8FABB

Crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
214
Chain Sequence
b'AVKLVQAGGGVVQPGRSLRLSCIASGFTFSNYGMHWVRQAPGKGLEWVAVIWYNGSRTYYGDSVKGRFTISRDNSKRTLYMQMNSLRTEDTAVYYCARDPDILTAFSFDYWGQGVLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-LAMBDA HIL FAB (LIGHT CHAIN)
publication title Three-dimensional structure of murine anti-p-azophenylarsonate Fab 36-71. 1. X-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 47
structure length 214
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB01
4J6RL 5K9QG 1T7WA 5IW6A 3L95B 1JP5A 4IOSD 2J8UE 4UV7H 3I84A 4CRPA 2AJUH 1I9JL 1JWSA 1IMHC 3HC3L 4B7IA 1BFSA 4F7EA 4NQEB 1D5ZA 1LEIB 4F8TA 4K2UL 2FB4H 3U46A 5C0GB 2HG5B 3B2VL 2NY3D 3MRMB 4S1RL 1MFAL 3QRGL 1MUJB 2IQAA 4UB0L 1CU4H 3PHSA 3DURB 2W60A 4JY5H 1T3FA 1JMXA 2QQQA 1XEDA 1RMFH 1NC2D 2KH2B 4NP4L 1BBDL 5LWYL 1IAIM 3GIZH 2VQUA 1KIPB 3U4EB 1AI1L 1YEGH 5L8KB 1MPAL 2WUCH 3WHXA 5BRZE 1KJ2L 1RZFH 1VADB 4MNQB 4Y19D 1DQTA 4MDJB 2HTKD 1R5IA 4Y1AE 1QEWB 4X7SH 4IRSA 4PJHB 5F71A 3DECA 1TVBB 1V7NH 3UO1H 1MLCB 1AIFB 3QHZL 3QQ3A 5LCVL 2DQGH 4I0PA 1NAML 3O4LD 5FYLL 5EA0H 1F4XL 4IBLT 2OZ4A 5D7SH 4JRYE 2NY6C 1YY9D 2WBKA 4GXUM 2DJUA 5IIEB 3FT2A 2Z8RA 2G9HB 3S7GA 4MA3B 3WNMA 1GGBL 2OL3H 1CFBA 1T83C 2X4SA 1EIBA 4C55A 2OS7A 4JQIH 5HHQB 3TN0A 3RWCB 1EUUA 4O2FA 4LAQH 3NN8A 5MEPA 4XHQA 4TPRL 4G43B 3SKNA 5I8KH 5DTFB 4X98B 5D5MF 1XGQA 3ARYA 5LXGL 1DQLH 4CVUA 3S4SB 1RHHA 3V5KB 1MWAB 1AJ7L 1T1WB 5K9OA 3T65A 4ZNEA 4AK1A 3VXRA 3GUTB 2MOVA 3PNWA 3RVXC 3H0TB 3QDGB 4XBEH 4LLUB 3UXFA 5E2UL 2VXUH 1G6RA 1HHGA 4H88H 2XZQH 3WCYA 4RZCA 4KI5E 4I3GA 3DSNA 3QIWB 2QADC 3GHBL 3MJ8A 3TVMC 4YK4C 3P0YH 4JRWA 4XVJL 1U92A 2GCYB 4L4TA 4JM2C 1CXEA 4NO3A 3X3FL 5CS7A 1DCLA 5BMFL 1QR4A 4XNXH 4RCAA 4CVXA 1V7ML 5LGHL 3CFDA 4MAYD 1F58H 1V3KA 4Z95L 5AD0A 5IP4A 3TIDB 1WAAF 3FO0H 1MFCH 3UTTE 2FO4B 3R0MA 5DSCB 3NCYS 1QBBA 4HJGA 2OZ4L 2JJSC 1UWEH 3PL6C 4MD4A 2XICA 4CW1A 3EFDL 3BEWB 4X4YB 2VIRB 4CUCA 1B90A 3VFWA 1LO0H 4XMKH 3NIGF 3HS0B 1LNUA 1SBBA 2OM5A 1HSAA 1WLHA 1A5FL 3ARRA 5EBMB 2FDBP 1MJUH 5C0EA 4NGHL 3FHAA 1KCSH 2UZYB 4XRCA 4C83A 1RZKC 4Y4KC 5I2IB 1K4DA 5IT2L 1G0YR 1ZLWK 4OLYL 3AU1B 4H8WH 3DRTA 2FSEB 1RJYA 1IEBA 2WQ8A 3BE1L 4OKDA 1QPXA 3JWOL 1G7IA 1G6RL 1GIGL 1FVDB 3B43A 1LO3H 2CMRH 1MREL 4Z7VB 1KT2A 2J4WL 3GSUA 3VD9A 1DEEB 2DIBA 4JREC 2WWMC 2R8SH 1A9EB 1WJ3A 4BZ1L 1KSRA 4LASL 4X5XA 1HKLL 2F19H 1U91B 2P8LA 5K9KB 43C9B 4BSWA 1V5JA 3OWEA 3HUJF 1T83A 3WFDH 2AV1B 4ENEC 2XYCA 4JRXD 3CH8A 1NGXB 1M7XA 4J3OC 3VJ6A 4QOKE 3MRNB 2R2HB 4U6XA 5C07E 2EECA 1ZVYA 3GMLA 5GRUL 4K9EH 4J3VA 4YHML 4AIXA 4AIOA 1AE6H 4HBQA 4PJDA 3UTSD 2R9HD 1TCRB 4P9MH 4OZIA 3KR3L 4I2XA 4OM1H 3VGEA 1H3PL 3BDYH 4QXUH 2H9GA 1IGYB 5JNYB 5KVDH 1U8QA 2ATPB 2I5YL 3C5ZC 2C3WA 2NY0B 2ZUSA 3OF6A 1YN7A 1X5HA 5FHAL 4NNYB 4U2ZA 4MXVE 3X14A 2HLAB 5L2KB 1T22A 4YHOL 4JM2A 5F7KC 2WBJD 1FO0A 2W9LA 3DGGA 1DSFH 3SKJL 1X44A 1Z0MA 5L9DH 3N85L 4MMXC 5EN2B 3N1FC 2Z93B 4W4OC 4BQBA 1XCTA 4OZHF 3E2HC 2YKLL 1QRNE 1UCBH 4ZQKA 1GC1H 1G7PB 3Q1SH 4Z7UB 2JJSA 3T09A 2DBLH 3I2CH 1CGUA 4PB0L 1B4JH 1ADQA 3QUXB 4P2RE 2CKBB 2P44B 4P5TC 4YXKL 1A6UL 4JKWA 4N0FB 1LEKA 1CFQA 4FZEH 2W92A 4OZFH 2ADGA 4K55A 5IQ9B 4TUKH 1QFWH 3LPFA 4NBZB 2BY1A 3H7BB 3P4OB 4X7FC 3X12B 1I3RA 2AI0L 4PLKD 4NYLB 5C9JA 4PJGF 2F5BH 4L3EA 5JPMA 1CGSL 5J1TC 3GMOB 4YR6A 1J05B 3DYMA 1JGUL 5DRWB 4OZGE 1NMBH 1XGYL 1NKOA 3IDXH 5KANG 5D7JC 1FYTA 4APQD 2OLDA 2Y23A 3BISA 4PJ7B 5KJRH 4K7FA 3ARPA 4HUVA 4LCYB 1ZLUH 4NN6B 1XGRB 3BJLA 3DBXB 5K9QI 3N06B 1CT8B 1FO0L 5EDXA 4M5ZL 2VDPL 4GRWE 5E8NB 4NPYA 3I50L 5CUSH 4PJCF 2VR5A 1Y0LB 2EDTA 5FOBB 4WFGE 2CQVA 3SDDB 1H15A 5F9JA 2MSPA 1NCNA 3S35X 4UQ3A 2CRMA 4IIQB 5MEOB 1ADQL 1MFBH 4NO0B 2DYPA 5E9DB 5DD3L 4O2EB 3WKMH 4XXDB 3EJJX 3HN3A 4K3DH 2YRZA 2FJHB 1YQVL 1EX0A 2HKFH 32C2A 3JV4A 2WP3T 4GXVH 3VWJA 5HYJD 5D93C 2EEBA 4QY8A 3OAYK 1YN6A 4XVTL 4B7LA 5D1QC 3RKDD 1OSPH 4XNMB 1TFHA 4WCYH 4BFIA 5IQ7L 2EDXA 1X5XA 2YZ1A 3C5ZA 1Z2KA 2VDML 3MRDB 1RZKL 5CAYB 3PP3H 4K07A 5F7YC 5ESQB 3MGTA 1ES0B 2AJ3A 4PY7B 4ZFFA 3FTGB 3STZB 2RQ8A 2E27H 5J8OA 2PCPA 2EKSB 2VN7A 4D9QE 4Y5XB 4ONGH 3WNOA 3RPKA 2Z31C 5J1AB 4E41D 3GSOB 2VQ1A 4L4VD 3D3VB 5JXAL 4O58H 2NXZD 1I3GL 3C8DA 1WTGT 3DTXB 1A8JH 3FN3A 2Z9TA 3R06A 3QXUA 5TF1H 1T1YA 3CVHL 4HWZA 1BJMA 3OKKA 3FQTB 1WZ1L 5TE7L 2RB8A 1S78C 3MBEC 4QCIB 1I7RA 4CMHB 2HT3D 1HSBA 2CIIB 4OKVB 3BPOB 1EFQA 5FKAA 1VESA 4P5TA 2XY2A 3AB0C 4ZD3L 5IVXA 2XXMB 1G7MA 4H25A 4R8WL 4HIIB 4MQ7B 1C12A 1ZEAH 4PJIB 2DKMA 1EFXB 1TCMA 2YN5A 5B21A 1ZLVH 3DXAA 3GMPA 5EBLB 4X4ME 5L8LB 3MLTA 5EZJA 4MCZA 3MA7B 4Z0BL 3IETA 4QHLA 3RL2A 5TQ2H 4CKVX 