8FABB

Crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
214
Chain Sequence
AVKLVQAGGGVVQPGRSLRLSCIASGFTFSNYGMHWVRQAPGKGLEWVAVIWYNGSRTYYGDSVKGRFTISRDNSKRTLYMQMNSLRTEDTAVYYCARDPDILTAFSFDYWGQGVLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-LAMBDA HIL FAB (LIGHT CHAIN)
publication title Three-dimensional structure of murine anti-p-azophenylarsonate Fab 36-71. 1. X-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 47
structure length 214
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB01
2AXHA 2NX5A 1ZK9A 3GIVB 5FV2A 5SWQB 3WL9A 3GMPA 4XP1H 1EPFA 4JDZA 4WNQB 3FAXA 4CVZB 3S35X 4K9EL 3MYJB 1CXEA 4LNRB 5ACMA 1MQKH 2NCMA 2QSVA 1E28B 3IDYB 5ACZB 3BO8A 5HGDA 1SYVA 1EDQA 5JR1H 3O11B 3ZMRA 3VFMA 1EJOH 1FFPA 1NC2B 3QHZH 1P1ZB 1MLBB 4WI6A 5SWZB 1N0XL 2M2DA 5ICXA 3VG9B 1NGZA 4ZD3H 3A6BH 1C8PA 1R3JA 1HIMH 3ZTJG 4OZHA 5HI4D 4KU1A 4L29A 3C5SB 4XXCC 4BFIB 5FYJD 2XWBA 1QLEH 3SO3C 2DAVA 1BHGA 1AP2B 4DGYH 4YE4L 5DMJB 5J12B 3T0ED 5L2KA 4X98B 1WK0A 4AM0A 4LF3B 3AUVA 4DEPB 3KPPB 1JTPA 2EXYD 4I9WD 3D1MC 2Z8VC 5D2LF 3MJ8B 3OKLA 3RAJH 1IEAB 4MD4B 2VDPH 1D9KB 3HLAA 4UUJA 1QNZL 1FZOB 5ETUA 4U6XB 3I75A 3I02B 3KLHD 2O5YH 2FATH 3KPOB 4BK4A 2XKUA 2CMRL 3D87B 3RWCA 1F42A 3UJTH 4XPBL 3V4UH 4MJ6A 3MBEB 2FSEB 4JM2B 2YA2A 4H20L 4KRPC 3C5JA 2H2SD 2MQ3A 3VXNB 1KIPB 1DEEA 5FUZH 1N3NA 4QHKJ 4P48A 3RHWK 2ICWB 4R90L 2NY4C 4XP4H 1XCQB 1EJ6A 2PUQT 3F65A 3TBYA 3LSOB 5CZKA 1UWEL 4UNVA 5JMOC 3KXFA 1E28A 2IPUG 1IT9L 3OKOB 3BT2L 4Z7QF 1IGCH 2E9BA 2NXYD 3RVWC 1G7IA 5DLMH 1Y6KR 4F37K 4EDWH 5EBLB 3NZHH 4M48H 4X9HA 4JFEA 4N8CL 2E9IA 4ZFOB 3CX2A 1WTGT 3WNOA 1T0MB 1QG3A 4CVXB 3G6AA 3DSNA 1EFQA 3LN4B 4OZFH 1CLOH 2E8ZA 3B9DA 2H32B 1D5XB 5A2KH 5HPOA 3GSXB 1LO2H 3ARXA 1CU4H 3ZE2E 1EHXA 4YPJA 1ZA3A 1BQLH 2ZOLB 4LLQA 4OQTH 5MEPA 3WNNA 3SY0B 5FA3B 2PO6A 4ORZC 1NFIA 2WBJB 2YUWA 4P23C 3VFVA 3H7BB 5EC1A 3DBXB 4O2FB 2ADJA 2XWJB 1T7XA 3H7LA 2W38A 3BP6A 2BMKA 5EDXA 4ORGB 3NACL 1MWAH 3TA3A 2JE8A 4NQDD 4U3XA 3SKOA 5IW6B 4N5ED 1D5BA 4MQ7B 3WUWA 3O8XA 2VITB 4KJYB 4JFFB 1KEML 5KVMC 4K7PL 4AEHL 2VLLB 4HCRH 3BZFB 3WO4B 4WUUE 2EKSA 1AO7A 4JO1H 5E2WH 1I85A 2Z91B 5CINL 1KTKE 4MX7A 2NNAA 3QCTL 2HFGL 3CFBB 3KPRE 1JL8A 4YHZH 3OKMA 5TE6H 4PJIF 1YEEL 7FABL 4PD4J 1J0KA 1G0DA 2BK8A 1YEKH 5T5FH 1G7HA 4OD3H 3RBSA 1KENL 1A5FH 3V0VB 3HAEG 1MLCB 4I48A 2OZ4L 1X4YA 2C1PA 1CXFA 2V7NA 3U30C 3QIWB 5T1LA 3NVQA 3CFDA 3MJ7B 4OZGE 3STLA 1C5BH 4P3DB 1JHTB 5DRNA 1PX4A 4C56E 3HE6D 2Q1EA 5CEYB 2HWZL 4JJ5B 4WWID 5A43C 4GKSB 1ZANL 5IW1B 2AK4A 4PJEF 5BRZB 4PR5B 4BZ1L 3L5XL 1G9NH 5IMKA 4HXBH 4X6CE 3ARVA 2VQ1B 4L8DA 1T21A 1KG0B 2X41A 2OCFD 1MI5D 3QQ4B 3BPCB 1EMTH 5HPMB 1A6WH 3QCUH 3AC0A 4YGVA 3L1OL 3U7YL 3B3IB 3I6LD 5T3ZL 4C58B 3TJEL 4UILH 3OTTA 2ZWLT 3HFML 1CCZA 5I1DA 1CL7L 5I6XC 1P4IL 5FOJA 1T22A 3V8OA 3P11L 1QRNE 1TDQA 4MSWB 3UPCA 5JW4M 3I6KB 3E6HB 1JGEB 4TVPE 5GS0D 5C08D 2Z8WC 5LWYH 5IHBA 3ARSA 3D18B 4OD1L 3WFBH 4Y16C 1SBBA 4FS0A 4HPYH 3LH2L 5F3BB 1BF2A 4Y19A 2Q86B 4NQVB 1MCHA 1V05A 2DQJH 3GSRB 4N90D 4DKEH 2F5BH 3EOTL 4RGNB 2QSCH 1BFSA 4F7CA 5K9JH 5JPMA 3DO7A 1P7QD 2DM3A 3T2NH 3TFKC 3WLWD 2P7TA 3IRZA 4L9DA 2J6EL 3U4EB 4HMEA 1OARL 1IM3B 2WW8A 1KELH 3TWCL 3QDGE 4XPAL 4Y4FA 3UTSE 4P2QE 1CBVL 1NLBL 2O26U 3D0LB 3HNVL 2DQCH 3MLXL 5F72S 3T2PA 2JJSC 2NY3C 1FFQA 1PG7X 3MV7E 4P3CH 5E9DD 2EEAA 1NANH 5ENWA 4JZNB 3V6ZB 4BUGA 4KMLB 1E27A 4JO4H 5FYKL 3WE6A 3OKEB 4JQIL 4PTUB 3ZDYE 3V52L 1X7QA 3WFHB 2AEQL 2ZCKL 4RAVA 3DV4B 4HIIA 4JVWA 4QRPB 2OZ4A 3SJVA 5FGSA 4S10A 2VYRE 2H8PA 4M6AA 5DDHA 3QDHA 2Z31C 1HDMB 2AQ1A 3CXHK 1MCRA 1UZ6E 2DIJA 4OZFB 1FYTE 1UQSB 3T1FA 3H9HA 2ORBL 1M7IB 1IAKA 5CKGA 2ENYA 1KNOB 1A14L 4R2GD 1HNFA 1MJUH 3G6JE 5AAWA 1ACZA 2YXMA 5TPWL 4LEXL 2IQ9L 4AQ1B 3DUSB 5D7LE 2AJVL 3MRGA 3HZMA 1HQ4B 4POYA 4FQLL 4I77H 3EYSH 2AJZB 2YBRB 1H3GA 5CWSB 5KVGL 5JHDA 3PP3K 5MEOA 2GTZB 3QWRD 4P23A 1IGML 3ULUC 5IQ9A 5KZCD 1MWAB 4J3WA 2R1XA 2Y5EA 1B0WA 2NY7L 1Y0LB 3OKKA 3V4VL 3UTZB 4QYOB 5IG7B 5FUCC 5KJRH 3ZE1F 3ZSTA 4BKLB 3ARRA 1JP5A 1F58L 2BOCA 3HPJB 3O0RL 5GIRA 4HFWB 3ZYZA 3PP4H 4PJ5D 4W4OC 1OB1A 4M8VA 1AR2A 3W2DH 3KYNA 4HJGB 3QPXL 4RZCA 1V3KA 1YMMB 3CFKB 4L4TB 1TZHA 1S7RB 1RUKL 2CLVA 1BEYH 1BQHB 3LRHA 3C09B 5ADOL 2R2HB 1EEYA 4JY4B 4KMQA 2UZIH 2VABA 2LV4A 2MQ0A 3O6FC 5EO9B 1ZGLB 3VGHA 1ZGLM 4OB5H 2NXZC 4PY8I 5J06A 2AEPH 5CSZA 5I1JH 2AABL 5CJXA 1X5AA 1T2XA 3MUHL 5L0QC 2P24B 5LBSH 4G42A 4GG6F 4DJMA 2DMCA 1N4XL 1MNUL 1Z0MA 4RWHA 5E2VL 3R8BB 1U8PA 4TNVF 2NW3B 3B6SB 2EH7L 5AYQA 2E7LA 4WU5A 2ZUWA 3L3DB 4TN9A 5C0DA 1S7VB 4TYUA 4XMKH 5TGBB 3RWHA 1RUPL 1Q0XL 2CDFA 3FOLA 3DETC 4DVRH 1RK1A 2JIXB 4KJWC 1U58B 3MXVH 2BHYA 2NY6D 1VKXB 4KDWA 5DRWB 4ZS7H 5I1AB 5HYFA 1G7MB 5C0GB 4U31A 3LKQA 3J7HA 4PTTA 4NQCB 4XPHL 4EI6B 4BQ8A 1R3HB 2NW2A 5T1DL 3ULUL 2C3HA 3RVXD 2E9WA 5KS9B 4ETQB 1HKFA 3TNMA 4PGDA 3GM0A 2IALA 1ZEAL 4IJ3B 1V7NH 3O3DA 5T33H 4PV8B 1AGCA 4O4YH 3DUUB 2R23B 4LU5H 1KJMA 5F8RC 4KAQH 4MJ5B 4OGXH 2R2EB 2ZZUT 3DOSA 2B20A 4PRHD 1R5WB 4Y16A 1AC6A 5C71A 5FYJH 4WU7A 4NC0B 2FJHB 3DROB 1BBJA 5F6HJ 1MCNA 3FQXA 5F7FA 2ICWI 3QUXD 2EIZB 3WS6C 