 4K1EA 1Z6JH 1YPHC 4ABEA 4GUXA 1RIWC 4ABDA 3K65B 2PKAA 1Y3VA 3SJKA 4CH8B 1SGQE 3H7TA 4ISOA 1O2TA 3D62A 1GJ4H 4HTCH 2SFAA 1W7GH 1O5FH 5GJ4B 1PYTD 2ILNA 3RXDA 4BTUB 5C5OA 4ZKOU 4HI3A 1C2KA 1TFXA 1O3OA 1IQNA 1O3MA 5EG4A 3P17H 4OGXA 3SNAA 5K7RA 1SGEE 4NWLA 2BB4A 2P16A 1DOJA 2GV7A 1UTPA 4X1SU 1UTQA 5ESTE 4NIVA 2XWAA 3MH5A 2BXUH 3KYGA 2ZU1A 3PWCA 4NGAH 5DK1A 1SR5C 1F0SA 2AGGX 2BD5A 1HAPH 1J15A 1BMLA 1XXDA 2ANYA 2W26A 3ZYEA 1P09A 2J98B 1D3QB 1D4PB 1NC6A 2FMJA 1UVPA 2TPIZ 1GHVH 3SQHE 1LPKB 1Y3XA 1VR1H 3EYDA 3AAVA 1MAYA 2F43B 4B75A 2O8UA 1CGJE 4TPYA 1GBDA 3ELAH 2ODYB 2QCYA 1SGFG 1HAXB 2A2XH 4UFDH 7LPRA 1OWHA 5EJLA 4MVNA 1SFQB 1Z1JA 3CENA 4DURA 3URCA 5ESBA 1VITG 4XBDA 3NWUA 3GCTF 4UD9H 5GDSH 5HM2A 1IHSH 1YPGH 2R2MB 4YLQH 1NFUA 5F03A 1GG6B 3RXBA 1ZHRA 3MTYA 1C9PA 4CBNA 3A7XA 4MPUA 6GCHF 3SNCA 3SI4H 3HKIB 2BQ7B 3RXFA 1DUAA 1ORFA 1XUGA 4AG2A 2FI3E 1GCTB 3BN9A 1ZPBA 3U69H 2FIRH 2CV3A 1NBME 2BY8X 4X0WU 1HGTH 1K1JA 1RRKA 4NA9H 3TGJE 1G2LA 1ELCA 1IAUA 2OINA 2WPMS 1C5LH 3P8FA 1NN6A 1MKXH 1ELEE 3BTTE 5ETXA 1G2MA 4ZKNU 5EXNA 4U32A 1JOUB 2BQWB 3PMBB 2H5CA 2F9NA 1C5XB 1TOMH 3RP2A 2SGPE 4BAOB 2Z9LA 4DT4A 1CBWC 1Z7KA 1RXPA 4A6LA 4FVDA 1GHWH 2VH6A 2FTMA 1C1PA 2FYQA 3MWIU 2P3TB 2H9HA 3U1JB 4INLA 1GG6C 2Y6TA 1DY8A 1KLJH 1O30A 1CHOF 5C0TA 3TJOA 1A1RA 5FBIA 4BANB 5E0JA 1ESAA 1CGHA 2ZFFH 5FL7D 1ELGA 1FZZA 1P01A 1GCTC 3SORA 1S0RA 1DPOA 2QC2A 4WWYA 3UNSA 1NFWA 4O97A 1E1RD 1G37A 2W7SA 4LOYH 4AGKA 3T5FH 1EFRD 2SGFE 3FP8E 1SLUB 3SHAH 3EA9A 4LZ4B 1KTTB 1EAXA 3Q76A 4IC5A 3KN2A 1AWFH 3AW0A 1CVWH 5EPYA 2HVYB 5HMAA 3IWMA 2Z3DA 1AVWA 1XVMA 3ZVFA 3ZYDA 2J92A 3V13A 1N6YA 