2HT4C 3LRSA 3TGXA 2A6JB 2NY4B 4HUMB 4K3EH 1XIWC 4JDVB 3FO1B 4LPUA 3NCCB 1PG7L 3HZVA 5D7JA 4DQOL 2FJGB 5BW7C 4CGTA 5I15H 3VCLB 3B2UC 2PO6D 1YEFL 2FX8L 4XPHL 3WIIL 2NR6C 1RSFA 2AJYL 2YD5A 1KTLB 1GRWA 3FFDA 2ZOLB 1WWAX 3F58H 4YHIB 1G9EA 3F7RA 1GHFH 5DWUH 1GZPA 1ZK9A 3TBWB 1LO4L 2IBZX 3HC4H 4N5UA 3HC0B 3N1MC 2R1YA 2IMNA 3JV6A 2X7LB 3EO9H 5EIIA 5GGSB 4FN0A 3U30C 5GS0D 3U4BH 3HE6C 1AQKL 2FHBA 1DVFD 1KIQB 5KW9H 5CJXC 1M4KA 1WBXA 1A9BA 3CLEL 5GRJL 5IVZB 4U1SB 5L2JA 4D9RD 3RWDA 3SDYL 4DUWA 4ELKB 2YPKB 5D1QA 5ICYA 1IGTB 3FONB 1FDLL 1U8IA 4EQ3A 4MXWL 5IHUH 4YLQT 1EEZB 4AEIL 3OKOA 1UZ8A 5IKCA 3KPRB 5C0ND 5IB1B 2DQFB 4UTBL 4D0CA 2C7UB 3BSZH 3P77B 1KB5A 4LLQA 2NY5C 2YPLD 3CK0H 1IAII 3WKNA 1D5MB 1CGVA 4OCNC 1E4XL 4CNIB 3ZDXF 1WFNA 3VXQB 1CFVL 1CD8A 1I4FA 3MV8D 2ZUTA 2DI7A 4IMKA 4PJAB 3IT8D 5F9OL 1T04B 2E7BA 2K1MA 5HYJE 3MBEA 1QSFD 4JFEA 4MXQC 4BH8A 1G7QA 2I24N 4WEUD 3NPSC 3D0VB 2X2YA 4QRRB 2FWOA 1Z5LB 4PGJA 1WEJL 1ZMYA 1MI5B 5TQ0L 5DK3A 3SOBH 4GQ9H 1A6ZB 5DEGB 5DJ8B 2ICWI 5GJSH 5JR1L 4YXLL 1K8IB 5EU6D 5F7FA 5I30L 5GS3A 5M7QA 5GS0H 1IKFL 5DF0A 1G7HA 3HA0A 2ERJC 1JGVL 4YHLH 2RGSA 1U8NA 2B4CL 3T1WA 3B8SA 3QO0B 8FABB 3CFCH 2YD3A 2BJML 2JELH 4HKXA 5DRXB 1TXKA 4FQLH 3ZMRA 1XIWA 3LIZL 5DHVA 4LCUB 3QI9C 5GSRA 4U6VL 4N8CH 2Q6WA 3NMEA 3VXPB 1JRHL 3F7YA 4X0KA 2G5BA 4QYOB 1MCSA 1E27B 4RNRA 4O2CB 1OAQH 1UC6A 3BYTA 5IBTH 5BV7H 4UQ2B 4DN4L 4Z8FH 1KB5L 1GXEA 4LNVA 2I9LA 4RGNB 5HHOD 4HS3A 4TRPL 4QNPF 4ZUUA 1G0XA 5JOPD 1C16A 5MP6L 5D1XC 1QZ1A 4WUUB 3DYPA 1ZLSH 1RV6X 4HULB 3S3PA 2VXQL 3HKFA 3D0LA 1ZANL 2GTWA 1FFPB 3VFOA 2C26A 2VL4A 1BF8A 5CGYD 2BDNL 2ZNWA 3NZ8A 3O4OC 4AEEA 4HIJB 1A6AA 1W0WB 3HE6A 4NQDA 2GJ6D 5T3XD 3E6HB 4GG8A 1YUHB 4D94A 1CGWA 3P0GB 3KPNA 2P43B 1TJGL 4EUPH 1QSEB 3L3DB 1WZMA 1QBML 4U1HB 5T3ZD 5J11C 2DLTA 1A3RL 5EU3A 4JZNB 4ONHA 4PBXA 4X99A 3WE6A 5DMIL 1VHPA 3HTLX 4UIKH 3T08A 3O8XB 4D0BA 3QUYC 5KSAB 1EO8L 1A14H 1U8HB 5I16A 5KANI 1AHWB 1RZGA 2V7HB 1KEGH 3BQUB 3C09B 4Q6IA 4PG9B 3J8F7 3MSPA 2P46B 1FNEB 3FT4B 1CDYA 5FA4A 3TFKD 4L8SB 2YMXL 1X5AA 3HZKB 1T0MB 1MCRA 8CGTA 3SJVA 3GGWB 1MF2L 1MY7A 4PRNB 3Q6FA 5E56A 4ONFH 4XWGL 3FQRA 5C0AA 2CDEA 4RWHA 3M1BB 2F53E 4MHHG 1CICC 4LSSH 3RFZC 4D9RE 2E5EA 4JO4L 1U8KB 1R0AH 3PP4H 4UT9L 3KJ6H 3QEQD 1NBZB 3K3QA 3VXUD 2VDNL 1N4XH 2H26B 4LGPB 4NQCD 3IU3B 4GQPH 4ODSH 4KI5C 4MB5A 5J12C 1QBLH 4GAJL 4UNTA 1MCOL 3AVEA 1ACZA 4WO4B 2QJDA 2FH6A 5E6ID 5T3ZH 2IAND 4FQ2L 4RFNB 4PGBB 1BZ7B 4J3SA 5DQJB 4QTHA 1OB1A 3BEVA 2WBWB 3BN3B 3QI9A 1PZ5B 5FYKL 2QHLA 2WM0A 4XZUA 3QIBB 1II4E 4Z7WA 1KB9K 4YBLC 5IEHA 1HN1A 4UI2A 4V2CB 1MQKH 4XPGH 3SGJC 2Y4SA 3CSYA 3BKML 1WWCA 5HGAA 4F33A 3OKMA 4MVBC 1FH5H 1U41A 4PBVC 4PRHE 2NY5L 3QWOB 4L9LC 4OZ4A 5IBUB 2DMBA 5ISZA 4L8BB 5D1XA 1P4LB 3GSRA 4JGUA 5FA3B 2Z92B 5D7LD 4X83A 1U36A 4PGEA 5EUOB 5I71C 2A9NH 5HJ3A 5TH2A 3W9DA 5AYQA 3K2UL 2P5WD 3KGRA 1M05B 2W0KA 1D6EB 1N59A 4IHOB 1R3JA 1MCNA 1J0HA 4QO1A 5DEFB 4LQFL 5ERWB 4JG1H 1WWWX 3SDCB 2MHAA 5K9JL 4UINH 1NDMA 1QBAA 5GS2D 1N6QH 1RUAH 4NQEE 1FORL 1IQWL 5IM7A 4G8GB 2APFA 2FX7L 5CSGA 4IOFD 3RJDA 2Q7YA 5J89A 3HI1B 3NIDE 4MS8D 3FCTA 2OR7A 5FGSA 4PJXF 5FYJD 1JHTB 5KZCB 4WU5B 4JVPA 5ANME 2HA1A 2D4FA 2XTJD 4IS6B 5DQDH 3DX6B 1UEYA 4AENB 2E6JA 3GMNA 5FO8A 4NT6A 4OZIF 1Q9WB 3BN9D 1OQOA 1X7QA 2NY3C 4KMLB 1JGLL 5CZXC 5CEYB 2NW2A 5IMOA 5IHZB 4MNQE 1NFIB 3HG1D 3RWEB 2JB5H 4RAUB 1A1MA 5C0CB 1PKQA 2OQJA 3CGTA 3IS1X 5T3XE 2WUBH 1JGEB 3SE9H 4JFOA 3WL9B 4PYHA 4NQSB 3P73A 5B8CB 3O11A 3CU1A 4JM2F 2DBJA 2F5AH 1R3IL 1AGEA 5FO7B 1P9MA 2HTKC 4WTXA 1HEZA 2JIXA 4Y16B 2VR9A 1MH5B 1U8PA 4KJYB 4P5KA 4XPFL 1GZQA 2VLRA 4K8RC 5C0DA 3ARVA 1ORSB 1CTOA 2X5PA 1YY9C 5EPMB 3PGDB 5GS2H 2EDWA 4K71B 3U0WH 1MRCH 3MNVA 2R1XA 1ONQA 3GSVB 3BGFC 3PHQB 1G1YA 3MOAH 4G3YH 4S10A 4FQHB 2XOTA 2JJTC 1OAUL 3EYVA 3CPLB 4JKKA 4E5XB 4PS4H 4NCC2 5FYJH 2F8VA 1S5HB 2VABA 2XWTA 1LILA 3MR9B 1KENH 2RAMA 4QXGH 1OP3K 2CRIA 3QEUB 3RZCB 3IFPA 3VFTA 4HF5H 4NKOA 3VXNA 3F7PC 2DQHH 4I3RL 5EULV 1FL3A 1HI6A 4WFEE 5ACZB 4LKCA 4PJ5A 1JI2A 4Y2DD 5L88L 2EXWD 2ZSVA 5EOQH 5JIHA 4L9LA 3MROA 3HCVA 1LDPH 1RZIA 1EEUA 2D9CA 3MXWH 4NQCE 3L5WA 5HDBF 5DRNB 1KC5H 2OJZL 3EDEA 4LEXL 4JFDA 4QHNB 5DUBB 1A4JA 1FZOA 1F42A 2H8PB 1CFTB 2X4TA 4WRLA 2HRPH 1NH6A 4RGMB 1U95A 2IANE 3LN4A 3VRIA 2WMPA 4ZMAT 3ARFC 2ED8A 5DJ0B 5C0IB 3H9HA 5JO5A 4NKMB 3T0XA 1UXSB 3LKRB 3I75B 2OL3A 4UV7L 1T5WA 4OD3H 4PJ8D 5DJAA 4URTB 5CHNA 4K9EC 4AY0A 5I18H 4XNYL 3WO4B 1K9TA 3CMOL 5FF6A 1GOGA 3ULVH 3JTTB 4ISVA 5ICZB 1CU4L 1JWUB 3W5MA 2AXGB 3V0VA 2PF6A 3VRLE 3WFEH 1Z9OA 1NC2A 3C5JB 4WI5A 1RUMH 4FQQB 3A6CH 1G9MH 4TUOA 5C2BH 2WUCL 4RMUA 1RZFL 6FABH 