2CPCA 3OJDA 4JG0L 1XR9B 3VGBA 4L4JA 4PP1C 1D5ZB 3IS1X 3NFPB 1MPAL 2E6PA 3QQ9D 1A02N 1U8OB 4HC1H 4KI5F 1JPSH 4M1DL 4Y1AA 5DT1H 2P24A 3DLQR 3QDJB 3RWIA 4NFDA 4PLKD 1ZLVH 5I30L 1E4KA 4U1MA 5CP3H 1KLGA 3FTGB 1P2CA 5CCKL 4GS7C 4J4PA 1AHWC 1AIFB 2BSTB 2PCPB 5HHQB 1XF3B 4X7TB 5JLZB 4P2YA 4CNIB 5D6CA 5EBWA 4Y5XB 4L1DA 3U6RA 3QDMA 3VD5A 1A9BB 5DK3A 5FK9B 1QBLH 5E8EB 4NZJA 4HDIB 2FHFA 2QADB 3PWNA 4LP4A 1BMGA 4OLVL 5IGXH 4NKMB 3QQNA 4EQ2A 4OM0L 6FABL 2WWKT 1D6EB 1LO5B 4U1SA 2BY2A 4M62L 4QOKB 2JB6A 2GSIA 4XWOC 1P4LB 2OQJB 4XX1G 2Z0BA 4XB7A 1YPZB 4PRBB 4XNMA 4V1DA 2BY1A 5IHUH 4D2NA 5C2UB 1OT2A 5CD3B 4QCIB 4KQ3H 3AB0B 4EIGB 2ZJSL 3TO4A 1FV1A 2NLJA 4ZOBA 1HZHH 4L3CA 4QHLA 3BGMA 1HSBB 4NYLB 3FT3B 4J1UB 2L7JA 3L7FA 4KI1A 3QXTA 4AG4H 3GK8H 1JYVA 3IXTB 1IQWL 5MP6L 2X4UB 3KYOA 3VA2C 1QO3B 5E99H 1DFBH 1JYNA 2B8OT 4WJ5B 3FO2A 3MUGB 4Y4KC 4Z77B 3ZSSA 3ZDZF 1GGCH 1RULL 3SKJL 1VB9A 1QSFD 3HE7A 2OTWA 3QQ3B 4PJGB 4QF1B 4X4MA 1GJIA 2XG5A 3ZTNL 4NQEB 1DLHB 4OLUL 3C60D 1UEYA 3QXAB 3T4AB 3HG1A 2Y1VA 3U82B 3WFEH 4PY7A 1G6RL 4JPVL 3RWEA 4W70A 1URLA 3PNWA 3W0WA 5DJ2A 3D0VB 1OP3H 3QUZC 5DD0H 5DFVC 5FGBA 2VL5A 2GITA 3FO9B 4M3JA 1H3TA 1S9YA 2VH5H 1JWSA 1MFBH 3WDHA 1BM3H 1QQDA 3O6FA 3REVA 1CYGA 4GRLC 3N06B 4M02A 3BP4B 4QXWA 4P46B 1KLFA 1J5OH 3GMLA 1FDLH 2VDQL 1XZ0B 4OV5B 3HNSH 4KRPD 3S3PA 4GQ9H 2F19H 2E7HA 5F9WC 3NN8A 4O5LL 4D0DA 3BD4A 3LS5H 4LARL 5DZOA 1R3IL 1TQBB 5F9OH 3QG7L 2QL1A 3PG2A 4OM1H 3IKCB 1ZE3C 2ZUUA 1NFDE 4CBPA 4LBEA 3EFDH 4N0CC 3CPLA 2FGWL 5DEGB 1K5NA 5ANME 5GGUB 1XGUA 2XRAH 3H9SE 2VXVH 1DVFD 2BC4B 3PWPD 3AS0A 3QUYA 4PYHA 1A0QH 1RQ5A 4UU9B 2RCSH 3X3FL 5EC2B 4LHUG 1TXKA 2OI9B 3BUYB 1FNLA 3VXSA 5GS0H 1YNLH 5I1CL 3T0EB 1KT2B 3NCCB 4PP2A 2WQ8A 4YBLB 2D7TL 4ZUTB 4PRPD 1DE4B 4ERSH 2EDEA 5EA0H 3KGRA 3WS6A 1OSZA 2IPTH 2YUVA 3TPUA 2AJSH 5DD6B 1N26A 1JNLH 5EUKB 4FXKA 1U92A 3SKUD 3PIQA 4H0GA 2F54A 4KTYA 2VXSL 3L6FA 3GSVB 3BP4A 3LS4L 3BDYL 5KW9H 3ZKXB 4U0RB 3O3AA 3R1GL 4AQOA 1F11B 3H9ZA 4Q0XL 1HH9B 4RNRB 4GAGL 4POZD 1J1PL 3TZVD 1JUFA 1AHWA 2AAVA 4OZHF 4F9PC 5GGTH 3GHEH 1G6RA 5F96L 5DD3H 4UZGA 1JJUA 2X9WA 1TJIL 4WDIA 2O61B 1DBKL 2J8OA 1NC4A 4PG2C 3IKCA 4Y7MA 4XMLL 1J18A 4JZOB 3QHFL 5BO1L 1MRDL 1EEUA 4IRSC 1F5WA 3O6MH 2R9HD 2NXYB 3L3OA 5GSRA 4CADA 5DVMA 1UYWH 2PYFB 1KCRH 1F4YL 3BZDA 1F8TL 5ID1B 3U0WH 2ZPKH 1UCTA 1XCTB 4XP9H 4NQUA 4N9GA 5LQBH 3CLFL 4WI8A 3TN0A 4ELKB 1JFQL 2VJXA 4LPWA 5DC9B 2ITDA 3RZCC 3FO0L 5HI3D 4TSBH 1FIGH 1PLGH 2VXTL 4PRAB 3UZEA 2JELH 3SE4C 2DB8A 1N8ZB 4H1LH 5HJ3B 1UVQB 5CEZL 2G60H 5FFLA 2AV1B 2UZXB 3ELAT 1XT5A 1ORQB 3CDGB 4PJBA 1K6QH 4AENA 3FT4B 4NO5A 4P4RB 5D2LE 3P73A 3VRLE 2JB5L 2HG5A 4ZAKA 1LO4L 3VXMA 4KHTL 2PNDA 5GHWL 2A83B 2CLRA 2AXFB 2XKNB 3TPKA 4ONGL 1FGVL 1YEFL 3MO1A 2JTDA 4AIZA 3Q3GA 4MNHA 4TVSa 5IROC 3SE8H 3WBDA 2ED8A 4NQDB 3EGSA 5FKPB 4Q6IB 1T3FA 4K2UL 1QFPA 3QUKA 2VERN 4WFGD 4NOBA 3ETBF 3HR5A 5E5MB 2VE6B 4YHLH 3MACL 3EOAB 4NBYB 1MJJB 2VDKH 2IH3A 1ADQH 4G9FA 1X3DA 2GK0B 5HHNA 1JF1B 1ZT7B 5ACLA 5I1LB 5EWIH 5IMOA 4GMTL 5D1XA 3L3IA 4Z7QE 1KPVA 2QR0B 3L5WB 3TFKD 3QUZA 1WIPA 4GOSA 1OAKL 5ABDE 1NJ9A 3KR3L 3KPQA 5EORH 4G9DB 4LLWB 1WFTA 4M93B 3DVNB 3ECBB 3ISWA 4O02L 1SJEB 2CXGA 5DMKA 1OGTA 3A67H 3NA4A 1GYAA 1CGSL 4QT5B 4P5MB 3QYCA 3FO1B 3KYKL 2B4CH 3HE6B 1KFAL 4L3EA 3F7RA 5DRZA 5BCAA 3TIEA 3FHAA 4YK4C 4P4RA 3GMQB 4MA3A 5CD5C 2C7UA 2AJ3A 1JGLL 1OLZA 4NZTH 4Z7UB 2BXYA 2IADB 1EO5A 4K3DH 1MI5B 3QRFM 2BNUA 3T0XA 5C6WH 5KAQG 1NGQH 4WRLA 1MH5A 4OKVA 4JRXA 4LNVA 3FN9A 3PGFH 1S5HA 2EDXA 2V2TA 3O9WC 4YFDB 1MEXL 3BJLA 3I9GH 1EXUB 3GDBA 5F89B 2EYTB 4MLIA 2F53A 2PTTA 4K8RC 1BFVH 4GH7B 4N8VB 1VFBB 2X1PA 5LGHH 3THMH 3W81A 5C08B 4ZO8A 1NANI 4JAMA 3T77B 3ZYOA 1EZVX 4K07A 1MSPA 3QO1A 4NSKB 1ES0B 1VENA 4BZ2H 2HN7B 1NKOA 2CDEB 3DARA 3S35L 3LQMA 3MLSH 5F7KC 1C08B 1P7QB 1RZFL 3A6OA 5T5NG 2VLRE 4B50A 5I1GL 1ZWIB 3BKCH 3ECBA 3S3SA 2EE9A 3PV6B 4K9EH 1LDSA 1U3ZA 2LTQC 4JRYE 3HZKA 2XTJE 3AM8A 2FD6L 1EEZB 1N0XH 4HLZH 1IM9A 3B2VH 3IDUA 5HSFA 4JCLA 1FL5B 4X99A 1NAMA 1FFNA 1WFUA 3U9PH 4X4YA 5FYLE 3QISA 3WN5C 1CFQA 2CR6A 4PJEE 5E9DB 3QNZA 4UIMA 4J3SA 1CVRA 1J10A 3X12B 4YE4H 5D72L 4I3GA 4S2SB 3BH8A 4NZDA 5HHVH 2YPLA 4PG2A 2F8OA 5DSCA 4IHOB 5LGJA 1N59A 1GGYA 3LQZA 4KTDH 4XCNA 4U1JA 4NT6B 1CDBA 5B3JE 1NCDL 1U93A 2EYTA 2NQCA 4G43B 2R4RL 4Y8AA 4YQXL 1CDJA 2NXZD 3QEQD 4JFDD 2CMRH 3S9DB 4H1LB 3LD8C 4JRWA 2EYSA 1P84K 2HFFA 1IGTB 5H37G 4W81A 1OCWL 4K8RL 4R2GB 4PRIE 4YXLL 1T5WA 4H20H 3Q6FA 4L8SB 3V5KA 4W6WB 5LKNA 1OTSC 3VGDA 4LK4A 1JNHB 4PPTA 1H3XA 1RURL 4CRPA 4MNQD 5ITFB 3TVMC 1J0IA 2H3NB 1BVKA 3NFNB 3LOWA 4LLUA 1LEKB 2ENSA 1C12B 2EXWC 2IAMC 5DRXB 1NSNH 2EDBA 3KDMB 2KKQA 2CSPA 3FQUA 5E4EC 4G8GD 3MV8D 3OV6A 3RA7L 1LK3L 3EYUH 2IC2A 3OGOE 1IKFH 1WSST 2EZ0C 1CE6B 5CHNA 4OIIL 4FQIH 3S3JA 3CU1A 3QPQC 4I3SH 3AY4C 2OYPA 2Y7QB 3UBXA 4BSWA 5C2BL 2CD0A 5A16B 1JPGA 5IROA 3UTTD 4N8CH 5D7KE 2W60B 5EU3B 2A73A 2X4RA 5AEAA 5JIIA 5GS1A 3C9NA 4HPOL 4XRCA 4PJ5B 4X7EC 4QRRA 1TTUA 1J12A 15C8H 1XIWA 4FABH 1MVUB 5CEXA 4OSUL 4LSUH 4NRXA 5CGYC 4DCQB 2XN9E 5K9OB 4XMPL 3ILPB 3TCLB 1CWVA 1UM5L 5LXGH 4CMMA 