1XX9A 5AFZH 1GBAA 1NTPA 1TX6A 3E91A 4ASHA 1K0HA 1C1OA 1O3AA 2EQNA 2VWNA 4KTCA 2BY9X 1UVTH 5EPNA 1A3EH 3SV8A 2F9OA 3JZ2B 4TY7A 1QY6A 3S69A 1S84A 2A7JA 2O8TA 2ZGXH 3LJJA 3NPSA 3UWIA 1B0FA 1COWD 1MD7A 4FUIA 3ZZ8A 4AYVB 3Q3YA 1SBWA 1NU7B 4WMEA
chains in the Genus database with same CATH topology
1C2EA 1BBRH 2GX4A 1JIMA 1UK2A 3RDZA 3MNSA 2D8WA 1DX5M 2EI6A 1FY8E 1G3CA 5L6NH 2YNBA 1LHDH 2BY6X 2WPLS 1SGPE 1EJMA 1ZSLA 1DDJA 1BBRK 1G30B 2VJ1A 2OCVB 3SI3H 1QHRB 3BV9B 1V2QT 3KF2A 1XUJA 5A0AE 5AVDA 4I8LA 2H1UA 5FX6A 3BTWE 3TVJB 3LOXA 2ZZUH 1HIAB 2O8MA 1DM4B 1V2RT 1TNGA 2J94A 1EZXC 2ALPA 1BQYA 2ZFRH 4BTIB 8KME2 1VCWA 3SV6A 2FS8A 2Z94A 4K8BA 5FHTA 1P2OA 1IQLA 3PO1B 1ARCA 3ZVAA 3ZZCA 4X8UH 5EQRA 5EODA 2ALVA 4CR9A 2GKVE 5CMXH 1GMDG 3MOCA 3UNQA 1P10A 1RTFB 2Y5GA 4GHTA 2VINA 1MTVA 1AY6H 2Q6FA 1C1UH 2ZFQH 2B5TB 5A8ZA 2GZ8A 3K6YA 1BBRE 2W7UA 1ZMLA 1SGNE 2FDAA 1G32B 1K1LA 2WPIS 4F4OC 1EQ9A 1T4VH 2ANMH 1G3DA 1XUHA 3QLPH 1P3CA 1C2LA 2BOKA 1ZTLA 1TBRH 1NFYA 1GBTA 3A88A 4KELA 1TONA 3GDVA 1DE7H 4Y6DA 4THNH 4BTTB 3UPEA 1A5GH 1P2MA 2V3OH 3PO1C 1O3LA 2VGCB 4DG4A 3NK8A 1FY4A 3Q77A 4AFQA 2ZCLP 5E2PA 1O2PA 4K69A 1EAWA 3HK3B 1V2KT 1ABIH 1K28D 1TMUH 1GBHA 5AFYH 3MO3A 2QYIA 3PB1E 1HAIH 1O2RA 2GMTB 2XC0A 2ANKH 1BA8B 1HV7A 2KAIA 4XDEA 1TNJA 4UONA 2BVXH 3O8RA 3K9XB 1MMJN 2UUJB 3M36A 3SU6A 1C1WH 1C5QA 3U98H 3UWJH 2FLBH 5EXLA 5CHAB 4ISHH 3HK6B 5E8EH 1AVGH 1BRBE 3DHKH 4IC6A 3LH1A 3SUFA 2WPJS 1BTHH 1ZPZA 2FOBA 1IQHA 1ZHPA 3HATH 4ABAA 3RM2H 4BNRA 5FCKA 1RGQA 1DY9A 1TRMA 3AASA 1ETRH 1WAYB 4MTBA 2VGCC 4FUFA 1C2IA 2ZI2H 2VIQA 3RXJA 1Z8IB 2V3HH 3FAOA 1GI2A 3ZZ5A 2GMTC 2DE8A 