3G6JA 4LU5H 4LARH 5T1LB 2AXFA 1PY9A 2HFTA 1TITA 1FAIH 4N1HB 3O45A 4FZ8H 2AEPL 2APWA 5EC2A 5IESL 2UY7A 3QUKB 3MRPA 3T3ME 1P2CB 3RY6C 5CBEB 3UO1L 1F13A 5I17A 4I8DA 4LRIA 1N5YH 1B0GB 5GS1B 1OQXA 1NUNB 3WFHB 4OCXH 4ZPTB 1R5WB 2DQGL 3MV7D 5EA0L 3O4LA 3FOMA 4JM4H 5FKPB 1WCBB 1FC1A 4QTIH 5D7SL 4RISH 2ZCKH 3U0TA 1ULVA 5IVXF 4J2XA 2JB6B 3MRJA 5D9SA 3E3QE 1H8NA 25C8H 4P59H 3T4YA 1HILB 4LPXA 4OV5A 2JJTA 4ZFZB 4PRAB 4JQIL 2QSTA 2E7MA 3IJYA 4JJ5B 5FUZL 5BZWB 5J13B 1PQZA 1Z9SA 1NGQH 2IWGA 1MVUB 4LAQL 2EC9T 4YPGA 1YMMD 4E0RA 4L8CB 1H9VA 5I8KL 1OAKL 1S5IH 2OBGA 1DQLL 2PTTA 2YEZB 3SKOA 1AQDB 2R9HC 4NQTA 4O02L 3RVTD 4M61B 1S9WA 5BZDA 3DVNB 5JUEL 3KXFD 1QLRB 1BVLA 3QH3B 5L2KE 4P57A 4XBEL 4DW2H 4HMDA 2HRLA 3U9PL 1A7RL 4F7MA 2VXUL 1C8PA 4H88L 4BK5A 2XZQL 4KVCH 4NC1C 3LN5B 3EBAA 5I73B 5D2NE 3QDJD 4KJQC 2VDLL 1R6VA 3P0YL 1ACYL 4NUGH 1DDHA 2BOCA 1ZSDA 4Z7UE 4CBPA 1A4KB 1IEAB 2Q20A 2WBJC 2X4RB 4OFDA 4XAKE 1Y6KR 4NFCA 1J11A 2NPLX 2WWKO 4N8PA 1BEYL 4NQVB 4BQ6A 4FXLA 5IG7B 4P99A 2FCBA 4POZC 1RZ7L 3S98A 1F58L 4MAYA 1EO5A 3TA3D 1MFCL 5J6HA 1VB9A 2NYYD 1YY8A 1H3XA 5DC0A 3TO4D 4L5FH 1M6OB 3RUGB 1LEGA 5JXED 2DQDH 1FFNB 5F3BA 5E1AB 2L0DA 1GGYA 4YH6A 3BHBA 4XMKL 2Z8VC 5DMYA 4QLRA 2MMXA 5KS9F 2W0FA 3DUSB 4PJFA 4FMKA 1TTFA 5F7NC 4HZAA 1VKXA 4V1DA 1JN6B 3WIHH 5IB3B 2OTUA 1KCSL 2EC8A 4PLKC 2SEBA 4PY8I 4KKAD 3ROOA 1A1OA 4HUKB 4HPYL 4ZFOA 4BZYA 4PJ9B 1NCUA 1J8HE 4KDVA 5GIRB 2MTPA 1I8KB 5C0FA 1GH7A 4RFOH 5FK9A 4F15B 3P4NB 5I1KH 1I7ZB 1ZA6A 1CE6A 3VFGH 1JE6A 4APQC 1JPFA 1XGUB 1U8MB 2V17H 4M6MH 4PRID 3TPUA 3VMPA 3RWJA 1A7QH 4HZLA 3LMJH 2CMRL 4EIGB 2W65B 3SGEI 1EEYB 2R8SL 1H3UA 1ZHLB 3BD3A 2QEJA 4PIRF 5CSBA 4LPCA 2F19L 1MCWM 3Q5YA 5E9DE 2FBOJ 1NMCC 2BNQB 4U7MA 1P5VA 4HUWA 4OZFA 3MRRB 2Y5EA 3WFDL 1OF2A 4DUVA 5DJDB 2ZG1A 4JRXA 2BSRB 2EE6A 4CN1A 1MJJB 4LSQL 4WI7A 2EKJA 5CEZD 2EICA 2XWJA 4K9EL 2A0LD 5B3NA 1AO7D 3MUY1 3U7YL 1AE6L 5DGRA 1YDPB 3UTSA 5HHXH 4P9ML 5TPWL 1QA9A 1QLFA 3TNMA 4RGOH 4OM1L 5HHVL 2DQTL 3BDYL 2V2XA 4PRPD 1UFUA 4HV8A 5KVDL 4M6OH 1YEKH 2PN5A 2X4UB 1CVRA 1PBYA 3D3VE 4WVRA 4Z0XA 1BJ8A 3PWVB 1S7WB 4E42B 3GM0A 4ZFOL 2CXKA 3MMEB 4KV5F 5HHPA 3FB7B 4QRUB 3GDBA 2ZKHL 5BVPL 3QRFM 4UTAH 2WBJA 3NPZB 2HKHH 4NOBA 1DSFL 3L3IA 4WI9A 1ZOXA 5H2BB 2LAAA 4HGWA 5T5FH 5L9DL 4PJGB 3WFBH 1OGAB 4P2OD 1UCBL 2ICEB 4ODVH 4EKXA 1GC1L 1LGVA 3Q1SL 3RL1B 4PJIE 5HYEA 2N7BA 3GMRB 3T0AA 2DBLL 1B4JL 2O26U 3D39B 2HT3C 1WC7A 1MNUL 3ALWA 2DOCA 3B8YA 3WD5H 4FZEL 1QTYT 5KVMC 2YS4A 1MHCB 4EVNA 3TJHD 5E8PB 4CU6A 2ZNXA 3QDJE 4HK0B 1QFWL 2DS4A 3O3AA 3S3SA 4YO0A 2R1WA 3WSQL 4PBWD 4KGJA 2NCMA 4ERSH 4X6DB 4HUXA 1ZA3B 4MSWA 3AGVA 2OR8A 1NMBL 3M8OH 1A6TA 1OT2A 2FGZA 1W8OA 5CSZB 3IDXL 4MQSB 1KFAH 4KQ4H 2IAMB 5KJRL 3QJFA 5DD1H 5DRZA 1CLYH 5FGCB 4XAWH 2GK0B 3RIAK 4YFDB 1KPVA 3SY0A 1RFDL 1X5YA 4M8VA 1ZGLA 1PD6A 5F70A 3GI9H 4JCMA 5CJOH 5HD8D 4YGVA 1ORQA 2HVJB 3S5LA 1H0DA 3WNPA 3ARUA 5M94B 5H8DA 4M9OA 5CUSL 1JGDA 3ORJA 2KZWA 5DS8A 4KZDL 4OF8A 5KVEH 3H8NA 3IJSA 1KYOJ 4ODHH 4YHYB 3E8UL 3GMMA 1TQBC 4HS8H 5GS0C 4HAGA 1FGNH 1I7UA 4QRSB 4P46B 1OTSD 1MFBL 1DLHB 5E5UB 2VITB 4XNQA 1DVFC 3WKML 4UNUA 4DFHA 3MZGB 4K3DL 1K2DB 3KPRE 4GXVL 4JHWH 4R26L 3O6MH 1U2HA 4GMSH 4GW4B 1D3CA 4NRXB 1YPZB 4WW2C 4WFFD 2J88L 4NZJA 5BJTA 3Q2CA 1NUGA 4Z7WF 1OSPL 2VUOA 3MV9B 3QFDB 3LQZA 3AAZB 2QHRH 4N9GA 4X4ZA 3OV6A 1XH3B 3EW3B 2Y07H 5D7IB 1P69B 5C0NC 4YEEA 2HH0H 2DL9A 5JZ7D 2E27L 3QNYB 3C5SA 1QQDB 3QWQB 5CILH 1AGCB 4ONGL 1DANU 4E41A 1WF5A 3RWGB 4XMLL 4L4VA 4O58L 3QXAA 5FDWB 1I9RH 4QRRE 3I3DA 3BI9X 2A6KA 2C3HA 3LKQB 5TF1L 3GBMH 4O9HH 1JWMA 1BREA 5GRVL 4FXKA 5BCAA 2XT1B 5ADPH 4C56B 3UJJH 1GGTA 2LABA 5HXMA 3L3OB 1U3ZA 4M43H 3OJMB 2V2WA 1ZEAL 1O0VA 3BH8B 4JZJC 3QXWA 4R4BA 5DJYB 1DUZB 2BERA 5INDA 4ZOEA 5TQ2L 2DJ4A 4GRLD 3QZWA 3Q6GH 1J0ZA 5DHYA 5DQ9A 1ED3A 3OR6B 3OJVC 4KTEH 4K3EL 3GRWH 3QDAA 2O5ZH 1KG0B 2YWYA 4ZNCD 3ARTA 1S7TA 3HNVH 5C71A 3WLBB 1UZ6F 4Y7MA 3WHE0 2PO6A 3ARDB 4NC0B 1NCDH 1P4BH 5TGBA 4D9LH 2K7QA 4Q9CA 5IB5A 4DUXA 3ZYJA 4JFHD 2VNCA 4ZUTA 4IM8A 3F58L 1AD0A 3LPWA 4PJEE 1GHFL 5DWUL 3VWKD 4HCRL 4GRWH 3G5VB 3UJTH 1BBJA 4KU1A 3PQYB 4TUJB 1QSEE 5D1ZB 4MNHB 3MRKB 1X4XA 2GUOB 1KJ2B 3EO9L 1KPRA 5CGYC 4ZXBD 3P4LA 2X1XR 1N7MH 1OGTB 2P24A 3LEYL 1R3KA 3NIFE 1ZWIA 5KW9L 3VXSD 2OCFD 5CMAB 5J9PB 2PXYD 4LFHD 1X3DA 1NAMB 3NZHH 1RJLA 5F3HB 4WW2A 1RI8A 1CFNB 1RIVH 4ZTPH 4GW1A 1KJVA 5IB2A 3H6JA 3GJFB 1RK1B 4R9HA 1MVFA 1IBGL 3FAXA 5IHUL 5ABDE 3G6AB 3CH1A 1Q0XL 3CSGA 5HHNB 4WHDA 2O93L 2DM3A 1QG3A 5IW6B 3WLWD 2R2CA 4JPKH 3KPSB 3BSZL 4P23B 4GG6A 4X5WB 1JWSB 3UTPE 4XVUD 3CK0L 5ICXA 2YPLA 1D5ZB 3ZHLA 3RWHA 4AZ8A 2VAAA 1KN4L 2KQNA 4KDWA 