5AD0A 3MNVB 4P49A 3ZHKA 5KG9A 3GSUB 3KYMA 2ZKHL 2B1HH 2Q8BH 1P5VA 3QUML 4E41D 3JBG7 5FKAB 4FFWD 4MJIE 3WFDL 5IMMB 4S11A 1WQVT 2KUTA 1UB6B 2VLME 1ZHBB 4WI3A 3MRIB 4XCYA 3BGFC 1LE9B 2DTMH 2XXMB 3NACH 2WAHA 4JN1H 4PBWD 5C0CD 1UM4L 3UROR 2FEDD 4KUZL 1EX0A 4HEME 3K80A 1F4AA 4K7PH 4AEHH 3QAZC 1RUML 3HUJB 5FHAL 5GS2D 1TMCB 4G8FB 1IAOB 3SGKC 3WYRA 5IBUB 3QCTH 2BRQA 2HFGH 3SE3A 2GAZB 5B38G 4MA1C 3LCYA 3S5LG 3NTCL 3QWRA 1QSEA 2EYRB 1YEEH 2JKXA 3JTSA 2JJUA 2OMBA 2NY6B 5H2BB 4O58L 2W07A 2HVJB 4GKNB 3MROB 4I5BA 1E6JL 3DV6B 2OR9L 4K55A 5C6TH 5IB5A 3FN0L 1YN7B 4PB9H 1AXSB 4GW4B 2J5LC 3L5IA 3KLAB 4FXGA 3SQOL 3JV6A 4N1EA 2PF6A 2N7BA 2HWZH 5C0BD 2BXZA 2A74A 1IEHA 3KPLB 4K3EH 1T5XA 3MRMA 4PRHB 5I75C 1SBSH 2XFXB 3OB0H 2XT1B 4FTVE 5MHSE 1UJ3C 2FJGB 1SM3L 2P8PA 1GZQA 4BZ1H 3L5XH 1NMAH 4NN7B 1OP5H 4TOYL 2VRAA 5CZXC 5HGGS 1WBXA 3IFLL 3BZEB 3JTTB 3FQNB 2GCYB 4XCFL 1MCPH 1AQDB 5BQ7B 5K59E 4M43L 4PRDB 3GBMH 5IMMA 5MENE 1EFXA 1T1WB 4X7SH 1ONQA 3TJEH 1I3RB 3KLSA 1AGEB 3HFMH 1MHCB 2GJ6A 5I15H 1CL7H 4D9QD 4WY7L 4GG6E 2MCG1 1P4IH 1SJXA 3FKUS 3BW9B 4Y4KD 1KPRB 2YN3A 3E8UH 5D7IA 4NJAH 4OLXH 4RRPA 3U9UA 1A7NL 3KNBA 1S9XB 4JDVB 3RFZC 4RDQF 1DUYB 2YPVH 3LH2H 4LSSL 1NDMB 2A77L 1JMZA 2RFXA 3H2WA 3T8XA 5BZWA 1IGIL 4DGVH 3D39E 3QUMA 3EOTH 4NO0A 3JV0A 1C7SA 4M7LT 1CFVL 3LN9A 3O3EA 3WXWH 4KFZC 2J6EH 1U8QA 1QLFA 4LSPH 4S1DD 1CDYA 3DI3B 1CI5A 1PG7L 5GGQH 4EXPX 2LAGB 3P30H 1BWWA 1CBVH 4GRLD 1YA5A 3HNVH 1ZMYA 3VWKA 1SHMA 3S36H 3RGVC 4WHTA 2XA3A 4P57B 1CE1H 3H0TB 5DHVH 3MC0A 3P0VL 1RZJH 3D3VD 1YMHB 4NHCL 4JQIH 5EU6D 3QUXA 4H26A 4UDTB 3V52H 3AREC 3TVMA 3QFDB 2ZCKH 4KVCH 3CVIL 4KK5D 3VFPA 2O5ZL 5DJ8B 5T1MA 1Z9OA 3QWQB 5IM7A 3VCLB 3FFCD 4KI5E 1HYRC 2ADFL 5D71H 4KRLB 4NRZA 4N0CD 3V6FB 3G04B 2DM4A 3AY4A 3GMMB 3GMRA 3IXAA 1I1AC 4FQCL 4F7MA 5CEZD 2HT2D 4LLMA 2ORBH 2VDMH 1QSFB 3C6LC 2NY1D 4DN3L 1OP9A 3C60B 4F3FA 3H3PH 2EE6A 3SO3B 1YECL 4MNGB 3BP5B 4YNYB 4DZBB 4WEBH 1FN4A 5DWUH 1K2DA 3QG6B 2IMMA 3ROOA 5TPWH 3PL6C 1ZAGA 1I3VA 3QO0A 1DTUA 2AJVH 4MB4A 4NWTH 5I0DA 1QKZL 3GSQB 4HKBB 3RHWF 2VAAA 3ARBA 1IKNC 3BAEL 2UUDH 2P5ED 5HD8C 1RSFA 2A6IB 1IGMH 3HS0B 2I5YL 4Y89A 5ICZB 4ODUA 4RFEB 3ZTJH 3MREA 4R3SA 4F37F 3VXRD 2XZQL 5J11C 5IBLD 1J8HD 2XICA 5FGCB 1B6UA 4IOFC 4MCZA 1NGYA 2ZUTA 3DVFA 3KPSA 4U05A 4ZPVB 3VFNB 3F6LA 4KK6C 3W9EB 4KRPB 2OTPA 5ELIA 4LVHC 4NKIH 4XNQA 3HNTH 3L7EB 3R0NA 3QPXH 1JBJA 3PJSA 3UYPA 3SGKA 1S8DB 1FFOA 5D93C 1OWRM 1H5BB 4ODXB 1YJDC 5JDJA 5EZIL 1Q9WB 1VGEH 3LRSB 4LIQH 1V7ML 1RUKH 1OTTC 3F5WB 4IRJC 1EAJA 3VCLA 3OX8B 3QBTB 4KRNA 3JUYA 2A1WH 4RMTA 4XVJL 1VESA 4IRSD 5IV2A 2DJSA 4FP8L 1A6UL 4NPYA 1OPGH 3BKYL 3NIDF 4QRTB 1ZVSA 3M17A 1YDPB 3QJHB 4J3OC 5JQ6L 2VB5A 4OKDA 3R8QA 1DVFB 3ZDZE 3D2UA 4Y88A 3PWPB 3QSKB 1NUDA 4LLVA 3WKMH 3RZCD 2KBGA 3CMOH 3MV9E 1N4XH 2Q6WB 3BP5A 1K4DA 1ULVA 5E2VH 4DK3A 3RQ3A 1U91B 3BZ4A 1AXTL 2BVEA 5C0AE 2M26A 3FONB 3N50A 2EH7H 5C8JA 1UJ3A 4NCDA 3V6OA 5GRJL 4LCUB 4UV4L 4G80A 1IQDB 1KCUL 1SMAA 4PRPB 4Z0BH 1E4XH 1RUPH 5F9JA 1Q0XH 3T0VA 3CDCA 5EU4A 2EDTA 4YAQB 3HMWH 4YPGA 4OZIE 5EZLB 1YEDB 2NY2D 1M71B 1JZ4A 1AKJD 2FO4A 3LN5A 2HT4C 5A2FA 1LP9B 3M8OL 1HNGA 4BSVB 4XPHH 3WV0A 1E6OH 4RGMC 4AK1A 3ULVE 3F62A 1TVHA 3GJEB 4FZ8H 4U7KA 3ULUH 2QQKH 1HHGB 4TTGA 5EIIA 5HVWA 4F7EB 3VFOB 4GBXA 4LAQL 3NGBC 3O3BB 4M7ZC 3TZVB 2IFFH 1EHLL 4G6KH 4OV6F 3RVTD 1QR1A 3LEXA 4JFOA 2ILLA 3PXJA 3BX7C 2YRPA 1XAUA 1ZTXL 1HWGB 1CFTB 2ATKA 5KBNC 5GGRB 4G7YL 2XIDA 3QB7C 4X6DE 3FT2A 4YDIH 3KG5A 4XBGA 1MAML 4QRQA 1YJDL 2D3VA 1U8LA 3ARGD 1A47A 4HHAA 4BJLA 3MFGB 4MCYA 4JPWL 4XTRC 3BPLB 1CICC 4FQXA 4NQXB 1A2YB 5D7JD 4XPGL 3U30B 1KCKA 3HI1A 4M1DH 1FO0H 2BFVH 4OGAD 5SV3A 4I18A 4KKNA 5I71B 1NGWA 5I30H 5JO5A 5DHVB 4Z76A 3LEYL 1JF5A 2VDOL 4KPHH 3SDCD 1JZ8A 1OQXA 3RGVA 1UFUA 2R69H 4FFVD 4JN2B 2VDRL 3PHQA 1JHKH 3BEVA 4HGKC 1MJ7L 4JB9H 3ZE0F 5FOBB 5TDPB 4TVPL 1A7QH 4W4NA 5CD5D 1P9MA 3AREA 4X6BB 3HAEH 3PGCB 1B0RB 4EQ3A 3DXAE 4EUPG 5JOPD 4U1GC 1FC2D 1ROWA 4ZOCA 5FM8A 1JGVL 5DD5H 4OLVH 2P49B 4O9HL 4KK8C 3GJEA 4GAYA 3K2MC 2VTFA 3O9WD 1AGFA 4UDUB 3E6FB 4QXTB 4K8RD 3QZWG 4JG1H 4M8QA 4OZHE 1FG9C 1FG2B 1HILA 4G6AD 1Z0NA 1FH5H 1HINL 5ID0A 3V5DA 3QNYA 4TTDC 2ADGB 1FNGB 1B4JH 3RX5A 2ZOKB 3GNML 3PL6A 4WUUA 3B2UD 3D25B 4PJBF 1G0XA 1HEZB 2ZJSH 1NCCL 4WWKA 5CGTA 4F8QA 1S7SA 1WWWX 2R0WL 3CK0L 4NQXA 3OPZL 1EO8L 1LEGB 4XHJC 4LHUD 5MP6H 4D0BA 3MRCA 4HX1B 2Y06L 3ZL4L 4PGEB 5BVPH 4OUUB 5C0JB 4J8RB 3F6IA 4DGIH 4LRIC 4OZGA 1T20A 1RULH 3I6GB 4PRNA 4X83A 1BVLB 2WZPD 5FECA 4C56A 2HKFL 2K7QA 4EI5C 4PJAE 2XNAA 5GS2H 2XQBL 4JPVH 4R96A 3O4OC 3UTQB 1KJVB 4P2RD 1BBDL 5DHYA 1KTDB 3SCMD 4Q74A 5I8EB 2FWOA 3EYVB 5D5MA 4O2EA 5FO7A 4JPIB 1QA9B 4JFZL 1UACL 1J8KA 4NQSB 5E8NB 5SWZE 3OBAA 5I19H 3D69A 3LZFL 3U2SA 4JFEE 5D96C 5D1QD 5TQ2L 3U0TB 1NBVL 3VD4A 4M7KL 5J89A 1FZKB 1P5UA 5HHOD 3S5LA 1T7WA 2EDJA 2VDQH 4E5XB 3OR7B 1IC5L 4HD9A 1WBZB 3FQTA 3S37X 4CL7A 1HHJB 5SWSD 1NMCB 4WTXA 4O5LH 4QXGL 2AS5M 4LARH 3QG7H 1JNJA 4XCCL 2IAMD 2XXCB 2WINB 1ZHNB 2BNQD 1LEGA 1S9VA 3DMMC 1GGBH 3V8CA 1FLTX 2AV7B 4FZEH 2EEBA 2EZ0D 3CCHB 4X4ZA 1BZ9B 4MDJA 3EO9H 4YZFF 