4NIYA 3SGQE 3KQBA 1L1GA 2HOBA 3F1SB 2AS9A 2VB0A 1TIOA 1AE8H 3MU5A 3CS7A 1HAVB 3F9EA 3SQEE 4BXWA 1IQEA 3ZVGA 2XTTB 1KXEA 1O5GH 2F3CE 5CHAC 1J14A 5L2ZH 2ZTZA 1WQVH 1QJ6B 1MBQA 4O03A 3LT3A 3W95A 4SGBE 2Z7FE 1GGDB 1HAVA 2AGEX 2UUYA 5L2YH 2AMQA 1QRZA 1T7CA 1P06A 1ZSJA 2ODPA 1V2NT 2FPZA 4E7RG 1U6QA 2VIDA 5DP8A 1W8BH 1MBMA 3S9BA 1L0ZA 1O35A 5HXFA 1ZGVA 2D1JA 4AX9H 1TE0A 2GT7A 3OYPA 4KP0A 2Z6BD 4MNXA 1YF4A 2P59A 1XUKA 4KTUA 2A31A 1T8OA 5E2OA 1ZYOA 3SW2B 1E38B 3U9AH 2ZEBA 3UQOA 1C5YB 4TPIZ 4GPGA 3ZZ7A 1LHEH 1QB1A 1UMAH 4D7GA 1E36B 3NXPA 5LGOA 1X7AC 1YC0A 3EE0B 3E16B 3T62A 2C90B 5DGJA 4A7IB 4M7GA 1UTNA 4O3TA 1GGDC 2BDBA 1JMOH 7GCHF 1HJAB 2IOTA 2ZIQH 2ZHDA 4IW4E 1D6WA 2HRVA 1FIWA 1JBUH 3UOUA 1H8DH 5JB9S 1Q31A 4X1RU 1SOTA 2NU3E 2SGAA 4B73A 4DVAU 1V2ST 1P12E 1GDQA 5DP3A 3TNSA 2C93B 6LPRA 4NFEA 4LXBH 4FUGA 4FU9A 3H5CB 1YP9A 4A5TS 4MLFB 4OS1A 1KSNA 9LPRA 2XRCA 1K1PA 4ABIA 4FUHA 3UR9A 3MO9A 3QUMP 2QGRA 3U1IB 3MU1A 2F9PA 4AB8A 1G9IE 1BMNH 4K1TA 1BTYA 1AZZA 2AYWA 2C8ZB 1TNHA 4FU7A 5FPTA 1E0FD 4DW2U 1FONA 3RU4D 3OY6U 5EXMA 2UWOA 1LVYA 5C2ZA 2PWXA 1SLVB 1FUJA 1HDTH 1S6HA 1HJAC 2CHAB 4I8JA 2QAAA 1H1BA 1QJ1B 2FODA 1LHCH 3SU0A 1TA6A 4GHQA 1QCPA 1ZJKA 2ZQ2A 5LPEA 1GJBB 2P94A 4KKDA 1QQ4A 1K2I1 2FLRH 1GJDB 1SOZA 5L30H 2CGAA 1OS8A 1GJ9B 3BTDE 1P2KA 1TALA 1SHHB 1BMMH 1NO9H 3AW1A 5CE1A 3VB5A 3UFAA 3Q3XA 3T25A 4ISIH 1GJ8B 1EJNA 1WV7H 3FZZA 3GCTG 3RXKA 2G4UA 4NWKA 4WMDA 1C5VA 4ABGA 2AEIH 1FY5A 1EOLA 3AAUA 4WXIA 1OXGA 4MPXA 3V12A 2UWLA 2FOAA 4FUBA 3GY2A 3P70B 3SUEA 4DJZB 2CHAC 3F68H 2CJIA 3ITIA 1P8VC 2ZPQA 1GBBA 4UDWH 4Y76A 1L1JA 3PWBA 3SNEA 2VNTA 3EA7A 4GVUA 