3MV01 4YNYA 3REWA 5HI5C 2IFGA 3MV8A 3C6LD 1V05A 4M48L 1WIUA 3MFGB 5SWQA 3K46A 5HVFB 1OWWA 4KTDH 2YXMA 2W60B 1T3FB 2W38A 5JORA 4XC3H 4WFFE 2X10A 3RVWD 1EERB 2FRGP 4I4WA 3L5IA 1ZGLP 4EUPA 1I7TA 4HHAA 3SOBL 3WHXB 4X6EA 3DNKA 5GJSL 5DC4B 5EU6A 3ZO0A 4ZSOE 3V5DA 5GS0L 3PP3K 4IRSB 4YHLL 2Z4QA 3MLSH 5JOEA 3GSNH 1DLFH 3EOTH 2JELL 3QQ3B 4I0PB 1ZHBA 1MHPH 3IRPX 5KAQF 2V9RA 4P4RA 5AG8A 4N8CL 4ODUA 1E6JH 5ALCH 3FT2B 5C7XH 3HZYA 3OKDA 3RKPA 2XZCH 1OAQL 4WNQA 5IBTL 5A1AA 4O5LH 2X4SB 5BV7L 4Z8FL 2YRLA 2Y9RT 1SQ2N 1LP9E 5JHDD 3SDAA 2CLVA 5HHOA 4O2FB 5GRVK 3NN8B 5MEPB 4C58B 1IAIH 2QKIA 1ZLSL 3TH2T 3LEXA 4G6JH 3T1FA 4YFLF 1YNKH 2WIIA 4LEOB 3S36X 3T65B 4FQPA 3EYQD 3BO8A 4NKDA 3NAAH 1ROWA 3FQWA 3H9ZA 4NM8L 2FD6H 2YD6A 4P3DA 2GJ6A 1G6RB 1HHGB 4RZCB 3CJJA 2GITA 3I3BA 3GB7A 3QG6A 4IOFC 1DQQA 1CIUA 4L4TB 5DJXA 4NO3B 3K81A 3HI6H 1IGJB 4NUJA 1DEDA 4OD1H 3O3UN 3B9AA 4Z7OF 4CVXB 1A14L 3MRLA 1KEGL 2AK1H 4QRPB 5C0CE 5AD0B 2HFGH 3B9KD 5FGBA 3BN9C 2WWKT 4K7PX 5KG9A 4HJGB 2EDKA 2X4NA 4MD4B 1FLTX 4CW1B 4JJHA 1P4IH 4GW5A 1AGBA 2B2XH 3VFWB 4ONFL 4U6HA 2Q76B 3ZYOA 4AH2B 2XQYK 2IADB 3BZFA 5J7CC 3SBWC 1GAFL 1HSAB 4HC1L 4G5ZL 2H45A 2UWEA 4QKXB 5C0EB 3O9WD 2YPVL 4OI8A 4XRCB 5EIQA 2YA2A 4R2GD 2C3XA 1K4DB 3PP4L 3KJ6L 3IDUA 2MPAH 3F12A 3QEQA 5F1OB 1VACA 4BSVA 1N4XL 3VXUA 3GZKA 1RJYB 3U6RA 3F6LA 2R0KH 1IEBB 1T21A 5CWSA 5T3XL 5E95B 1G7IB 5D2NC 4XTRC 1QBLL 1LO5A 2J8HA 5T3ZL 3UC0L 1IGFH 3GSUB 5E6IA 4PJFF 3BPCB 4YDLC 3TBVB 4GLRI 3WYRA 3HMWH 1P7QB 2NY6B 4YUEH 4X5XB 1YEDA 2FEDD 5EU7E 2P8LB 4UUJA 2ADIB 4AL8L 1MQKL 1J0KA 4XPGL 4BSWB 3BKCH 5HPMA 3VGHA 5D6CB 3T0EE 1S7QA 5F7UA 3EGSA 4ODWA 1MHHA 2EXWC 3N9GH 3MRBB 3AXLA 3GMLB 1S7RB 3TT3L 1BX2B 5D7LA 4PJDB 2A9NL 4JVUA 4FMFA 2P5WA 4ACPA 2IGFH 1T0PB 2QSVA 3VRJA 4Y4FD 1J0IA 4MDIA 4EDWH 4NJ9H 3ES6A 1FZMA 3HLAB 3CDGA 2XIDA 4UINL 1N6QL 2VL5A 1RUAL 1IFHH 4M4PA 4YAQA 1OAYL 5MHSD 5C8JA 1UXWB 2QADB 2IPKB 1XF2B 4NC2B 4YK4B 3X14B 4PTTA 3HRZA 3L5XH 1YMHA 4JM2B 5CZVL 2W07A 2JE8A 4RIRA 1FO0B 2LVCA 3DGGB 4PJ8C 5I6XC 4OCYH 5DQDL 4I0CC 1EH9A 4JFFD 4PRBA 4FQXC 3IFLH 1H5BC 4OI9A 1RZ8A 1AKJB 4GKZA 4ZQKB 5KAQG 5KSBA 5HGDA 3PL6B 3EYSH 1S9VA 1QR1A 1UM4L 2JB5L 3HG1A 1PX4A 2VC2L 5LAXB 1NEZB 4FFYH 1LEKB 4XBGA 1QLEH 2WUBL 4HUUA 1NJ9A 3SE9L 2BNUA 2AVGA 3BDXA 3FKUS 2F5AL 4HIEA 3UBXA 1OT1A 2C1PA 2ICWJ 4G9FB 4ELMA 1I3RB 2XNAA 1S7VA 15C8H 4L3EB 4Y4KB 4UAOC 5JPMB 2FR4A 4YR6B 3GIVA 2DTSA 4M7LL 2PNDA 3TCLA 2GJJA 3D69A 1HHHA 3F65A 1YEEH 1F90H 2W91A 3U0WL 1MRCL 4HUVB 1FZKA 4G3YL 4YDVA 3FB8A 3CVHB 4JB9L 2VLMD 5I75C 2P42B 4JREB 4U1KA 5I8EA 5FYJL 4XP5H 4PJBA 1KCUH 4QF1A 1KENL 4QXGL 4NPYB 5I9QC 5T1DH 1QACA 3CZFA 4FTVD 4HF5L 4OFKA 2VLKA 2DQHL 1GGUA 2AERT 3X3GH 4MJIB 3KYAA 3GSQB 1EO7A 4DTGH 5F9JB 1YEJH 5IK3A 4P3WA 3NIGE 4Y2DA 4JFPA 2XA8H 4UQ3B 5EOQL 4M3JA 4PD4K 1ZVHA 1LDPL 4PRDA 3MXWL 2DYPB 1ZHNA 3NOIA 2OMBA 2BNRD 1KC5L 3MRIB 5IFJA 2ENYA 1Q94A 4NRZA 4QY8B 4OLXH 5DO2D 1LD9A 2FBJH 1T66D 2QR0A 4LHUA 4TTGA 4J3XA 3EKCA 5CFHA 4BFIB 4GKNA 1VFUA 3JV5A 3C5ZB 4KC3B 1AC6A 3RUGE 3MGTB 1AY1H 2D0HA 2WIMA 4Q0XH 3TA3C 4DAGL 1T6WA 5SWZE 1NPUA 1A47A 3VXMD 1CDJA 1PYWB 2NYYC 1A6WH 2R23A 3C60D 4OD3L 2VQ1B 4PJ8A 3OL2A 1JBJA 3TO4C 3DO7B 2PKDA 3RVVD 5I18L 4Z5RA 5JA8B 1EJ6A 4LPVA 3R06B 1C5DA 3E2HB 1T1YB 5CBAB 3VH8A 4HWZB 3VFMA 4PLJC 4NKQB 3RGVD 5JPNA 4ONOA 2F74B 5BXFB 3HUJE 2JK5A 3MGAA 1I7RB 1HSBB 1UB5A 4MD0A 2R2BA 5FKAB 4P5TB 4S11A 3WFEL 4PG2C 5IGXH 2JJWA 5IVXB 1G7MB 4KKAC 3MJ9H 1SYSB 3A6CL 2UZXB 1C12B 1I8LC 4KGLA 5JQ6H 2IPUK 4JN1H 1NCCH 4LU5L 2M2DA 3GMPB 1FAIL 3WJLC 5EZJB 3MREA 4FZ8L 4MCZB 3BP4B 1KCVL 1KUMA 4QT5A 5HHMB 3IETB 3TBYA 2RCSH 1WQVT 4MCYA 5ESVA 4G6FB 1TLKA 5TDOA 1N5YL 2BNQE 4NM4H 3K8LA 3WDIA 3MV7A 5D7JB 4JM4L 1VEMA 4QTIL 4RISL 4OZFG 3PGCA 5E99H 1A3LH 4P2YA 3VFPA 25C8L 4P59L 1NFDA 4RMWA 5JLZA 2A73A 4KRPD 3FFDB 2APBA 5CKGA 4OZHE 1NGQL 2QLVB 1HXMB 1YMMA 3WIHA 3DSFH 1JVKA 1RULL 2A0LC 3IDIA 4WI2A 4JAMA 5DJ2A 1S5IL 2BFVL 4JG0H 2R1YB 1T03H 4BZ2H 1EAJA 3SE3C 2FZ3B 3AROA 2ZG2A 5GRXG 3KXFA 3STBA 2EE9A 3L3JA 2XN9D 4DW2L 3I6LD 1RK0A 2ITDA 2DF3A 5AUMA 5F7EL 1WBXB 3DPBA 1CQKA 1A9BB 4K3JL 2I60H 1S9XA 4PJGE 5L2JB 5D93B 2IQ9H 3B9VA 1OGAE 4NUGL 5D1QB 5ICYB 3B3IA 1MHEA 3OMZA 4ZO9A 1U8IB 3EJZD 4KQ3H 3WUWG 1H8SA 4I48B 2FECI 2NMSA 1UZ8B 1OPGH 5IKCB 4FQJH 1P84K 2YA1A 3TA3A 4MJ6A 1RQ5A 1KB5B 4LLQB 5FYJU 1ZHKA 1HYSC 2Z31B 3QQ4B 2VLJD 3OB8A 1LMKA 3QDMB 4NQXA 3O3EA 1GOFA 3TO4A 2EXYD 2DQDL 1I4FB 5JXEA 4XBPA 3ULUH 1U93A 4X6DE 4KK6C 4F3FA 4HDIA 3ZLQC 3TJHC 4OCLC 4PJCE 4HWNA 2LVEA 1MFEH 1PEZA 5ENWA 3EYOB 3MBEB 4U4BA 4BH8B 1G7QB 1OLZA 3VFRB 1AXSA 1CGXA 3WIHL 4BELD 2AJZA 1EHNA 3AB0B 3KYNA 