2W0FA 4RMRA 3QPQD 4RIRB 1FE8L 5TE7H 4F9LA 4NNPL 1T7ZA 1WCBB 5F1IB 4O2CA 4QRUB 5I1IL 5I74B 3X3FH 4A6YA 1HQRA 5CGYD 4OLYL 1AGBB 1BZQK 5I1CH 2DWDA 3MV7A 1JVKA 3QIUD 1HHKB 1LK2B 4CJ1A 4ODWB 3OAZH 3X13A 3LKPA 4YFLF 3I2CL 4C4KT 3IDGB 3GKZA 2P5WA 3RU8L 2AKRA 2DS4A 1SVZA 1T0NA 5ESQB 3I3EA 1MVFA 5IQ7L 2GEEA 4CDGC 4NGHH 1S3KL 5IR1A 4OCRH 1AFVL 3IDNB 1CICA 1FO0B 4F33B 4N1CA 4X9FA 2NXZB 3QEQB 1HOCA 2VXSH 1GCFA 3MPCA 3WLBA 1RZIB 4Z95H 4JFDB 4B7LA 2VIRA 2X4NA 2FX8H 1Y18B 3F58L 1HI6A 3F12A 1IGYB 4GAGH 1NDGA 1FVCA 1I4FA 4XAKE 2BY3A 5GGVL 2Y07L 1K8DA 2ICCA 1NKRA 3ARUA 3GO1L 4RISL 2JCCA 3HAEB 5GGSB 5IEKA 3UP1A 3CC5A 4JLRB 1U8KA 4MNQB 3DHJA 1DBKH 4KKCC 3KLDA 4HUXA 3DX6B 3F7VB 1UH4A 3RTQC 5D7LA 3CDYA 4G8GB 3MV8B 2QQNL 2B2XL 3IRPX 3T3PF 3IJHA 2EC9T 2PXYD 4HXAL 3K7UA 1ND0B 1F4YH 1XF2A 2G75B 1F8TH 4ZFFA 3UTTB 5BZDB 4U1LB 2OTUB 3EYFA 1YY8A 4M6ML 4QHUB 1JFQH 4JFFE 4J3UA 1EUTA 1GHFL 1JI1A 4LSVL 4U1KB 3V7MA 4NRYA 4FQQB 5CEZH 1KLUB 2DQUH 5EO1A 3C08L 4Y19E 1GC1C 4LSTL 4FN0A 4WI5A 4D9LL 4JVPA 2GTWA 3NIGE 1JWUB 4HF5H 1CG9B 3LV3B 1A7RH 1X5LA 5CZXD 4HEPG 5ESQA 3UTPE 5J4MA 1X4XA 3HTLX 3BWAB 1LO4H 3CSBA 4E41B 1F4WL 2Z35A 4KHTH 5DJCB 3CFEA 5GHWH 4X6FB 5C0FB 35C8L 2X70A 1HHHA 2HJKB 5K93A 5E94B 4ONGH 1FGVH 1YEFH 2E6QA 4HS6A 1MIML 1KIRB 1WAAA 4U1HB 4PREB 4WTZG 2HH0H 3P40A 2R29H 3X11B 1RIHL 2AEIT 4M7JL 5C0CB 1T83C 1BD2D 4EXKA 5IB1A 5BRZE 2XZCL 3PWUB 2I25N 4HJJL 2AQ2A 4MA8L 3MLWL 4OFYD 2CLZA 3FJTA 4P5TC 3PV7A 4Z0XA 4RQQA 4I2XA 5D70L 4IIQB 5JNYB 4CN6A 3GUTA 3HC4H 2VZ1A 1TNNA 5ERWA 1JGDA 3UJJL 5GJSL 2G75A 4LGRB 2A0LD 4LVNC 2X4SB 1CL7I 1ETZB 5BZDA 3LKSA 4B53A 5LVEA 2ITCA 4BELD 4HKXA 4PB0H 3P4LA 3VMOA 5GZND 2OK0L 5HGBA 1U8JB 1I8MB 2DQTL 2FLRT 1INEH 5H35A 2NR6C 2E27H 5C0BB 4XI5C 1ZT1A 3G5YB 4NUGH 5JW5A 2OXGA 5IMLA 3CSYA 1B2WH 4WUKH 4ODVH 4RGNE 3UTOA 1GC1L 1JGLH 3B8SA 1OAZL 1GGTA 3ARDA 1IGFL 2M8XA 1DN0B 3WMSA 3TJHC 5KANI 4L5FL 1MHHB 5KVFL 5FCUL 5JHDE 2ZSWB 1R0AH 2W65B 5LGKA 5DK2A 5EBMA 5TDNB 3OKNB 2NPLX 5EOTB 3V2AR 3T2QA 3HC3L 2MJWA 3GBNL 1I1AD 4Y4KB 5CKAA 4UB0L 4P2OC 5DJXB 2DJ4A 4LPUA 1YY9D 1RY7B 3PDDA 3UAJC 4G3YL 2O5XL 3TM6A 4RCAA 1X5YA 4R4NC 3L3GB 5KSVB 4K3JL 4X6EA 4P99A 2FBJL 3MOBL 3BXNA 1TQCC 5C0IB 4QRPE 5EPMB 1X5KA 1RZFH 1GSMA 1ETZA 3IU3A 3P9WB 4NN6B 5FDWA 1IZKA 3WJLA 3QNXA 5J6HB 3EO1B 3VFWB 3L3HA 3B9KA 2FD6H 1D5IL 4GRLB 4APQC 1VACB 4IS6B 5TJWK 4JFPB 1TIUA 4JKPL 3NH7L 2HMID 2VR4A 2O93L 5CIPA 1DEDA 1U41A 5D1ZC 2HJFA 5SX5H 4YDKL 4LMQI 4XPTL 1MUJB 1OY3B 1INQB 1YN6A 3C8KB 1ZLUH 5D7IF 3D3VB 4F7PB 5EU6B 1HYSD 1F2QA 3WHE1 1VGKB 1NL0L 4R7NA 1IBGL 2X4OA 4JHBA 4Y4HD 4P4KD 1SY6A 5F1SA 2ERJB 4PGCB 1MF2H 3C6SA 1XF4A 5L8LB 3FFCB 1A4KB 1HSAA 5TDNA 3IAGC 3KS0J 4K71C 4NNYB 1VFOA 4MXWL 3MLUL 5EU5B 2EDWA 3VXTA 2J12B 1ED3B 3RL1A 1FNEB 1RJZA 4Z5RB 2PW1A 3FQRB 2NY1B 5F1OB 4FFZL 3TBWB 4K8RH 2BSSB 5IVZB 4YXLH 5J1AB 1QRND 4TVPD 3QH3B 1YMME 3FCTA 5EZJA 4L4TE 1WBYB 1NPUA 4Z9KB 3AU1B 4RGOH 5L6YL 3W39A 5KSBB 2Z4QB 3LKNA 4JGUA 4NJ9L 1OTUC 2IAND 5B39A 2X89A 1BIIA 2P5EB 1KC5H 2Q87A 4QTIL 5D9SA 5HGHB 3CMGA 1LK3H 3VRIA 5I2IB 3RNKA 2Q8AH 3FOMA 4Y1AE 3U46A 3VXRB 4OAWB 2A6JA 2YXFA 1J8HB 3QDGD 3W9DA 4W68A 1ZHLB 1EBAA 3UTSD 1G7QA 4P2QD 4HPOH 1T83A 4NFCA 4GW5A 5ESAB 2JJWA 4OSUH 4O00A 1G7PB 1NCWL 3MCKB 1YNKL 4MWFB 1YYML 3BDBA 1UM5H 4NKOB 3BEWA 3LB6D 3MRJA 4PJ9D 5I73B 2CK0H 1S7XA 2ZKHH 1I9EA 1CZ8L 4PJHA 4RFOH 3H9YA 1IRAY 4IRSB 5DJZA 4XTRD 2D31A 3O2VH 5KS9E 1JPFB 3WFDH 5I66B 5IOPA 1NFDA 5DEFB 3W11C 1KPUA 3WXVL 4BK5A 3VFRA 4BUHA 1S78C 4HUUA 1A9EB 1KBGH 2MQCA 3TBWA 2V2XB 2JK5A 4IMLA 5ANMA 3RZCB 2AJUL 1WJ3A 3H9SA 1UM4H 1PW3A 2XA8L 4Q9QH 4UT6L 1FNSH 1FYTD 2F74A 1JV5A 4QHNB 4XNZB 1RUMH 3P9MB 4TNVK 5JIKA 5K9KA 4V1DE 1M05B 1FZMB 2RJMA 2R2BA 2Z8SA 3MOQA 4UT7H 2B5IC 3B83A 1GIGL 2Z4QA 2Q76A 4I4WA 3TBSB 4YXHH 3RJDA 1T7VA 4HUNB 4GSDL 5JDSB 3H42L 4MXQD 4F7TA 4UQ2B 2NY2B 4LSQL 3NCJH 1AKJB 5I9QB 3L95A 1A4JA 3QDJE 4N0FB 4ZFZB 3QEHB 3GGWB 5DJDA 1H3VA 1A1NB 4WENB 5T1KA 3TV3H 2V9TA 4KXZH 3VJ6B 2G2RA 2FCBA 5IESH 4P5KA 5EOCL 1DUZA 2BVTA 1DANT 5C9KA 4UTAH 3CFJB 5LJYH 2DD8H 3RNQA 3G5VB 3MNWA 4WFHD 3LKOA 4G5ZL 4J23A 3DUHA 1VADA 5F88A 4R4BB 3CXDH 5JORB 1SM3H 3LMJL 1JZ6A 3CXHJ 3IVKB 4ONFL 3EO0B 4UMGA 4ZUWA 3ARGB 5BS0A 3EAKA 5IVNA 4LPTA 4XCFH 1NMBL 4XPFH 3NIDE 1WVZA 5D7JB 5J3HD 4JFHD 4M43H 3RWGA 5BV7L 2W0LA 4XHJD 4QOKE 3EDEA 1NQBA 5KVDH 4FQJL 3G5XA 4MB3A 1R5IA 3V4PL 4F15C 1NEUA 5BXFB 2LU3A 3MR9B 2A6DA 3P4NA 1X5ZA 4FHBD 4YHKL 4APQA 2ATPA 1Q9OB 3EDKA 3SDCB 2Y36L 1YPZE 4M7LL 1T2QL 2AGJL 3IDJB 2MWCA 2FHBA 1OSPL 3JUZA 3ULSB 4YK4B 1PFCA 1G84A 3WD5L 4EI5D 4JFXA 4LSSH 5HY9A 5D6DA 2R1YB 5JOFA 4YO0A 1TCRB 4KVNH 2WK2A 4TSAH 1QFOA 3VGAB 5JZ7D 1Z6JT 3NFSL 4QWWC 3QJFA 3GGWA 2UWEA 1C5DA 3MUZ1 3O9WB 1YQVL 2XPGB 4YIQA 4AEIL 3QDAA 4JZJC 4LCYA 2VSCA 4PJGE 2ID5A 4YHOH 2FR4A 2LU7A 1AE6H 1CGUA 3RDTD 3HPLA 3ESUF 5CBAA 4PV9A 4QTHB 4R0LC 2D7QA 4DWHA 5D4QA 3MLRL 4NDMB 2W0PA 3O2DL 4NHCH 5FYLL 4HMCA 1ZSDA 1UA6L 4TPRH 3GMOB 3CVIH 3CU7A 2DQFA 4WW1A 3MA7A 3GJFH 2YC1B 3DMMD 3EZ8A 2J88L 4FQHB 3OGCA 4LHUB 1LP9F 4PJFA 2BOBA 5CJOH 5B8CC 5F7DB 2EE3A 3SDDC 3N1GC 4KTEH 