2ZCHP 6GCHG 1SMFE 2ZQ1A 1NZQH 3LGYA 2FZZA 1KIGH 3JZ1B 4JZ1A 1TX7A 1OWDA 1AKSB 1F7ZA 1O2QA 2HNTF 3MYWA 3IITA 4TWYA 3PTNA 1T31A 2BTCE 1V2MT 3U8RH 2H9EH 1YCPH 2R3UA 4CRDA 1DS2E 2HVXA 1AIXH 3W94A 3RXLA 2OP9A 1K21H 1NRRH 1W2KH 2AH4X 1MD8A 3BEFB 1OX1A 4ABJA 1XUFA 3BTQE 4I7YH 1B5GH 2XXLA 1EATA 3P95A 1TQ7B 1PQ8A 1GHAF 2SGEE 1GL0E 1Z8JB 4RKJB 1CHOG 1AUJA 1O31A 1LDTT 1TMTH 2D26C 2ZFPH 3ZVEA 3ZV9A 5JBTA 5A09A 1ELAA 1H9IE 3OU0A 1AMHA 1EPTB 4INKA 3PYHA 3F6UH 2WPHS 1FN6A 1C4U2 5GPIB 4RSPA 3VPKA 1O2UA 2AIQA 3ATKA 2BDYA 2PGQB 3ZZ9A 1EPTA 2BX3A 1QNJA 2W5EA 5F8TA 1QB6A 2GZ7A 2J9NA 2ZPSA 3BF6H 1UJ1A 3PLKA 3A86A 1AWHB 4IN1A 1Y3UA 3E0NB 4MG3A 5DP4A 3BSQA 3T28A 3RXMA 8GCHF 4AOQA 1XM1A 2FTLE 3BG8A 1FMGA 1O2HA 3S0NA 3L6PA 4Y0ZE 1O5AB 1W0ZU 1Z6EA 4ABFA 1L2EA 2ZKSA 5EW2H 1TNKA 1BIOA 5SGAE 2HPQH 1M9UA 1GBJA 1V3XA 2QIQA 3QK1A 4YM9A 1EPTC 2BY5X 2FWWA 1D3PB 5C1YA 2XYAA 1TX8A 3O8BA 3QTVH 2AMPA 1NRNH 4AFSA 4A1XA 1DWCH 3OTJE 4FXGH 1A0HB 1DANH 3ESTA 4RN6A 1C5RA 2HNTE 2ZO3H 1LTOA 2PR3A 5TCAA 1IHTH 4H6TA 1DWBH 3M5NA 3SN8A 1H8IH 1Y8TA 2B7DH 2QY0B 3MNXA 3ODDA 2RDLA 1HNEE 3L33A 3UIRA 2A5KA 1GBLA 3M5LA 1NFXA 2G5VA 4I33A 3TJVA 1BHXF 1BDAA 4OS7A 3DUXH 1O3BA 1DSTA 2PTNA 1IQFA 3TNTA 4RKOB 1YCPM 4AN7A 1YPLH 4O9VA 2OD3B 5E0GA 3SOSA 1C1MA 1TABE 1MCVA 1TPOA 2GTBA 1TGTA 3E3TA 5HYOA 1VJ9U 2Y82A 1QBOA 4O3UA 3E6PH 2ZU4A 5FX5A 1O3CA 3MH6A 3G01A 2BDIA 5EQSA 1YPJH 2XC5A 1OP0A 2A4QA 2F83A 2OC8A 3MU4A 1UVUH 3A83A 1SQOA 3E1XB 3LJOA 3ATWA 1HAZB 1TNLA 2XBXA 2ASUB 4X6PA 3RC5A 3SJIA 3UREA 2HLCA 3A81A 2NU4E 3TJNA 3M61U 1MKXK 2RG3A 4E05H 1SGIB 5PTPA 1S83A 1ID5H 2GVFA 1UK4A 1ANDA 1P2NA 3BTFE 1C9TA 