1DBKH 5CZKA 4DK3A 1NCBH 3L6FA 4GG6F 5FGCE 2BSTB 3C8HA 1BPVA 4LKXA 2P8MB 5KBNC 1CZ8H 5I1KL 1DQMH 4M1GH 3WJLA 4HLZH 4LSPH 3NA9H 2V17L 4M6ML 3MV11 4PRIA 1A7QL 3LMJL 4RFEB 3PWJA 2KQMA 4LL9A 3S5LG 1XIWB 1XGTA 4M7JH 4XP1H 1DQDH 1PAMA 3DETD 1Z9MA 5HD8C 4X0KB 5IWLC 2DLFL 2G5BB 5E08H 1I9IH 4RNRB 3VFSB 5B39A 3CC5B 4TVPD 4MYWB 2VZ1A 4EOWH 3ZL4H 1TJIH 2XI9A 3X11A 1WUNT 1YPZE 3IDMA 3G5YA 1JPTH 2ZCHH 4KAQH 3EO1B 1OTSC 3MV9E 4OF5A 1MEXH 3Q0HA 4H0HB 4L29A 3UROR 1AO7A 3H9SD 5I1LA 3D0LB 4LVNC 2ZUQC 5HHXL 3S6CA 2RFXA 3NZ8B 3TH4T 2EDRA 4RGOL 1YEIH 1S9KC 3AS0A 1A6AB 3U30B 3B83A 3CDCA 4PRPA 4NQDB 2PYEB 3HE6B 3BZEB 4YBHA 4NBXB 4GG8B 2EE3A 4M6OL 1YEKL 2D3VA 2AJXH 3KPNB 1VPOH 4UDTA 1T2QL 2ARJB 3S37X 1H3WM 3I85A 4OGZA 5FO9A 1I1FA 1T7YA 5EU3B 4ONHB 4X99B 5F72S 3WE6B 5H35A 2EDBA 2AK4B 5JZ7C 2ORBL 2UYLA 1CF8H 2VERN 5I0ZA 3IAGC 3QIUD 4D0BB 4OUUA 1BVKA 1REIA 2ZUXA 3QIBC 4H0IA 4UTAL 3STLA 5I16B 2NZ9C 1RZGB 5E2VL 2HKHL 3LKOA 2ESVD 4K3HA 5FB8A 5IW1A 2KKQA 4U6YB 5FDYA 2CKBH 3K4ZA 1NGWA 2P7TA 3WFBL 3GEWB 4C56E 1DN0B 3SGEH 4P2OA 3G9AB 3MLXH 5MERA 4WHTA 5C0BD 1FNSL 4CVZA 2VMFA 3Q6FB 5EOTB 2C4FU 3WD5L 4XB8A 3UPRA 4YBQD 1D6VH 3MPCA 2ITCA 1NBYA 1M7IB 1I3UA 3QZWG 3ARSA 3VFNB 5CEZL 5KN5A 3NPSB 3T3PE 5L8JB 4ERSL 3MACH 1UWGH 4GRLC 3O3DA 4AM0A 2UZIH 1HH9A 3QHFH 4KFZC 1VA9A 1KFAL 1AFVH 2ZZUT 4KQ4L 1UH3A 1F00I 2ERJB 2V5YA 5DD1L 4U3CA 2VLJE 4XAWL 2D7NA 5GZOD 1NAKH 3QUZC 3DVIA 2CLZA 4J1UA 2UWEF 4QTHB 2UV3A 1UADC 3QI9B 4XZUB 5CLWA 5CJOL 3VWKC 3RWIB 5IWLA 1JYXA 1TVHA 5DYOA 3CSYB 4YGAB 4WY7H 5HGAB 3D87B 5KVEL 4HJJH 1R3HA 4P9HC 4ODHL 4KK8C 4ZXBC 1WT5C 2EYTA 5FYLE 4HS8L 3DMMD 2NY4D 1FGNL 5D1XB 3QT2A 1D5XB 3OZ9H 4PGEB 1WISA 5TH2B 3LH2H 3W9DB 5EOCH 3BESR 1KYOK 3W5NA 2IMMA 2PXYC 4JHWL 3O6ML 4GMSL 4IMLB 4R3SA 3IGAA 4XPTH 3KPSE 4LPWA 1K6QH 1NGYA 1A1NA 1RAMA 1NDMB 5DC9B 3IDJB 2GSGB 5IM7B 3L1OH 4LLDA 5IBLD 5BRZB 3T0WA 3REVA 1WFUA 2Y07L 5J11B 2HH0L 3N50A 3WLWC 4TVPE 4RMQA 3FCTB 4OLEA 5CILL 3QUYB 4XVUC 4LMQI 5F9AC 3L5HA 4HX1A 1KCLA 3NCMA 3BH9A 4KI1A 4OSUH 3GMNB 1ERNA 1I9RL 3V8CA 3JV0A 3C6LC 1X7QB 2BVPB 2CSPA 4AT6A 1EBPA 4JRYB 3GBML 4EUPG 5JW4R 5TF0A 5EU7C 4JDZB 5IMOB 4O9HL 1TIUA 2CIKA 5JHLL 3RVWC 1EXUA 2OQJB 2YC1B 3T0EC 1CG9A 4QNPE 1D9KC 4JFOB 5ADPL 3P73B 3DRQA 3O11B 4PY8J 5EO9B 3SE8H 4RDQF 3L7EB 4M43L 1DL7H 4R7DB 3FB6B 4MA1C 1AGEB 1I8MA 1NBVH 4OIIH 3VE0A 4FRWA 1ZT4B 4ZPVB 1HEZB 1XZ0A 3WN5C 3P9LA 4JHBA 3S35L 1JFQL 4P5KB 2ZJSH 2VLRB 3FQXA 4NRYB 1FBIH 3OJDA 2X42A 5HYQA 1FIEA 2O5ZL 2D03H 4MNGA 4U3XA 3HNVL 2XKSA 2XG5A 3MNVB 4Y0GA 3RNKA 5J12B 1ONQB 1C08A 1IAOA 1NCDL 4TNWF 4D9LL 3K2MC 2HFEA 4XX1G 4KMQA 3EYVB 3ARWA 1KXTB 4ELMF 3OKEA 2IEPA 2X05A 5SWSA 4ZNEE 5EUKA 1VCAA 3VXRE 3C2SA 2XWTB 3HE7D 4YBLB 3VWKA 4NKOB 3UTTB 1HI6B 4FNLH 1VENA 5JIPA 4LKCB 4PJ5B 2ZSVB 3TPKA 4L9LB 4ZXBA 1WT5A 1SHMA 2R0WH 2V2TB 3K74B 4L4TE 3LB6D 2Y7QA 4XP9H 3L5WB 2PTVA 5CIPA 4W81A 5D7KE 1A4JB 5I71B 1FZOB 3ZE2F 4QRPE 3A6BL 3GSNA 2HT2D 1L7IH 2X4TB 3VXSA 4M93C 3ULVF 4K94C 3EFFA 4M8QB 1N6UA 2PXYA 3NGBB 1U95B 1QD0A 3LN4B 5AZEH 2YA0A 2JCCA 3NZHL 4PJBF 3VRIB 5IMLB 5B38G 1NGPH 3H3KA 1RIVL 2ZG3A 1RJZA 4ZTPL 2P45B 3KWWB 4RGND 2ENSA 3EOYG 3H9HB 5GGVY 3GK8H 5JO5B 4WUUD 2BSED 1QKZH 4I77L 3B9KC 1SMAA 4XMPH 2EZ0D 5J13C 5C08D 3IB4A 2GT9A 1T5WB 4LAJH 3BRGC 2MQCA 5DJAB 3S88H 5E8DH 2NY7H 5IMMA 1CL7I 2IPUG 4XPBH 5FF6B 3C6LA 2NY3B 2BY3A 5EOCJ 3H3PL 3MGOA 3PV7A 5EU5A 1FL5B 1SJEA 3SDXA 4XNZC 3EYUH 4XC3L 4XC1H 3HFMH 3O9WC 2GTZA 4R2GC 3KAAA 1NC2B 4KKLD 1YQ2A 1MQ8A 1Y18A 4Q6YA 4TUOB 1WICA 1LVEA 4LSDA 3G6JB 4P9HL 1YYMH 3C6SA 2ICWA 4UT6L 2AXFB 2DI8A 4Y19B 3O45B 2X70A 2CDGB 4DWHA 1U8OA 2X89A 4KJPD 2HJKA 3MLSL 3BKYH 3GSNL 4LLVA 5I0DA 1DLFL 4Q2ZA 5J57B 3CFBA 4X5LA 5EBWB 2XZAH 2FGWH 3O4LB 3FOMB 1N6VA 1LE9B 4M5YH 5ITFA 4GAGL 3U0TB 2BVQA 2FEDC 2E7LC 1RZJC 1E6JL 5ALCL 4PGZA 5C7XL 4Z7NE 1HCFX 3BGFB 1FFRA 1NANH 3D2UD 4B53A 5C3LD 4PJDE 4KROC 4OV5B 1F4YH 3FJTA 2HTLC 3IRZA 4I2XE 1QVOA 4ZS7H 2QSCH 3IJYB 4HXAH 1NC4D 4WHYH 2CGRH 1VEOA 2PYFA 1IAIL 4DZ8A 4G6JL 3SKOB 5F97E 1YNKL 2GAZA 1EBAA 3MJGX 2J8UF 3DXAD 5A3IC 3F62A 1X6LA 1BVLB 4Y4FC 3NAAL 1T89A 4RSVA 3LKSA 2FD6L 5GZND 4F7MB 1OOAA 3BUYA 4KPHH 4G7YL 4RDQG 1NFDF 5D5MA 4LRNH 1L6ZA 3ET9F 3MJ6A 4DKAA 1DDHB 2ZUUA 2LAGB 2BOCB 3HI6L 2PETA 5C09D 3PWUB 3ARFB 5MEND 1ZVSA 5CGTA 4OZGB 1B0RA 2AK1L 4YHZH 1T0NB 1XGPA 3JTSA 2PW2A 3B9KA 5J6HB 1MCJA 1YY8B 1P7KA 3H3BC 4TULH 3U36A 4HPOH 4KZEH 3GI8L 3OB0H 1P4IL 4XP6L 3UBXG 4DGYH 4EI5D 4L3EE 3IDGA 4X6BB 4R96B 1WAAA 5LGJA 3HMXH 4W4NA 2EH7H 2W0FB 3ZE0E 4KRMB 5BQ7B 4PJFB 1TVDA 3MUJA 2OI9C 4ETQA 1FYTE 2R4SL 1VKXB 4PP1D 3TBTB 1BQSA 3O9WA 5I1GH 3U2SA 2SEBB 1DE4B 2W0LA 