2OSLB 1UWXK 2APBA 4FQCH 1VERA 4AEEA 5FA4B 4LCCB 3DURB 1F6FB 1LHZA 2DQGH 2W1NA 3WN5B 2EDNA 3FL7A 1BAFL 1OAYH 4HK0A 4LVOC 3ZE0E 3MRKB 3BVNA 4ONHB 4IOIB 3U1SH 4P2RB 4X4XA 3SCMB 3DVGA 4WW2B 4MA7L 5TE4L 4HZLB 1OW0C 1S9WA 2XV6B 2FO1A 3OKYA 4J2XA 4X0KA 5DUMH 4U1IA 2VISB 1QLRA 3K2UL 2X7LA 2UYLB 4OT1H 5IVXB 1QP1A 3PDOA 5D1QB 4U1NA 1VPOL 2P8LA 2VLJD 1FCGA 1FYHB 5FYJE 3CFCL 5HHOB 4B7IA 4EIZC 1W72L 4MAYD 1MCQA 2YD7A 1JWMA 3OR6B 3S4SA 4HUVB 1N6VA 4OZGF 3T0EE 3NCMA 5SWSB 2APVA 4X9GA 4HFUL 5FO9A 4I9WE 4I1NB 5TFSH 5I8KH 4PJ7B 1QPPA 4RFNC 4KKCD 2IAMB 4H88H 1V7MH 1N6QL 3S7GA 3FRUA 3QIBC 3MRDA 4M1CD 3RTQD 1PZ5A 1KB5A 2BNQB 4HIEB 1MRCH 5E4EB 2CO6B 5I76A 5D5MF 1PG7W 1D5MA 1A3LH 3R06B 3DX7A 5I1HL 1A6UH 3AVEA 3I50H 4XC1L 4OTXH 2B1AL 5H37H 1IJ9A 4ODHL 1CTOA 1CXKA 4X5XA 4AT6B 4HIJA 1UM6L 1KGCE 1KN4L 4C4KO 2HJLA 1LILA 1QFUL 1ACYH 4YHIA 2EDYA 4LPVA 3EYQC 4C83A 4OJFH 3JWOC 4Z78A 2EECA 1QUNA 3O2DA 3QIUB 1I8LC 1K8IA 3DX8A 2YKLL 4L4VD 4CVWA 1FHGA 2BSED 4L9LC 3HKFA 4PGJA 3K74B 1H3WM 1KCUH 4WO4C 3MRRB 3U4BH 1CFSB 3DRTB 5GGVY 4FQ1H 1WF5A 2Q7YA 1IGJB 4P0DA 3WS3B 4M5YL 2F8VA 2CUMA 1UZ8A 3MRBB 3ZKNC 4BH8B 2NMSA 1DLFL 3BGFB 2BRRL 3ARQA 3IFPB 1QHOA 2F8XC 3MRLB 3FQWA 1T80A 2DMBA 2YA0A 5L2JB 1FRGL 4PRIA 5IEHA 1ZTXH 4X7FC 1U3HD 4P5TD 4JCMA 4RMSA 2W9DH 3WIFB 2DQEL 4Z7WB 5HYSA 3ROLA 1NUFA 1YJDH 4R8WH 1AY1L 1T66C 2X09A 3ZDYF 3MRFB 4NHUA 4YZFE 4BFBD 1MRFL 4YDLC 1HXMB 5E8OA 2PXYB 1C16A 4OGYH 4NQDE 3L3JA 43C9A 4KI5C 5JUEL 3TT1L 3QI9C 4CW1A 4JZJA 1FVEA 4RAUA 4J3TA 2ARJB 1PVHA 1I7TB 5DQJA 2V5MA 4HS3B 3SGEH 1QTYT 2VDOH 3EIFA 3EJJX 5A1AA 1UZ6F 1BJ1J 4XI5D 5I75B 1AI1H 1WICA 3JWOL 3NAAL 3CVHL 4R0LA 1RIUL 2GYSA 1GL4B 2C3VB 2HLAA 1DQJA 3QA3B 4OLWH 4TVPH 4HKJB 5BVJB 1YC8A 3MRNA 1P7HL 2JCCF 2XN9A 3GJFB 4LKCB 3RWJA 1L9NA 1G9MC 2VMFA 3TJHD 5J0BA 4YX2L 2XYCA 4RA3A 3C5ZD 4OI8A 4KZDL 5J6GA 3ILQD 5CJ5A 2AJXH 4MMZC 4XBPA 1WEJL 5IK3B 5B8CA 4C55A 1MCBA 3SDDA 1AQKH 2HA1A 2N7AA 3P0YH 5IKCB 4OF0A 3DWTA 4P2OD 4HJ0C 1UEMA 3PQYA 5FM5O 1G6VK 2V17H 1BD2B 4Q58C 3O41A 1BFOA 3VMPA 1HINH 4S1RH 3MUJA 4Y2DC 3QRGL 4JFYB 4XVTL 3CJJA 43CAA 3MV11 4DVBB 4Z7UE 4OD2A 3HZYB 4NN5C 2H6PA 4EN3A 1U2CA 5C0EA 1MI5E 4KV5F 1N0LA 1T1XA 3QWOB 3FB5A 1G7LB 1JNNL 2BVPB 4GKZA 5TF0A 3UJIL 1U8NA 1UXWA 2V9QA 4HWNA 2R0WH 3CK0H 1OF2A 3OPZH 4GG8A 1LGVA 1MHEA 3P4OA 1HH6B 1I1FB 4EDXB 1S7WB 3VXQB 2Z8RA 1G1CA 1U6AL 4URTB 5C08E 5E00B 1WAAF 4LOUD 3DSFL 3ZDXF 5KSAC 1P69B 5I1EL 1KTLA 4LCWA 3VXOB 3UPRB 1CDGA 3I3BA 3VRJB 3MGOA 4NQTA 4G6FD 5D1ZD 1EVTC 3TH4T 3D6GA 1WV7T 1AD0B 1GAFL 4YHNA 1ITCA 5JXED 1NBYA 1EZVY 1P6AB 1J1XL 2I9TB 1CT8A 1J11A 2XQBH 3FZUC 3U36A 4Z7VA 5A2IH 4Y5VB 3QIBA 3WUWG 1EV2E 4PJCB 5JW3L 4MDIB 2CIIA 4ISVA 1G9ML 1MJ8L 5EIQA 1A1MB 3RBGA 3SDYL 3IS0X 2X4QA 5IJVB 3LZFH 2J8UB 5TQ2H 5MENA 2VDNL 1I1AB 2IGFL 3S37L 1R6VA 1AGDA 5E9DE 2IH1A 4GUPA 4BQ6A 5DQDH 2AP2A 3CVHA 4H25A 4WEMB 3INUL 1IC5H 4LPYA 1RZKH 3PWJB 3NZ8A 1I8LA 4ZFGH 5EFIA 3FAWA 5CMAA 4OCSL 4ZODA 1RIVH 4I0PD 4QXGH 3RJQB 4L9LA 1I9JH 4KK9C 2Z92B 2V9RA 3KPRB 4BQ9A 3RKDD 2X42A 3V79C 4WO4A 2QSQA 2BHUA 5INDA 4ESKA 1BGXH 3GSWA 1OTUD 2VDLH 1RZ7H 3D39A 4L8CB 1D6VH 3O2WL 1IVLA 1NCBL 1FSKC 4DQOL 5FCSH 5F7WC 4JFQB 4D0CB 3BP7B 3QULB 1U36A 5DK0B 4DW2H 3LVEA 3MLTB 2OJEA 2F15A 3GI9H 4TQEH 3TYGL 3EDDA 2VQTA 3HCVA 4NNPH 4OLZL 1Q94A 1T1YB 2K7PA 5LAXB 5KTEL 1YNTA 2A6KA 2BNRA 2EDDA 1A7BA 1KIQA 4ZUVB 1FVDB 1JPST 1KXVC 1BLNB 32C2A 5D93B 3D48R 3MGTB 1DL7H 3OAUH 2VWEE 4Y4HB 5E2TL 2J8HA 2YUXA 4P4KB 1J05B 4PJXB 1R3LB 4X6CB 1CGYA 1JN6B 4K3GA 1W0WA 4ZUSB 5IFAL 4I13B 4R4FL 5FM4A 4MD5A 1AFVH 2VN7A 2JIXD 2XZAH 1R24A 2YN5A 1CD1B 2YEZB 2BP3A 5I16A 2H2PC 4DKFL 5CBEB 3W11D 2HTLC 4IDJL 3GSOA 4PJ5E 4KDTA 5F7UA 1LD9A 1F3DJ 2KZWA 1PY9A 4LASL 2GI7A 4XNYH 1EERB 5B38B 1F4XL 4KY1L 5CJBA 4U6VL 3OXSA 4JHAH 4XP5L 4E0RB 1T04B 1PKOA 2CRZA 1QRNB 2CIKA 4MVBC 2N4IA 3U0PA 2H41A 3ULVL 2Y07H 1LVEA 3BQUC 1CK0L 3MRPB 2YD3A 4ZXBD 1KN2H 1TVBB 3PWVB 1TNMA 1QPXA 5ALBL 2RGSA 2OJZH 3D9AH 4CU8A 1EHNA 4XWGL 3SKMA 1OAXL 2NZIA 4AH2B 2H26A 4HWEL 5BW7A 2IANB 4HUWA 1YEGL 3KPNA 4ZDHB 2R0LL 2QQNH 1A6TA 3IJSB 4Y5YC 2VLRD 2ADIA 4LEOB 1UKSA 4RGMB 3QDGB 1RAMA 2WANA 3E1F1 1UB5B 1IC4H 2IPKA 1B0GB 1Z2KA 4JRYD 3EOBB 1XGYL 2VZUA 4M6MH 3UTSB 4P2QB 4X5WA 1RJLB 5F6IB 4R7DA 3HUJE 4HBCH 3M1BB 1K4CB 2GUOA 4Y2DA 4ZPTA 1JPTL 3C08H 5ALCL 4LSTH 4M6OH 4KUCF 4X8JB 2ZUVA 2QLVB 1FL6B 1WWCA 5ISZD 3X3GH 1P7KB 5FEBA 4PJ9B 3QFJD 3BD3A 3T4YB 5L8JB 5MERA 2CH8A 4CVUA 1F4WH 5TH2B 4UI2A 4XXDA 5CP7A 3GFUA 35C8H 2P8MB 3EYOA 3IDYC 5I17B 3SDAD 4OF3A 1MIMH 4KXZI 2E7BA 5I8CA 3NMEA 1XFPA 2EO1A 4ZTOL 3DRQB 4PUBH 3VG9C 1U8IB 5EUOB 1EUUA 1PDKA 1DQQB 5FUOL 1RIHH 1CF8L 1JCKA 4M7JH 4PRHE 4LKXB 5E1AA 5BOPA 1FYTB 2PN5A 3FFDB 3IDXL 1K9TA 3GRWL 2XZCH 2R8SH 3GSNA 4HT1L 5GRXG 3OJMB 5D7SH 5DD1L 5D2NA 5FB8A 8FABB 5J12C 1MIEL 1Z3GL 3DYMA 3G6JB 2HFEB 3DIFA 3PABA 5C0AA 2EDQA 1TZIA 2BVOA 4OFKA 3VXUA 3KJ4B 3VWJA 3VI4E 5L9DH 3MBXH 1S5IH 1D9KC 5CZVL 3TO2A 1WFNA 4PJHF 5A3IC 1BF8A 5GJSH 3RI5K 2PO6C 1YEIH 3OKDA 1YUHB 4PJDB 2V2WA 2YD1A 3EOYG 1H3PH 1LNUA 3BD5A 5A2LH 2IBGA 4OZIA 3WO3B 1DP0A 1W0VB 1NFDF 