1HAHH 3MNCA 5DO4H 2A32A 3I29A 3VFEA 1ELTA 2AFQB 4CR5A 3GCHB 2CN0H 1SPJA 1EAIA 3QZQA 2QXIA 3ODFA 4AZ2B 1O39A 3F9GA 1IQMA 5HM9A 1MAXA 1UO6A 3OX7U 2FOGA 3LC5A 5AF9H 1P05A 3RLYH 3H7OA 3L3TA 1IQIA 1GWAA 2HWLB 2R2WU 2A0QB 1ZTJA 1PQ7A 2FP7B 4Q7ZA 2ZDMA 1D3DB 1VCPA 4XBCA 3SV7A 1E34B 3B23B 2OBQA 2ZGCA 5A2MH 3LIWA 1LVMA 3URDA 5C1UA 2ZP0H 1V2UT 1FXYA 2GDEH 3M35A 1ETTH 1O2GH 1BOQA 3TK5A 4X1QU 4H4FA 4XE4A 4X8TH 4AFZA 2I6QA 2GD4B 1W7XH 3GCHC 1V2TT 2QF0A 4NZLA 1C2HA 4LK4A 2HPPH 1V2JT 1HBTH 2OQUA 4ZXYH 3TGIE 1O3DA 4X2WA 3QTOH 1O38A 2P93A 1KXDA 1ZZZA 3EQ0H 1C1SA 4I8GA 1BCUH 2G51A 4UEHH 1TRYA 2Y81A 1F0UA 2SNVA 4YESB 1A0LA 1SL3A 2A2QH 1PPFE 5DP7A 3BEUA 5DP6A 3KL6A 4FUEA 5C67A 2RCEA 3BTKE 1OOKB 3Q00A 4WJG2 4GSOA 1C5SA 3TITA 1MU6B 1DUEA 1CO7E 1EP6A 1GI4A 4JMYA 5DG6A 3VB3A 1HAOH 1AE5A 1LHGH 2VIPA 2ZDLA 1Y5AT 1KY9A 2A5AA 2ZF0H 4ISNA 1QURH 1GL1A 2ZDKA 1BJVA 2EEKA 1TYNA 4X2YA 2R9PA 1GBMA 4SGAE 1K9OE 1C2FA 1TPSA 2QA9E 2EC9H 2GV6A 2XC4A 2BD8A 4KTSA 4OS2A 1BTXA 3RU4T 4ESTE 1O2XA 4IS5A 2BD7A 3LGVA 2PSYA 3FP7E 1HAYB 3TPIZ 2BXTH 3EA8A 3SV9A 3P6ZB 5C20A 1T32A 2FXRA 3F9FA 2BVRH 1FY1A 3QX5H 1J16A 3FVFB 4U01A 1ETSH 4YT7H 2CXVA 5DKMA 3A8BA 7GCHG 2TIOA 1TGNA 1DVAH 5C1XA 2J95A 5JB8S 1TGSZ 3GY5A 2R0LA 1UTLM 1GI0A 3GDSA 1C2DA 2WUBA 2ZGBH 2ZDNA 4NSYA 2KAIB 3MI4A 1QQUA 3QGJA 1C2JA 1GBFA 4HGCA 4CBOA 3VEQB 2HNTC 4CRGA 1GHBF 4D7FA 1KTSB 2Y5HA 3T29A 3ZZ6A 4HFPB 4GLYA 1H9HE 3A87A 1N1LA 3RXUA 1K1OA 1ZOMA 2GT8A 1NS3A 2BVSH 4WF8A 4BAHB 3SNDA 1Y3WA 1OP2A 4X6OA 1XVOA 3AVZA 2OTVA 3SUGA 1A0JA 1DWEH 3GY8A 1Y5BT 4X2XA 1QIXB 1IOEA 2PLXA 3SNBA 2QF3A 1TOCB 3M7TA 1P04A 1MU8B 1F5RA 1Q2WA 