3ROOB 3QBTB 5HDBE 2G5RA 1A1OB 1IVLA 5GGUA 2IH1A 5CD5D 2X4QB 4L8DA 4XCNA 3INUL 5FK9B 3RDTD 1ODAA 3VXOA 4JFZL 1ZA6B 1CE6B 1XR8A 3U82B 4JE4B 2Y36L 1P1ZB 4LGSB 3S36H 3TPUB 4HZLB 2Q8BL 2Y5TA 4OLWH 2XPGA 1IGFL 4K94L 1FL6A 4BFGA 4EN3D 5IJKC 3LPGA 2H2PD 1S7UA 4YFEA 3MBXH 4YHNA 1KBGL 4LDLB 3RI5K 3BKCL 4NZTH 4HUWB 4QEGA 5D96C 2E9JA 4Y16D 3RVUD 5ID0B 4PFEA 1EAPA 1OF2B 4JCLA 1OP9A 4JRXB 4JFED 3JVGC 2OJEB 3N9GL 2J6EL 4OJFH 3OXRA 4K7PH 4GT7A 3U0PA 4LHUG 3PHOB 1QLFB 3MCKA 5IR1B 3TNMB 5DO2C 2V2XB 1T66C 3QB7C 1I1AA 4HV8B 1TETH 4NJ9L 4EDWL 5J4MA 3Q3GA 3O2DL 4LDOB 4DK6A 3ECBA 5EZLB 4Z0XB 1IFHL 5EO1A 1XR9A 5F7WC 3BZ4B 4U1IA 3KPPA 5HHPB 3UJIH 5L7XL 3RZCD 2AAVA 3NCFB 3P9MA 3SE4A 4EI6B 1IL1A 2OXGA 5CCKH 3IFOA 3C60C 2WBJB 2VE6A 5IVNA 3VH8G 3NABH 1UB6A 4OCYL 4FQCH 3RVVC 3IFLL 4HGWB 1CVSC 4JFFA 5C6WH 4JQVC 5IVXE 1CQYA 2A6DA 1A7BA 4ODXB 5FHBH 5J06A 4C4KO 1EJOH 5IHBA 1CXIA 1IM3A 2VLLA 1T4KA 3P0VL 4NHCL 4IJ3C 5IF0A 1JNNH 3RGVC 4GLRH 5HI3C 3DXAE 3H42L 3EYSL 4GO6B 1TDQA 1RZJL 1MFDL 3O0RH 4HK3J 3K8KA 4FFYL 3LV3B 1QLEL 4EVNB 3TT1L 4H5SB 1TJHH 2VDOH 2VAJA 5E8EA 3O3AB 4YO0B 2BSSB 4JEGB 2AP2A 3BP5A 1CXLA 4EIZC 4MA8H 2UUDK 15C8L 3O2WH 5INCB 4JN2B 4PP2A 3BAEL 3ZHKA 1Q9OB 4ZTOH 1LEIA 5T1MA 2LTQC 4XVSH 5CJ8A 4Z77A 2HG5A 4F7TB 4G8IB 2EO9A 3Q5TA 1MUJA 4APQB 3VA6A 1YEEL 5DRZB 3DURA 5E7FA 5MEQA 4R90H 4NN5C 3BWAB 5EC1B 2BHZA 1KPVB 3SY0B 4J23A 5IJKA 1ZGLB 4OBSA 1KIPA 3IFNH 4TSCH 3SJVD 5DVKA 5HI4C 4XP5L 4JGJA 1KCUL 4YGVB 1VADA 3IF1A 4HXBH 4FQIH 2VISA 2CUMA 4MNQA 1T20A 2V9TA 3MRFA 4MDJA 1JGDB 1NMCB 5C0AD 5T1DL 1QEWA 1KPUB 4FTVA 3MJ9A 4MXVF 4PJHA 3IJSB 1TVBA 3GNMH 2D7OA 1T7VA 1AIFA 3JVGA 2XA8L 1I7UB 4XNQB 2BNRA 4F7PB 2XFXB 1KACB 1WITA 3S34L 5DD5L 1OARH 1UWXH 5HYJB 2V7NA 4OLXL 2FBJL 3JWDH 1PDKA 1JYNA 2D7MA 1R24A 3EOBB 2NTFA 3EJZC 1FIGH 4N9GB 5JOFA 3R8QA 5GGQH 1AY1L 1EHLH 1JIBA 5DTFA 4Q0XL 4X98A 5BS0D 1YNTA 3C5SB 3VXMA 2XKNB 1A6WL 3QXDB 5D71H 3C60A 4JFEE 4E41B 4PB9H 4L4VB 3QXAB 3BYYA 2EXYC 1NLDL 2PW1B 3QDGA 4ZO8A 5IROC 4UDUA 4JQVA 2A6KB 2VSCA 5TJWK 1A6VH 4BQ8A 4KHXH 4RBPH 4WUKH 1KXQE 3W2DL 4MZ2A 3QIWA 2IALB 5ISZD 1JWMB 4TN9A 3RGVA 1XCQA 1QYGL 5FM8A 3RBSA 4FXKB 4X9FA 4OFPA 1NQBA 3HAEB 2PR4H 5IGXL 4XI5D 4NJAH 2X1OA 3BP6A 3MJ9L 2V2WB 3KYOA 2MQ0A 4JN1L 1NCCL 4P4KD 4F57H 1Q0YH 2FO4A 5JMRA 2CO6B 4YX2L 4GRWF 5INDB 3QHTC 3SKMA 2RCSL 4ZOAA 5DHYB 5DQ9B 3IKCB 3BEWA 1ED3B 2VXTH 2I07A 2VIRA 3FMGH 3RTQD 4NM4L 5B39G 2YD2A 3CXHJ 3HS0A 4KV5E 3DETC 4U05A 1S7TB 2Q7NA 4LGRB 1NCWH 4BKLB 3QUMH 4X7TB 5A16A 1A3LL 3GSWA 5SV3A 3WNLA 1SYVA 4LLWA 1J5OL 5HGHB 5I2IA 5IB5B 5E0QA 4GSDL 1Q72H 1FVCB 3AU1A 5IVOA 1AD0B 4AMKH 4JDTH 4NQDE 4QRTA 3RRQA 1CLZH 1EV2E 2P1YA 3DSFL 2H2SD 1T03L 3MTRA 4BZ2L 4UU9A 3EHBD 4Z7VA 1TQBB 4XCYB 2B20A 4G8FA 2P24B 3BT2H 1DEEA 3V7AG 3MODH 5FYKE 1Z0NA 1R3KB 5SX5H 1DVFB 1QFUH 2I60L 4I0PC 2BVOA 2H32H 2V5MA 5K9KA 43C9A 2IQ9L 1RJLB 2A38A 4WW2B 5CLTA 4GW1B 3QIUC 1KJVB 5IB4B 3CMGA 3KLHD 2BX5A 4DGVH 3ZKSD 1P6AB 2X40A 3SJVE 3CH1B 3EIFA 2R2HA 5IUSA 1OPGL 2NY1C 3WJJA 5DD0H 3BPLC 1OTUD 3TWCL 5C0AE 3TN0C 4GG6B 3NFSH 3T2NH 3PWPD 1YEHH 5ICXB 3RWHB 2VAAB 1K85A 5IMKA 4YNYB 2FNBA 1IGYA 3MV8B 5JNYA 2ATPA 4H20H 4YBQC 4S1SH 2R0LH 5SWQB 4N0YH 1MFEL 4JANA 4NNYA 1UA6H 2R29H 5JORB 1MIMH 1QSFB 2CH8A 4JFDD 2HLAA 5L2KA 4ZUVA 1YJDH 6CGTA 4EUPB 1DBKL 3O41B 1NCBL 1UKTA 4X6EB 1FNLA 3U7WH 3KLAB 1NLBL 3UCRA 1J0JA 5H37H 4BQCA 4JZJB 2YWZA 4CJ1A 1G7PA 1JZ2A 2ED9A 2Z4QB 4LSPL 2X9WA 3NA9L 2QBWA 4WGWB 4D0DA 3RX8A 4CDGC 2EEAA 5T33H 5GZOC 2CKBA 4Q74A 3SDXF 3LD8B 4M7JL 4XP1L 1DQDL 3HNSH 2XRAL 4ODUB 3CX2A 3ILPA 1CE1H 3LHPH 4P2QD 5E08L 1INQA 1I9IL 2DQIH 1KN2H 3DI2B 4NYLA 4NOFA 2D31B 4HKJA 1CLOH 3ZL4L 1TJIL 3GMOA 5DRWA 5ANMB 2EIEA 3DMMC 1ZTXL 2YOCA 2VN4A 4YDIH 5K33A 1JPTL 2ZCHL 2QKIB 3N1GC 3LEXB 3T1FB 4JQXA 4OB5H 5FCSH 2WIIB 2DJSA 2IAMD 3RHWF 3H9SA 4PJ7A 4U1LA 2AJSH 3ZDZF 3BO8B 3J7HA 4LCYA 4NKDB 1Z6JT 1YEIL 3PDOA 4R4FL 3FQWB 1XGRA 3DBXA 4P3DB 5GJTH 2GJ6B 35C8H 2AJXL 1VPOL 3BWUC 2GITB 3GB7B 5IBLC 3QG6B 2VZ3A 5E8NA 2DKUA 1DQQB 3ARGD 1UH2A 3VD3A 5DJXB 1CF8L 1Y0LA 3QIUA 3D85B 5E70A 3DARA 5FOBA 5E2TH 1L0YA 1HQRB 1F97A 1IM9D 4L3AA 2P8PA 4P46D 2ESVA 4HWBH 4IIQA 1PKQE 3HRPA 5MEOA 2CKBL 1TZIA 4LPTA 4XXDA 4N0UB 1X5ZA 5IHLB 5C0BA 2FYYB 2MJWA 1U58A 4GW5B 4JPVH 4U6HB 3KYMB 4TVPL 4UMGA 1D6VL 3GSXA 5IOPA 2VLRE 4JO2L 4R0LA 1ES0A 2E7HA 1GGCH 1NEUA 3QR2A 1ND0A 2Z35A 3S3JA 3R8BB 2C5DC 1S7SA 4NWTH 1G84A 5F9DC 1CI5A 3MACL 1UWGL 1ZT7A 3QEQB 1KCKA 3WXWL 1VACB 4BSVB 3VXUB 3U6RB 3DTXA 2NY2D 4NQCB 4GXUN 3QHFL 4R6UA 4U2YA 3AUVA 1AFVL 2NLJB 4QHMB 5DR5H 3DUHA 4TTDD 2UVEA 1LO5B 2CIIA 3B5HA 2IANB 4OKVA 5J56B 1MAMH 3OKNA 1OY3B 