2OK0H 1GGUA 2DQTH 3VGEA 4ZS6C 5KANG 3QCVL 1T1ZA 4HWZB 5GSVB 3MBEC 4JHWH 5D7KD 1KF9B 3O8XC 1K85A 2Q7NA 1I3UA 3MA9L 4ELMB 1B90A 4I0KA 3VW3L 4HK3J 4NKDA 5F3HA 4EUPH 1UWGL 4FMKA 4NQED 4HV8B 4RWYH 1OAZH 1SQ2N 2CDGB 1P84J 1RUQL 2BX5A 2R15A 3M07A 4L5FH 4X6DA 3HZVB 5KVFH 5FCUH 4XCEB 5DR5L 3T04D 1U8HB 3RWDA 4KJPC 1MFCL 3HC3H 1JTOA 1SYSB 4MJID 1WZ1H 3GBNH 3MXWL 2CKBH 1RZGB 2MOVA 1VFAB 1ZS8A 3ME0A 4P59L 4UB0H 5FV1L 3KPSE 1XF5B 3EJZC 4NWUH 4XNXL 4KKLC 3O4LD 2O5XH 4YEEA 5DTFA 3VI3F 1C7TA 5CILL 4QGYA 1FPTL 1CTNA 1VDGA 5F9AC 3VG0L 4EI5B 3FRPA 3ARFD 5CSBA 1BREA 4D8PA 1ORSA 2BY0A 5AG8A 2FBJH 3MOBH 4Z8FL 4PG9A 4GRMB 2CRYA 3VFTA 1L7IL 1C1EL 2X1QA 3LAFA 4TUKH 1YEJL 2MSPA 3MJ9A 1IEBA 2GHWB 2ZSVA 1GGIH 4PJDA 4RDQG 2GJJA 3GMNA 5KN5A 3DXAA 3LY6A 4MXVE 2BDNL 4XVSL 2VLKD 1H9VA 2FIKA 3RWFA 1WZMA 1QFWL 3IDIB 2GSGB 3EBAA 1QSFE 2FYYA 2QKIB 3GRWA 5IHZA 4JKPH 3NH7H 5JPNB 4ZQKB 4KKAC 4ELMA 4IEFB 3RDTB 4YDKH 4RMVA 3O3UN 1JIBA 4DOHB 3BQUA 3ES6B 3WO4C 4M1GH 1QVOB 4JQXC 5F70A 4YDJB 1JGUL 3F7QA 3V6OE 3VFUB 1EAPB 5HHXL 4UTBL 3S34H 3FB7A 1XR8B 4MAUL 3BKMH 1I9IL 5DO2D 1H8NA 4FTVD 4Z18A 3STZA 3GB7B 1CVSC 1FJ1A 4HWBA 3RL2B 1UADC 4UIKL 3DMMB 4Y5YA 4HQQL 1M6OA 2HRPH 4H5SA 4DZ8B 3VRLF 3LKRA 3FHQA 3MLUH 4DN4L 1DBBH 3VXPA 3TIDB 2UWEF 3RVVC 3WHXA 5J56B 4LRNL 4OUOA 4Y4FC 4DUVA 2ZG1A 3BIKA 4ZYKA 2I9LB 4TRPL 4KH2A 3FN3A 3RKPA 4ZFOL 5C9JB 4U3CA 4PJ8D 3QEUB 3SDXB 1DDHB 3S98A 3REWB 5DJAA 4BFEA 4ZUUA 2OL3H 1I7ZA 4CAGA 5KZCB 3IAPA 3Q48A 5INCB 2HTKC 5DYOB 4PJAA 1CR9L 3JV4B 3EJYD 3ZYJA 2HP4A 3GIVA 5SWQA 4ZNEE 2AXGB 1P4BH 4WNQA 4CVZA 3MYJA 4LNRA 5HYJD 5ACZA 2I07B 5DMGD 3T09A 2P46B 4GQPH 4XBEL 3O11A 1KJ2H 2YSSB 2IFGA 1NC2A 1T4KB 1NCAH 2WBWB 4PJFF 1P1ZA 1EGJL 1MLBA 5SWZA 2VLJB 3A6CH 5HGAB 2JJVA 3DO3A 5D8JL 3CGTA 4Q9RH 3EHBC 4J3XA 3DVIA 4MAYB 5BMFH 2NTFB 1XGQB 4HK3N 1G7JB 2XWTB 3C5SA 4BFIA 5B4MD 2HVKB 3EDFA 4I3RL 3X14B 1NCWH 1AP2A 3ZT7A 5TF1L 1YNKH 2K3TA 1S7QB 1YYMH 1RU9H 2ESVD 4PRPE 4Q2ZB 5DGRA 5DUPL 4X98A 4LF3A 3EFFB 1OAQH 3KPPA 3JWNC 3RTQB 1CXLA 2MKWA 3MJ8A 2Q3AA 3L3KB 1T66D 1IEAA 2Y23A 4MD4A 1LP9E 1AD9B 1D9KA 2C1OB 4HIXH 4JR9H 5HI5D 3CUPB 1CIUA 1FZOA 1CFNB 5DJYB 4OFIA 1Q0YH 4U6XA 1GPOH 2OXHA 1NGPL 3I02A 4MQXC 1S7TB 4X7DC 3AXLB 3KPOA 2MHAB 3QI9D 1BOGB 3TESA 5EU7E 2KQNA 1RK0B 1Z9SA 2D7PA 1OHQA 3MBEA 2FSEA 4JM2A 4EUPB 2V5YA 4RBPH 3WIIL 2VC2L 4UT9L 4HS8L 4L4VB 3VXNA 1KIPA 1CLYL 2OLDA 5DYOA 1CLZL 1XGPB 5H94B 2ICWA 1JK8B 1XCQA 3QZWB 5IIEB 3LSOA 3MODL 1LE5B 3OKOA 4LSQH 1TJHL 1MQKL 4UQ3B 5JR1L 2A38A 4PS4H 2CKBB 1EJOL 4ZO6A 3UYRH 1U8MB 5EBLA 4QHMB 3IJYB 3SGEI 1N5AB 2IBZX 4ZFOA 3A6BL 1T0MA 4HH9B 4CVXA 5CJXC 3VA6A 4N0UB 1J86A 1CQYA 3LN4A 1Q72H 3UEZA 1ZHKB 1QLEL 4XVUC 5DMYA 1BZ7B 3ESVF 2H32A 4LFHG 1D5XA 4G5ZH 5HHPB 5IFJB 3GSXA 4M00A 5E6YA 3EFFA 1U3HB 3LMJH 4P5TB 3NIFF 2E7LC 5DJ6B 1WFOA 4ONFH 3WIHH 4Q9BA 2ZOLA 5D5ME 1OGAD 2HAZA 1NUGA 3LQAC 3SY0A 3RAJL 1X6LA 5FA3A 2VDPL 1IE5A 2WBJA 3H7BA 1PYWB 3DBXA 4LVNB 1EGJA 4D9RD 4O2FA 2O5YL 2GKIA 2FATL 1SJHB 2XWJA 4YH6A 4O51B 5LCVH 4ORGA 3V4UL 4WFGE 1G0YR 5IW6A 5KSAD 3S96B 5HBBA 4QHKI 5B3JF 4MQ7A 2VITA 2FX9H 3OAYK 4KJYA 1T2QH 2AGJH 5E24E 4JFFA 2WUBH 3V0WH 2VLLA 3BZFA 4PYGA 3DYPA 2Z91A 3MV9D 5GJTL 4JQXA 4WI4A 5FO8B 3CFBA 2Z93B 5EN2B 3T65B 3QXDB 3P77B 5C07D 5C0NC 3C5ZB 1HE7A 1IGCL 3V0VA 1MLCA 2IG2L 4EDWL 3NZHL 4M48L 1YYLH 1YQVH 2PTUA 2QQLL 5FHBH 3HRPA 5C09D 3QIWA 4AEIH 3MJ7A 5GRUL 1A6ZB 4P2OB 4P3DA 2D03H 1KXQE 3UXFA 1JHTA 2OL3B 4NO3B 2QHLA 1E4KC 1CLOL 4LIQE 3GEWB 5CEYA 1IFHL 4JJ5A 1BFTA 4GKSA 4J4PC 1H15B 1G9NC 5C3LD 5ESVB 4NZUH 5IW1A 1LO2L 5DA4A 5BRZA 1CU4L 1KTRL 4N0YH 4PR5A 5E6ID 1BQLL 3VD3A 5JA8B 1DQML 1JRHH 2P5WE 1Q9LB 1UA6H 4M61B 4G6JH 4NO2B 3MQIA 2VQ1A 3IGAB 1KG0A 1QYGL 2YA1A 5MI0C 4OF5A 3QQ4A 1KJ2B 1XGTB 5EIVA 3BPCA 5HPMA 5DI8B 3UX9B 3LQAL 2J88H 2ZCHH 3B3IA 2GQHA 1ZLVK 4O51A 1X44A 2VXQH 1RMFH 1Y6MR 3S96A 2MTPA 1I1RA 4MSWA 3O6KH 2F58H 1SEQL 4K94H 4G6FB 3D85D 3I6KA 5D1ZB 3E6HA 1JGEA 4G8IB 5EZOH 3D18A 4JO1L 4OZ4B 3TYFB 2JCCE 5F3BA 1N64H 4WFED 3NBNA 1MELA 5HYQB 2Q86A 4NQVA 3G6DH 3SGJA 3GSRA 1F3JB 4F2MB 4K7PX 5TE6L 5IBTH 2Y5TB 5D2LB 4MA7H 1FL3B 1YEKL 5T5FL 5TE4H 3TO4C 2PW2B 3HRZB 4HGWB 1ZA6B 4OD3L 4D3CL 3U4EA 1MCDA 3KHQA 4NC1E 2NX5D 1IM3A 3K2UH 3UDWA 1MCFA 3IAQA 4EZMA 2QSTA 1VPOH 2HTLD 4Q7DA 3D0LA 4CDHA 3MLVL 4LLYB 1IAMA 3UO1H 1KIUA 4QRSB 2CRMA 3E2HB 1W72H 4MVBD 3L5HA 2FX7H 5JA9A 2WWMC 3HE7C 2WP3T 5IF0B 4JZNA 3V6ZA 2DLEA 3VH8B 2IQAB 2EDKA 4C57C 5E5UB 4I0PB 4KV5E 4KZEH 3OKEA 4PTUA 1G9NL 1VHPA 4DUWA 4HXBL 1IAIL 1DBAH 3WFHA 1PBYA 5IP4A 3MRQB 1I8IB 4YHYC 1CGTA 5L2KD 3DV4A 1N6QH 1ZXQA 1KCLA 4Z7VF 1NLDH 1FORH 2FECL 2ZNWA 4QRPA 3QCUL 1ZT4B 2DICA 3FMGL 5DHXB 5FGBC 5I1HH 3KWWB 4JFDE 1HDMA 4UILL 2DKUA 1WAAE 1GZPB 3ZDXE 4ODHH 1HXYB 3GI8H 5K59F 3BIBX 3CIQA 3MFFB 4OZFA 1UQSA 1QFUH 1M7IA 2VAJA 1I1CA 4KGLA 1KNOA 5CUSL 3ARPA 4MNQE 4HPYL 3O81A 5GZOD 4OQTA 5F1NB 5E08L 1C5CH 4RMUA 2NZ9D 4EOWL 1OP3K 5FXCH 1KV3A 4DKEL 3DUSA 4I2XE 5K9JL 3DI2B 4G8GE 4HIHB 3MV8E 4JY6B 1MCSA 3T2NL 1HQ4A 4XGZB 1AXIB 5A40E 2AJZA 1H8OA 2YBRA 5CWSA 1BP3B 3OSKA 3OWEA 1KELL 2GTZA 4M5YH 3UTTE 2SEBB 3KXFD 