3S9AA 5DP9A 1LPZB 1C1NA 4AGJA 3TGKE 3KQEA 1B0EA 2GCHF 1AZ8A 2SNWA 1O2JA 3MO6A 2FESH 2FI4E 3QO6A 2Z9IA 4B1TA 1HXFH 4JZDH 1AD8H 1W11U 4BXSA 1AFQB 1PQ5A 1ZMNA 1V2WT 2YNAA 2ANWA 4CRFA 1CA8B 2B8OH 4MNWA 2XNIA 3VB7A 1NRQH 1GHYH 4MQAA 3BIVH 5IDKA 1ZRKA 3LKWA 1O2ZA 1C2GA 4D8NA 1GJAB 1O5EH 2GGVB 3O8DA 4IGDA 3SU3A 1SVPA 3KHVA 2B0FA 3BTME 2OQ5A 1ESBA 1VGCB 1KXAA 1GJ5H 1XKBC 2F91A 2ZGHA 3ATIA 1C2MA 2LPRA 3QWCH 1DLKB 1A2CH 2FX6A 4BAQB 1O32A 3ZZDA 2BDGA 1ELVA 2ZPRA 1Z8GA 2W3IA 4CRBA 2OUAA 3LGWA 2JH6D 4B2AA 2VIWA 3RXOA 3PLBA 3D23A 2FYRA 2NU2E 4HZHA 4WVPE 1ZRBA 2ZU5A 1O3GA 2O9QA 1O2OA 2ODQA 3RXRA 3T2NA 1GJCB 2FS9A 3U8TH 3PM3A 1BT7A 1AFQC 2UWPA 4JK5A 1AGJA 3PMHB 1L1NA 1ACBE 1AN1E 2OC1A 4AYYB 1O2IA 4B74A 2W3KA 4GAWA 1NRPH 4Y0YE 3SU1A 1ANCA 1UHBB 4X6NA 4YOIA 1HB0B 1GHAG 1VGCC 3UTUH 1T8MA 3STIA 1PPHE 1E37B 2ZHQH 3SU2A 1UHBA 2HGTH 2O8WA 3RC4A 1WUNH 3SU5A 2ZTYA 5GCHF 4MNVA 2GCTB 3LGUA 1KLIH 4X1PU 1NROH 3ZZBA 2ZECA 2JETB 3KIDU 2D2DA 3EGKH 4XSKU 3ATMA 2G81E 3CP7A 1O5BB 1A46H 3GISB 5J4SA 4IMQA 1SHYA 3Q3KA 1Y59T 2WYGA 1MH0A 1AQ7A 2IPHA 2DE9A 3VXFH 1SG8B 3B9FH 2V6NA 1Z8RA 1A5HA 3GY4A 1DFPA 4CH2B 1G3EA 2H9TH 7KMEH 1LVOA 8GCHG 2Q6GA 5FBEA 2JH5D 3HKJB 3S7HB 1Z1IA 3SJOA 5FPYA 2RA3A 5JBAS 3B8JA 3HPTB 1NM6A 2BHGA 3FFGA 4XBBA 2P8OB 3T27A 4YZUA 1PPEE 3RXIA 3R0FA 4JYVH 3A85A 1P2IA 2CF8H 3SUDA 3GCNA 5A8XA 1LPGB 1ZHMA 2GCTC 2JETC 3GCOA 2VVCA 1EXFA 4DOQA 3RUOA 2PHBA 2C8WB 4Q80A 2A5IA 2O8LA 2EI8A 5JYIA 4QT8C 4J2YB 3VB6A 1EB1H 3FZDA 1V2LT 4I8HA 2Z3CA 1MQ5A 1TBZH 1LHFH 1FY3A 3VB4A 5E0HA 5T6DA 1TB6H 1HCGA 1UCYH 2H5DA 1P0SH 2P8OC 4TWWA 3RXPA 1JIRA 4J1YA 2BD4A 4FVBA 4AFUA