4TSAL 2DI9A 2NX5D 4PJ5E 2ZOKA 1FC2D 1BFTA 3S37H 4OCSH 3BGMA 2E9BA 4PGCA 5I1CH 3HE7C 1CD1A 3T77A 5EBLA 1EZVX 3NH7L 4JFDE 5HPMB 4ZUSA 4H1LH 2EH8H 5C1MB 1S7QB 3ZKMD 3EGSB 3MA7A 4ODWB 3D25B 1A21A 3OGOE 3AXLB 4V1DD 2A6JA 2ADJA 3DMMA 3LB6C 1E4WH 4JDVA 4NZRH 2NXYC 3FO1A 3OZ9L 3PJSA 4LFHG 5D7LB 2FJGA 5EBGA 2C1OA 1J7VR 3LH2L 3T0VA 5FM4A 3ARDD 2HT2C 2M26A 2P5WB 4YIQA 3EJYD 3L9RA 3VRJB 1O7VA 5DT1H 1JK8B 2B1HH 4MDIB 4XPTL 5EZIL 3ES6B 1FZMB 1K6QL 2CJUL 4YXHH 3CDGB 3EYFA 1XF4B 4W68A 1FYHB 3L1OL 4HLJA 5F8QC 4YHIA 5C8JB 4PTTB 3TBWA 1U2CA 4WHCA 3HC0A 2EZ0C 4RIRB 1WWBX 4HWEH 1XMWA 3G6DH 5GGSA 1JPST 4DKFH 5DVLA 3H9YA 4PRBB 4P5MA 2GFBA 2E6QA 3WFCH 4POUB 5F6IC 5TE6H 1F8TH 4WGVB 2Y6SD 5DFVD 1KIQA 5KSBB 4X4XA 5HGDB 5FFLA 5TDPA 3G6JE 1KCRH 1S9VB 4GOSA 4M7ZC 4PJXA 4HBCH 4Y19E 5TE4H 5JW4Q 4ELKA 3KLSA 1LE5A 5F44A 1S3KH 3CX5K 4HUUB 4KKLC 3RIFF 5C92A 3VWJC 3IAQA 4Y5VC 2BNUB 3SE8L 1EEZA 3TIEA 2H6PA 3UBXB 2C4XA 2C1PB 5IB1A 3O4LE 4ZYKA 4P23D 4OIIL 1EEQA 1OWRM 2XNAB 2EEDA 3W39B 2ZCLH 2UY6A 1Q9KA 3V8OA 3HC3H 4KJPC 2FR4B 1E0OB 1G0DA 1D5MA 4ODBD 2HMID 1DFBH 1OSZA 4CNIA 3VXQA 2ZJSL 3B2VH 4TSBH 1FBIL 1F2XK 4IDJH 4S1RH 3TBSB 3D69B 2R2EB 3QRGH 4PJAA 3W81A 2A2QT 5D2NB 1OTTD 1T04A 1T1XA 4EDXB 4OLUL 4PREB 4Z7QE 4YDVB 3D0VA 4QRRA 1Z5LA 4YDLB 1KIRA 5GSVB 1MI5A 1JV5A 5DEGA 1BQHA 3CLFH 1K8IA 1F02I 3FFCD 4FFZH 3X13B 1WGOA 5C0JA 3HE7A 2CO7B 3CZFB 1HXYA 2J7LA 4ZS6D 2BRQA 4FNLL 2AEQH 4U1MB 4XHJC 5E7BA 3NIDF 3QO0A 8FABA 5IK3B 5I8CB 3QHZH 1L0QA 4HUNB 1BJ1H 2AKRA 2VRAA 2IBZY 2R0WL 5DRXA 1NAMH 4PRDB 1K8DA 1ZHNB 5F1KC 5DVOA 3IXTA 4KMTH 5GZNC 1DBJH 4N0CD 1C7SA 1RUPL 3GJFH 2ZP0T 3V4PH 4QYOA 1EA9C 5AZEL 4N5EC 5AZ2H 2QR0B 4Q9QH 2ZUYA 1NGPL 3G5XA 3RPIB 3V6OC 4GKNB 4R7NA 1IAKA 5B22A 3C08H 3LKNA 1A7OH 1NFKA 3B5GA 3GK8L 4TPRH 4PJHF 4A2LA 3ARXA 2VB5A 1J8HB 4WUUA 4O4YH 3EO0A 2EDHA 3W0WD 4XMPL 2Y06H 2R23B 1AJ7H 1FFPA 5C08A 5I1DA 4PJFE 3QEHA 4PJ8B 5E8DL 1ZKAA 2NY7L 4HIJA 3T4AB 5I6XB 2YK1H 4V1DE 4MQXD 3PWNB 4FQXB 4Z5RB 1H5BB 2NNAA 4EI5C 3E6HA 1YUHA 1C5DB 4XPBL 4M00A 5EZOH 4BH7A 4LLAA 4HMCA 1BOYA 3VMNA 3MUGA 3GHBH 5LBSL 5JPNB 2BC4B 5HVHB 3WS3A 3EYUL 4XC1L 5JIKA 1UB5B 4MD0B 4PP1C 2R2BB 1ZV5A 3X3FH 2B4CC 2B1AL 5KSAA 2OTWA 5EO0A 1V7MH 2MKWA 4Y5VA 2CD0A 2VR4A 3UP1A 2V6HA 4PG9A 1YYML 5HGGS 3RDTC 4W6YB 4KH2A 2J12B 3OSKA 2BVTA 4QT5B 3TBYB 4MCYB 4UAOB 1BAFH 5A2KH 1B6UA 3BKYL 5ESVB 4PRNA 4EN3C 3TV3H 2XZAL 2FGWL 1UT9A 2H2PC 4M5YL 4JRXE 1FCGA 3M1BA 3F6IA 4S0TD 1F45A 4Q9RH 2GI7A 1OL0A 3TJEH 4GBXD 4IMKC 4NGHH 4RMVA 43CAA 3VFPB 3D2UA 1GJIA 1A22B 3RVUC 3UTSE 5IT2H 4NNPH 2A73B 2V5RA 5I75B 4OLYH 4ZS7L 4XCEA 1NC4A 3NA4A 2H26A 2CGRL 4G7VL 4UBDD 5DJCB 5ECJE 3AM8C 1YMMB 4ETYA 1XFPA 3SO3C 3IDIB 5I9QB 5B4MD 5LGKA 5DJ2B 3LSOA 1C1EL 1TTGA 1CL7H 2W9DL 1G6RH 4NC1E 4X9BA 3KNBA 4JFXA 1BHGA 3NFNA 1WZKA 1VDGA 3KXFB 3L3JB 1JI1A 1BZ7A 1T2JA 2PTUA 2V5TA 1RK0B 3OPZL 4BZ1H 3ULUF 5EG6C 1P7QD 2NY6D 2ITDB 2P47B 3DX9A 4LASH 3RY4A 4KPHL 3RU8H 3WXVH 1PZ5A 5AUMB 4LRNL 4YQXL 3QDJB 1VERA 3SKUD 4WDIB 2CUIA 1MJ7H 3BPNC 3LS4H 1HZHH 3V6OA 1DN2A 1U9KA 5C09A 3WDHA 1SJVA 3VRLF 5MENA 3VGAC 4XT1C 4OT1L 4TNVK 1VFOA 3ZKND 2M8XA 4Z7VF 3TA3B 5I1AA 5FA3A 1J87A 3QDHA 4D8PA 5EUOA 1J1OL 1UGNA 3ELAT 1DBML 3CZJA 3BFOA 1D6EA 1H3PH 1BJ1J 4TULL 4NQXB 4HPOL 2OX5A 3O3EB 4X8XA 3TO4B 4KZEL 5ERWA 5AAWA 3T3MF 4XBPB 3I6KA 1U93B 2I5YH 4DGYL 1UM6H 4F3FB 2FL5A 4HDIB 4EI5A 1FG9C 3VGDA 4G8GA 3MYJB 2EH7L 3TVMD 3JWDC 3S96B 2FATL 4BYHA 1FPTH 2VDKL 1BM3H 1U8LA 2YUZA 4YHOH 1FN4A 2VQTA 2OSLA 1JHTA 2DICA 2A1WH 3L6FB 4DEPC 3DX6A 5KSUA 5EH1A 4X9GA 1AKJD 5KS9A 1MCBA 3RDTA 1CDHA 4JR9L 3PL6D 4Q6IC 3S36L 5CEYA 4PRIB 1NFIA 5CP3H 5HPOA 3KJ4C 3PWJB 4RAUA 2D7QA 4OLWL 1JZ7A 4KJWD 3V4UH 4U1JB 3QG7H 4EN3A 1XGTB 1CD0A 2MCPH 3WL9A 5B8CA 3PXJA 1UKSA 3MBXL 4LF3A 5FXCH 4I5BB 2AGJH 3DV6B 1JPGA 2AI0H 1MAKA 3ROLA 3K1DA 4NZTL 4Y4KD 5D8JL 1CGSH 3IDNA 3QA3A 4MLIA 4Y16A 2NW3B 1W72H 3G5YB 4Z7UF 1L4IA 1XGYH 5LKNA 4OJFL 4YE4H 4K7PL 3AM8A 1WBZB 3OR7A 4L29B 1X9QA 1YZZA 5CP7B 5EPMA 1IC5H 3ALPA 5ITBL 2RFXB 3L3GA 1DQJA 2Q87A 1BFVH 3A67L 4AEHH 1PW3A 1IGIH 4PRPB 1A64A 3CU7A 3OQ3B 4E5XA 3LQAC 4UDTB 4E41E 2YBRA 4L4VE 5E00A 5FO9B 2VDPH 4LQ1A 2VYRE 5H35B 3NFPB 3U83A 3I50H 3LRGA 4HEPG 3RZCA 2UYLB 1F11A 4OUUB 1BVKB 3CXDH 1WBYA 5I74C 3KHOA 3LKOB 3NABL 4PJ7F 1WIOA 4FQCL 4RAVB 5DRNA 1W8NA 3D48R 3SDAD 4ORGA 5DUBA 1X4YA 3MJ7A 1CFTA 4WHTB 1JNNL 3UDWA 1A0QH 4N90D 3WO3B 3DV4B 2P5ED 1GVIA 3SCMD 3BD4A 5DMGD 3O0RL 1RIHH 2HAZA 3UPRB 4XI5C 5DJ0A 5C0IA 2ITCB 2VDOL 4LLMA 4NKMA 5GISH 1KGCD 4PJEB 2EDJA 1UXSA 3LKRA 3VI3F 1CBVH 3D6GA 4CU8A 3AS2A 1FFOA 3L7FB 5KN5B 3PG2A 4MA8L 1J86A 2B39A 5F7DA 2IBBA 4UT7H 4KDTA 