1MWAA 4YDVB 1Y0LA 2H9GB 3UTZA 4QYOA 4FFYH 5C7XH 5IG7A 3WEXB 1F90L 1R3KB 2W92A 4BKLA 2DQCL 4PGBB 1MFEH 2X4PB 4JFED 3HPJA 3BKJL 3CX5J 4HCRA 4HFWA 3QUYC 4WIQA 2PR4L 1X5JA 4ZXBB 3BGAA 3G08B 4HJGA 1FRGH 3RY6A 3S36X 5AYUL 2B5IB 4LCIH 1YMMA 3CFKA 4L4TA 2DQEH 1S7RA 4PJIB 1HHIB 5KVEH 1BQHA 2JLLA 3BN3B 1AY1H 5FF6B 5GISH 2R2HA 3VMNA 1MRFH 4JY4A 5A3ID 1GZPA 1A6AB 2VLRB 1KJ3L 2PO6D 5EO9A 1ZGLA 2DMKA 3V5HB 4HKZB 5JUEH 3TT1H 1MCWW 2X1OA 4K7FB 4ODTL 4JRYB 4JQVC 2R0ZL 5E5RB 4U6HB 2FNBA 1FZJB 1WCQA 4P46C 4JPKH 4UV7L 1MOEA 3HHRB 2DLFL 1DBMH 3TA3D 4CMHB 1RFDH 1TJGH 2FIRT 3VE0B 3O8XD 3VGFA 5E8DL 2NW3A 1I8KB 3JWOH 3B6SA 3NAAH 3CVHH 4PJEB 4FQ2L 1F00I 3EUUA 3L3DA 1A7PL 3TT3H 1NUNB 5ISZB 1AO7D 4QKXB 1S7VA 3QFJB 2G9HB 5TGBA 3EYSL 2NY0D 2GT9B 2R0KH 4AJ0A 2JIXA 2FZ3B 1U58A 3KHOA 5HXMA 4NKQB 4KZDH 1VKXA 1O0VA 4YDVA 4AL8L 3SDAB 5DRWA 5I1AA 4JANB 5AZ2H 1G7MA 5C0GA 1AJ7H 3BN9D 4NQCA 3NCYP 4EI6A 1J88A 1MQ8A 1R3HA 1I75A 5KS9A 4ETQA 3N1QC 5T1LD 4RSVA 5C0BE 3QEGL 4M5ZL 3PP4L 3TN0C 4P9HC 4PV8A 1OWWA 3EJZD 3DUUA 2R23A 4BH7B 3HC0B 1SEBB 2OI9C 4MJ5A 1BQUA 2R2EA 1R5WA 2V5TA 3T0EC 1T0PB 3UBXG 3N85L 2AK4D 2FJHA 2EXYC 3DROA 4YBLC 4PJXF 2HFTA 1RUAH 2EIZA 5I8OH 1JNNH 1RPQA 3LPGA 4ZTPL 3UJIH 1GOHA 1XR9A 2BCKB 4ZAKC 4BFGA 1D5ZA 2UZIL 3NFPA 5J1SC 3CZFB 2P47B 4D9QE 5HDQH 3KLHC 1FLRL 2AEPL 1U8OA 3TNNB 2BJML 1W72B 2OR8A 2V7HB 3ZKXC 1I1YB 3QDJA 5E4IA 3DSFH 2DQHL 4ZMAT 5LBSL 25C8L 4LQFH 3FTGA 3MNZB 3AMKA 1I7UB 4NNXB 4JO3H 4KKAD 4JGJA 3Q5YA 1AIFA 2BSTA 2PCPA 5HHQA 2H2SC 1XF3A 4X7TA 5JLZA 1ZVYA 2DI8A 5JTWA 4CNIA 1IZJA 2DL9A 5JXAH 3H3KA 3IETB 3NCEB 3F8UB 4XMKL 4Y19D 4Y5XA 1J1OH 3PHOB 1A9BA 5FK9A 4DVRL 5E8EA 3MXVL 4HDIA 5AZEL 1UCBL 5D1XC 4JANA 5JW3H 2NXYC 4R6UA 4NKMA 3UTPD 1G9MH 1MJ8H 1I7RB 1D6EA 3SDYH 1LO5A 2G5RA 5C92A 4MJIB 3RVVD 4OZIF 4QOKA 4W6XB 4Y4FD 5ICYB 1WIOA 1P4LA 4O4YL 5KSUB 3O4LB 2OQJA 5SX4I 5F6HI 4KAQL 3ULVF 2X1XR 4LVOB 2NY5C 5ILTH 4OGXL 2X05A 4P9HL 1YPZA 2J2ZA 3ARFB 2EIDA 4PRBA 3F7PC 5FYJL 3IU4L 5CD3A 4QCIA 5EOCJ 1NGXB 2HTKD 2LFGA 3WSQH 1V5JA 4PJHE 3BSZL 3T3MF 5MEQB 4YR6B 1DN2A 1LQSR 2NY4D 1HSBA 2YMXL 4NYLA 3FT3A 4GAFB 4J1UA 1UXSB 4X6DF 3NA9H 3VFSB 3SJVD 2VLKB 3IXTA 2YPKB 1QEWB 4HC1L 5E2JA 1JPSL 2DQDL 2X4UA 3RVWD 4OF8A 1LO3H 1QO3A 4F80A 4Z7NE 3TYGH 3ALPA 4WJ5A 4ACPA 3MUGA 4OLZH 1B3JA 5J9PB 3EHBD 4Q6IC 4Z77A 5JHLH 4YUEH 5KTEH 4G8EB 3QQ3A 4QF1A 4PJGA 1INDH 4L8BB 4NQEA 1DLHA 3QXAA 3T4AA 5K9QI 4GRWF 1QBML 5KSBE 2ZUXA 1RHHB 4FTVB 4RFNB 1QBLL 3HI5L 5E2TH 4U2YA 1BIHA 3D0VA 5ITBH 4EEEA 1HKLH 4TNWK 1RZ8B 2R1WB 3RUGB 3FO9A 4LLDB 4RRPG 1UJTA 3VXRE 4PJDF 5T3ZD 1J8HE 4M93C 3SKNB 5JHDD 2WIIB 4JKLA 4P23D 1Z9MA 4MQXD 1M1SA 4DKFH 4IDJH 3AM8C 4JQVA 5DVNA 1LEIB 4P46A 3DX9B 3VI3E 3HE6C 4GG6B 4PJ8B 4XP5H 3PDGA 1XZ0A 4V2BA 4OV5A 2D9QB 4ELMF 4JDTL 1N2RB 3RIFK 2NY5L 5HHMD 4F8TA 4MD0B 1PZUB 2F9BT 3ZHDA 4J12A 5E2UH 5BS0E 4X80H 4HWEH 1CGVA 2DOCA 3Q5OA 5TDOB 1YEGH 4F58H 3LEVL 5HYJB 2FEEL 4K23H 3VDBA 4M03A 5DZNA 5DEGA 1NFKA 3S8WA 1DFBL 5GGUA 3NPZB 4AY0A 1F97A 3U7WH 1WWAX 2BC4A 5GS0C 1GGCL 4S1QL 3FB8B 4UU9A 3WNLA 3B5TA 5EC2A 4XVUD 4M6NL 3BUYA 3G5ZB 2WIMA 3TBVB 2ZP0T 2ESVB 1JPTH 5DC0A 5ALCH 5FYKD 3T0EA 3WFEL 4JY5L 1KT2A 4ZUTA 4WCYH 1DE4A 4MJ4A 1XGRB 5DD0L 4XX1E 3H8NA 4PJAF 2UVFA 3BH9B 3Q2CA 2VH5L 1EHAA 5DD6A 4HC1A 3NPSB 5E1HB 4NM4L 5CAYB 1KCSL 4YDLB 3P9LB 5EUKA 2UWEE 1Q9KB 4EVNB 2DQIH 4M4PA 3SEPA 2YD4A 5I0ZA 3QI9B 3GSVA 5CP3A 1A3RL 2XKSA 5JOEA 1U95B 1F6AB 3DGGB 1L0XA 1J5OL 1LO0L 1WISA 3IFOB 4YHML 1F11A 1RJYB 2X4TB 3SOBH 1HH9A 4RNRA 1FDLL 3M45A 1RVFL 5GS1C 4LGPB 2L4OA 3HNSL 3GRWH 3FB6B 2G5BB 4GQ9L 1G9EA 2F19L 1XIWC 4YC2C 1NAML 2ICEB 1WC7B 3LS5L 2DTSA 4Y16D 2O61A 5F9OL 4ETYA 3CH1B 5K33A 4OM1L 4TUJB 4JZOA 3B9AA 2MFNA 4OCXH 3P4MB 2AW2A 3IF1B 3EFDL 5CZVH 1CDCA 4PJFE 3RVUC 1T6WA 1WWBX 2PYFA 4H8WC 5ID1A 1XCTA 2XRAL 1NCNA 1XH3B 5JW4Q 1QACA 4ELKA 2AEWA 4XH2B 1Z5LB 4TULH 4MQSB 4Y1AD 2RCSL 1E4JA 3RZWA 4PRAA 4QY8B 3SBWC 3ZKSD 1N8ZA 5GS0L 5HJ3A 1UVQA 4JM2F 4L8SC 1PKQB 2NY3D 4J4PD 3IB4A 2AV1A 3VW3H 2D0HA 1ORQA 3BHBB 3CDGA 4P2CG 4NN5B 2GJZB 3MMEB 3FT4A 1OGAB 3SE3C 1RUQH 2IPTL 3QDMD 2VWEC 2CUIA 2AJSL 2BHZA 1JNLL 4BSJA 5BJTB 2A83A 3BPOB 2AXFA 4WV1B 2XKNA 2A2QT 4EKXA 3BMWA 2FL5B 2J1KA 5KW9L 4YGAB 3EDJA 2Z31D 4KDVA 1IL1B 4LHQB 4NQDA 5KSAB 3MXWH 3QHTC 4P59H 5FKPA 4Q6IA 2CXKA 4XNXH 5DS8B 1MCCA 1A6VL 3TF7C 5E5MA 3MV9B 4S1SH 2VE6A 1JRHI 3EOAA 3PGDB 3L9RB 4YHPB 1MJJA 1W8OA 5CJQL 4V1DD 5GRVK 2GK0A 5CFHA 4Z8FH 1JF1A 1ZT7A 2IJ0C 5I1LA 5C07B 1ZGLP 5IW3A 2QR0A 3L5WA 3TO4D 1QD0A 3O6ML 3KPMB 3N1MC 4GAJL 4YEFA 3OG4B 1UYWL 2PTVA 1BX2B 1OAUL 4G9DA 4LLWA 4TUOB 5C09B 5AUMB 3DVNA 4XVSH 2ZPKL 3U0WL 5IB3B 4XP9L 1SJEA 3KYAA 4NUJB 3ULUD 5LQBL 4WHYG 1QFWH 4H8WL 4QT5A 4P5MA 4CU7A 1M7DB 1MCOL 2EDFA 1S7UB 3FO1A 3OB0K 3HE6A 4TSBL 4W6YB 2JELL 1OP5K 3HE7D 3NIFE 4P2RE 2BVQB 1K6QL 5E6IB 4GT7A 1OGAA 3GMQA 5DJ0B 3HG1D 4Z7UA 4Z7OF 1ZVHA 1NBZB 2IADA 1MI5A 3AAZB 4WV1A 3W0WD 2X40A 3NIGF 3RIAK 4PIRF 4OCWL 1B4RA 5IB4B 1QNZH 4GW1B 1EXUA 5F89A 3TH3T 3O6FD 4LRNH 3D85B 4N8VA 1VFBA 3O45B 4TRPH 5C08A 4B41A 3VWKC 4XPBH 3T77A 4E42B 5DQ9B 4ODSL 2P44B 4YHLL 4HUMB 4NSKA 2P1YA 4CN1A 1ES0A 2HN7A 5A2JH 2CDEA 4NN7C 1C08A 4XZUB 3QUXC 5IB2B 1P7QA 3PWLB 1L6XA 1MFNA 3JSSA 4R90H 3ZHLA 2NX5B 2Y4SA 1ZWIA 3DETD 3GMPB 3QQ9C 5EORL 3WL9B 3PV6A 4KJWD 4GXUN 4JDZB 1UWEH 2APTA 2UVEA 1IT9H 3BT2H 3BO8B 4LFHD 1EEZA 1SYVB 3A67L 5FM5M 5HGDB 3VFMB 1FFPB 4I0CC 3WCYA 5D8JH 1FL5A 2XG4A 5ICXB 1ZLSL 1NGZB 5GGTA 1MAKA 1R3JB 3K0WA 3QUYD 5E9DA 4OZHB 3ARTA 5E6IA 4L29B 4PGZA 2XWBB 3X12A 3VXSD 5DUPH 5E03A 1VCAA 4S2SA 5L2KB 4MZ3A 4AM0B 4K3DL 4WHCA 1NGQL 1JI2A 3ARBC 3OKLB 3PXHA 4IHOA 1CLCA 2MMXA 3PGFL 3HLAB 2J3SA 4NT6A 4UUJB 5C70A 4PP1D 4G43A 3I75B 3S6CA 1BFVL 2F54D 1TPXC 4H1LA 5LGHL 1GVIA 3PQYE 4GO6B 3RWCB 1IGTA 4AZ8A 3N9GL 4MJ6B 3SBWA 2X9XA 5JMRA 3WIIH 2YOCA 3UCRA 4L8SA 4HS8H 3C5JB 1KEMH 4BZ2L 2P43B 1JNHA 4Z7WE 1CLYH 2E7CA 1CLZH 1DEEB 5CINH 5ITFA 2H3NA 3NFNA 1N3NB 4YLQT 1LEKA 1C12A 1NC4D 5DRXA 3KDMA 4KWUA 3BKCL 5DZLA 3MODH 3TBYB 7FABH 1TJHH 4OBRA 1IARB 3KXFB 1FQ9C 1CE6A 3UZQA 5DVLA 9CGTA 3RI5F 1G7IB 1KENH 2Y7QA 3W82A 2OZ4H 3B2VL 3MGAA 5A16A 1JZ7A 2W60A 4JFEB 5EU3A 4LCWE 2VO5A 3U9PL 5DUBB 4OIBA 4DUXA 3TN0D 1T2JA 2D0FA 4PJ5A 3G6AB 1MVUA 4OCYL 4XWOD 3C60C 1ADQA 4DCQA 4YWGL 2UY7A 5K9OA 3ILPA 3TCLA 1ZANH 5HHVL 3V6OC 4Z7VE 3MNVA 1ZA3B 5DGQA 3GSUA 4LLQB 5MEPB 3ZLQC 1CQKA 2EC9U 5FKAA 4KTDL 4ZAKD 2PO6B 1NFIB 5HVHB 3VXMD 1QFWM 3VFVB 2XACC 5EC1B 1T03L 3JWDC 3TH2T 2ADJB 3U7YH 3L1OH 5T3ZH 1UB6A 1ZHBA 1BD2E 3MRIA 1KULA 1LE9A 3BP6B 2BMKB 2DBLL 5FGRA 1KCVL 3TA3B 4DTGL 3SKOB 1T89A 4Q97A 2DYPD 3P11H 4GBXC 1D5BB 3WUWB 1BVZA 1KGCD 3O8XB 3HUJA 2IPUK 4G8FA 1CD8A 3BUTA 1IAOA 5GJTH 5EH1A 2EKSB 1AO7B 4KJQC 1H5BC 3DHMA 4OD1H 4MX7B 4WFFE 2NNAB 2GAZA 2Y25A 2NY0B 2WWKO 1NSNL 2X6MA 3OKMB 4G9FD 2EYRA 2VUYA 3K81A 5D1XD 5H2BA 3EYUL 1IKFL 3RY5A 1G7HB 4FQIL 3QUZD 2HVJA 5DFVD 5GPRA 2IG2H 4GKNA 4I3SL 3MROA 4FQXC 1OARH 2QQLH 3DV6A 4I48B 3TWCH 2C1PB 2YWZA 2V7NB 1DVFC 5DUBA 1F02I 5T1LB 1YN7A 1AXSA 4XPAH 5GRUH 4GW4A 3CFDB 3KLAA 3BRGC 3STLB 1NLBH 2R4SL 4I18C 1AH1A 15C8L 4FABL 2VUOA 5DRNB 2BNRE 4LSUL 1IFHH 4L3ED 3MLXH 3KPLA 4PRHA 2XFXA 1NEZB 1CDHA 4UNTA 2MCPL 2FJGA 2L7UA 5LXGL 2AK4B 2ZNXA 1DQMH 1L9MA 5FYKH 2CO7B 4PJCE 3BZEA 2ZUQB 1P9MC 2B1HL 3FQNA 3JTTA 4YBQC 2Q8BL 2I60L 3MCG1 5IMKB 2AEQH 2GCYA 2FJFB 4L8DB 1QYGH 1T21B 4N1HB 5EBGA 1AQDA 2DKMA 4XHQA 5BQ7A 2QJDA 4PRDA 3LQAH 2J8UE 2C4FT 3KJ6L 1T1WA 2KDGA 4JRXD 4YGVB 1I3RA 1AGEA 1MHCA 2DTML 3JWDL 5I1DB 3BW9A 4JN1L 5KS9F 4POZC 4D94A 1SEQH 1KPRA 2F53D 1T22B 3TZVC 5EU7C 4GKOA 1S9XA 4JDVA 1A14H 1DUYA 2RQ8A 3HI6L 4Z6AT 1NDMA 4Y19B 4JVUA 2YD8A 4YXKL 4LEXH 5DXWA 2IQ9H 4YFEA 5GRVL 4F7CB 2RBLA 5JPMB 3DO7B 3MLZL 2R9HC 4WWKC 4FQLH 4D3CH 3BPLC 2P7TB 2CR3A 1RHFA 3OQ3B 5KVGH 4EBQL 1OOAA 3H6JA 3Q6GL 5C6TL 4PB9L 2VN4A 2NY7H 4Y4FB 1GOGA 3V4VH 5I71C 1N5YL 3MLVH 5HI3C 4LPXA 1IM9D 1RZJC 3N0PB 1F58H 4LHJB 4P57A 4MJ2A 1NEZA 3O0RH 1G1YA 4K3EL 1J0YA 1SBSL 4G6ML 3H0TA 3HMXL 4U6TA 5ENWB 1YMHA 4X9BA 1NMAL 3TEUA 4PJXE 1E27B 3CDFA 2AI0L 4UDTA 3WE6B 1IAIH 2ZCLL 2FJFA 5JQHC 1X7QB 3QFDA 1MCPL 2CGRL 2YPLD 4RAVB 5DJ8A 2VXUL 2NY4B 4HIIB 3ZO0A 3GBML 4X7SL 3FMGH 3P3YA 4WHDA 3SJVB 5ADOH 1O7SA 1S9KC 2H8PB 5DDHB 3V6FA 3G04A 5I15L 2WSKA 3GMMA 2VQUA 3E8UL 3T1FB 4CGTA 2AABH 1QSFA 4NJAL 3H9HB 4OLXL 1IAKB 1KEGL 4XXCA 5CUSH 3C60A 2YPVL 5D2NE 4MNGA 1MNUH 4YNYA 4DZBA 5CSGA 5E08H 1YPZF 4PY8J 3QG6A 4EOWH 4DGVL 2B7DT 2IANE 3DNKA 3VXUE 4X9IA 3MV01 3GSQA 1VFUA 4HKBA 3CZJA 3MRGB 3O6LL 1JMXA 3HZMB 3EZJB 3WXWL 4LSPL 3SPVB 3V7AE 2A6IA 5JHDB 5MEOB 3HS0A 5GGQL 5ICZA 4P23B 4RFEA 3P30L 5IQ9B 3DYOA 2R1XB 3OKKB 1F90H 4OQ1A 5H8DA 5T1DH 3S36L 3BKJH 4F9LC 2BOCB 5GIRB 1ZEAH 1CE1L 4ZPVA 3VFNA 1KYOK 3W9EA 1OB1B 2AJYL 2PR4H 4QRRD 1RZJL 4PJGF 4HLJA 1XIWD 3E3QE 3L7EA 2VZ3A 3WNKA 3BRDA 3KYNB 5HHMB 3L5JA 1S8DA 5AYUH 1H5BA 5DC4B 4ODXA 2ZG2A 3DECA 4RZCB 3T3ME 1CXIA 1Q9WA 4KVCL 3LRSA 3F5WA 1TZHB 2CLVB 1NCTA 3OX8A 2UY6A 4K3HA 4JKKA 1M4KA 4JG0H 1RD6A 5D71L 3AS1A 4ZNEA 1EEYB 2CJUL 1KJ3H 3RVUD 4QLRA 4DFIA 4QRTA 5EUOE 1E4WL 2VABB 1YDPA 3QJHA 1MPAH 4ODTH 1DVFA 2R0ZH 3JV5A 5CSZB 2ICWJ 3PWPA 4C59B 2VDML 4UV7H 2OBGA 5DF0A 1A8JH 3HMXA 2DLFH 4G42B 4JO2L 2Q6WA 4GRWE 3H3PL 5L8KB 3OAZK 1U91A 5CCKH 4WEBL 1U8PB 5E8DH 1NMCC 3FONA 5DWUL 4FQ2H 1A7PH 2DLGA 1UT9A 5C0RL 4WU5B 4LCUA 4NWTL 2EKJA 5C0DB 3KS0H 4PFEA 1IQDA 4PRPA 5B21A 3SPVA 3RWHB 2HT3C 2CDFB 3FOLB 1OLLA 4PJDE 3WNMA 1RK1B 4YAQA 1QSED 5EZLA 1YEDA 1BQSA 4AL8H 1U42A 1M71A 4NC1C 1V3MA 1LP9A 1TITA 4BSVA 3LKQB 2HRLA 4PTTB 4OM0H 6FABH 1QOKA 1HHGA 4LDEB 2NW2B 5L7XL 4FG6C 4ZSOB 3K8KA 4F7EA 3QEGH 5I6XB 3VFOA 4M5ZH 3TNMB 4PGDB 4M62H 2IALB 4LDLB 4WFHE 3TZVA 1QSZA 3O3BA 3O3DB 4ELME 5B39G 5I74C 1AGCB 4NKIL 1FAIL 1KJMB 2W9EL 3HNTL 3R0MA 1MAJA 5T3XE 5DFTA 4WI2A 1CFTA 4Y16B 2DI9A 3N85H 5GGRA 1VGEL 4LIQL 4WU7B 5IJKC 4HSQA 4RA0C 4A6YL 2J6EA 5LG1A 4JFHE 1BBJB 3FQXB 1LDPL 4PLJC 2A1WL 4ZTPH 3RUGF 1GXEA 4GMSL 3CX5K 3OJDB 3IYLW 1OPGL 1A2YA 1FLRH 1EFXD 1WLHA 3VFGL 2BJMH 1IQWH 4Y1AB 1DANU 2DQHH 2GJ6D 4NM8L 3RWIB 5DHVA 3WKML 25C8H 2AERT 3DJ9A 3CMOL 4U1MB 1KLGB 4JN2A 1P2CB 2NY3B 2FHCA 3SKJH 3OAYH 1CGWA 1IAIM 2EIEA 3ZTNH 4ZG1A 5FOBA 5TDPA 4OLUH 4DAGL 4J6RL 4Z0BL 4Y0GA 4X6BA 2LQRA