5JXAH 4KWUA 4ZTOL 4GAFB 3N0PB 4G80B 3DHMA 4AM0B 3RTQC 3CVHH 5FUCC 1WZ1H 1EMTH 5ICZA 4R90L 4J1UB 3UTZA 1X5GA 4KKNA 4R8WH 3IFNL 4TSCL 4U1NA 2K7PA 4OCWL 3OB0K 1BIIB 4HH9A 1URLA 2H2SC 5CEXB 4I9WD 4C57C 2J5LC 4OD2B 3E6FA 3JBG7 4HLZG 3L3HA 3EHBC 1WTLA 2EDQA 3GNML 3GBLA 1P9MC 4LCIL 3WDJA 2QQKH 3WFHA 4JPWH 2BVEA 4DQOH 1WCBA 5GXBB 1KTDA 4LVNB 2ZUQB 4F9PC 4LNRA 4HGMA 1OARL 4R3SB 3IGAB 5I76A 2EIBA 4PJIF 4GG6E 3JWDL 3TESA 1NGYB 1MIEL 4A2MA 2YPLE 4ZFZA 4PRAA 4A6YA 1FIGL 1TNNA 4JJ5A 5BZWA 1FQ9C 5GGQL 3QUMA 3GMQB 4WFHD 3MV8E 4U49A 2DDQH 4ZSOB 5BS0A 3T0DA 2DIJA 3CFJA 1AQDA 4M6NH 4ZAKD 5C9KA 1AH1A 1I1YA 3PWLB 1JL8A 3IXAA 5D71L 1QLRA 1QSFE 3QFJD 3QH3A 3PIQA 4X9HA 1FG2A 5MI0C 2EDFA 2KZ1B 4LSVH 4WI4A 1A6VL 4KHXL 5E4IA 4WUKL 1QNZL 1OW0C 3P30L 3P4MA 3CLEH 5GRJH 4M62H 5EU6E 3NBNA 2CIKB 3SDYH 5TDNA 1CG9B 2X1PA 4TNVF 2PR4L 4M02A 3TNNA 1U3HD 5GRZA 3DRQB 4NJAL 2GEEA 1LP9B 4NQVA 3NGBC 4AEIH 1D5BA 1JHKL 5IG7A 2H32A 1LK2B 3FB5A 4CJ0A 4UTBH 2BXYA 5HY9A 1SY6H 1Q0YL 4P4KA 4F57L 2DLGA 5JDSB 5EFIA 1TMCB 2VH5H 2Z31D 4S1DD 3QDMD 1RU9H 4GRLB 1JNLH 3BGAA 1SVZA 3FMGL 2R15A 3OJDB 2X6MA 3RTQA 4MNGB 5HHOE 4A6YL 3LQAL 5JOPE 4N90E 3RNKB 1RUQL 1C08B 1IAOB 4K3GA 3QUML 2H3NB 1JN6A 2F54D 5IB3A 2HFEB 3QUZB 1I8IA 5TQ0H 5EUKB 3MFFA 5F1SA 2I25N 1Q72L 4PJ9A 3IJHA 5I30H 5GIRA 4AMKL 2CDFA 2FO1A 3VWKB 4HD9A 1CLZL 2GJ6E 3P4NA 1I7ZA 3WMSA 2FH8A 1XGUA 3IAPA 1U8MA 3KVQA 3VI4F 1DBBH 1JHLL 5T3ZE 4JVWA 3F7VB 2X4OA 4XP4H 1J0YA 4PJAF 2BJMH 4ZXBB 3D1MC 3ZE1F 2W65A 2Y7QB 4YWGL 1NL0H 5CIPB 3MODL 4KRNA 3O6LH 3FRUA 1TTUA 1QFUL 3GSNB 4LRIC 4ZFGH 3VXSB 1VGEH 4F9PA 2PXYB 3ARGC 1BD2D 2JCCB 5F89A 2COQA 2BNQA 4N0UE 1RJZB 4KXZI 3MRRA 1J8KA 4TOYH 1KTKE 5DJDA 3MNWA 2WV3A 2BSRA 3MXVL 5DMJB 5MP6H 5DLMH 1MJJA 3ULVD 5HDLA 4I9WE 1ZANH 1TNMA 1KF9B 3TYGH 3T2NL 1YEHL 3PWPA 4RA0C 5I66A 4HG4K 1U0QA 4LOUD 5IMMB 2PYED 2VLKD 4YHPA 1UACH 1U6AL 3DX7A 4WU7B 5GHWH 3C6LB 4H0GA 5CINH 4H20L 4OUOA 3MGOB 4H8WC 4S1SL 2X4PB 3QEQE 2R0LL 5EU5B 3VXUE 1OW0A 1QBMH 3F8UB 1SJEB 3PWVA 4N0YL 1MCFA 1UA6L 3KDMA 4E42A 2AK4D 3MMEA 3QNXA 4LIQH 3FB7A 4QRUA 5DMIH 2GTZB 3BW9B 3LOWA 1UH4A 4Y5YC 3T0EB 3C2AH 1D9KB 1CDUA 1Y18B 4GMTH 1AXTH 5I19H 5E94B 2VXVH 4LHUD 3U7WL 5LJYH 5H2BA 2ICWB 1FP5A 3QO1B 2NY2C 4MA1B 1UVQB 4LCWD 4XH2B 1TQCC 2RBLA 1U8OB 1K4CB 4TTDC 3WN5B 2B7DT 4MAYC 4LLVB 4HWBA 3C9NA 3D39A 3T0BA 4NSKA 1OP3H 5FYKU 2AJUL 3RAJH 1MHCA 5E1HB 4F7CA 1SM3H 5ITFB 3HNSL 2BVQB 4JKMA 3TZVD 1CE1L 4Z78B 2FB4L 3FO9A 2FECL 4P2QA 4BSJA 4JO4H 5D7LE 2DQIL 1KN2L 2BHUA 4RBPK 1LO2H 3ZKMC 2HN7B 1CLOL 4UV4H 2P5WE 1K3ZA 5JHDB 4JY5L 3WS6C 2PYFB 3DROB 4YDIL 4DZ8B 1RMFL 5CSZA 2YUVA 3FT3A 3U79A 4WENB 3O6FD 4FP8H 2MCG1 4OB5L 3GIZL 4OGYH 1YEGL 2IAMA 1HWGB 3FQUB 3FO2A 2DWEB 1KB9J 1IT9H 4FQ2H 4OF7A 4LP4A 3OJ2C 5FYJE 4X7SL 2VSDA 3BUYB 2W9EH 1V7NL 2XTJE 5D5MB 4QHUA 1FLRH 2CR6A 2HVJA 4M93B 1CK0H 1XF3B 1GC1C 2AV7A 3CFKA 3ARGA 5DA4A 5KSBE 2D7PA 4HFWB 3PABA 3A6OA 2JJVA 2NY5H 1ZVSB 4N0RA 5E2TL 4IOIA 3HG1E 1B0RB 1WFTA 2ADFH 1IM9A 2WP3O 4HWBL 4QRSA 1XGPB 4P46A 2OL3L 4H1LA 1DLHA 1KLGA 2PW2B 2VITA 2Y6SC 3B9KB 3FQNA 1LK3H 2WLZA 5DFVC 4QWWD 1FVEB 3ARBD 1P7KB 4NRXA 3QISA 4ELME 1YPZA 3DGCR 3HPJB 3VD4A 4S2SA 3HI5H 2FIKA 1NGZB 1IQWH 2BRRH 4V2BA 5DDHB 5FCUH 5D7IA 5D2LA 1GGCL 3KS0H 1J1PH 2NQCA 4XNZB 3G5ZA 4PTUB 3O9WB 1V3MA 4Y1AD 3U2SB 2NZIA 4Y5YA 2Y1VA 3QUYD 4R2GB 4NWTL 1AGCA 1CXKA 5EUOF 2HMIC 1HHJA 4X6CA 4XGZA 4BFBD 4MJ5A 5FDWA 2IH1B 2W59A 4L8DB 3VXOB 3G04B 4JRYD 2AABH 3QPXH 1XT5A 4XNXL 4KUCF 4PJBE 3WIFB 7FABH 1OTTC 2RR3A 1BQHG 2Y5TB 3FO0L 2XPGB 1FL6B 2VLKE 1JYWA 3M17A 1UWEL 5L6YH 1S7UB 2NX5A 3S37L 1M7DA 4OCSL 1CICD 4YHNB 3NTCH 5JW5A 2HVKA 4IRJD 3R1GH 4FFVD 4L4JA 1LO0L 5SWZB 2Q3ZA 2BMKB 1DUZA 3MQIA 4KROB 1AGFB 1BF2A 3VFUB 3WS6A 2BXZA 3OR6A 1MJUL 3OXRB 4NO5B 1H3VA 1UKQA 1E4WL 5H94A 4NZRL 1HHIA 2DWDB 3MNZB 3QULA 3ARDA 4H8WL 3MCKB 3HUJB 2B1HL 4Y4FB 4KK5D 1KNOA 5FUOH 1LHZA 4TYUA 1CWVA 2P48B 5DURD 2YSSA 5EO1B 1JNHA 1LO3L 1XR9B 1BZ9A 4WHYG 4L3CA 4BM7A 4HKBB 3P9MB 3DX8B 3UTTD 2VDRH 5T1KD 1IL1B 3IFOB 4G6MH 3PQYA 4I18C 3DVGA 4HIHB 2GYSA 4HWEL 5HYSA 5C2UB 1UB6B 4JFFB 4JY4A 4MQXC 1E4JA 1OGTA 3BP7B 4JY6A 5TE6L 2A6DB 3QQNA 1IM3B 1SEQH 4N8VA 2VLLB 1T4KB 5IF0B 2APVA 4GH7B 5CMAA 4QRQA 5J9PA 1CDBA 1OD7A 4MX7A 3QYCA 1A3QA 1IC7H 1NAMA 5E2JA 1CFNA 3W11D 1MRFH 1JZ5A 1S3KL 5CGMA 3GJFA 1RK1A 2G75A 3RWFA 2WANA 1F5WA 5I1HH 4OZHB 5E8EB 4QXUL 1VFBB 2VZUA 3G6AA 4U1GC 5HHNA 3RKDC 1GPOH 3MV7E 2OI9B 3UYOD 3GJEB 3KPSA 4P23A 3BP5B 2BK8A 1KJMA 4X5WA 2ZCLL 3EDFA 1HH6B 4PV9A 4PP2B 4LSUH 2KUTA 1DFBL 4MA7H 5AWNH 4LP5A 5T1MB 3O6KH 1O7SA 4XNYH 1NFDE 4Z77B 2Q86B 4TSBL 3CMOH 4IDLA 3V0AC 4IDJL 1EHXA 3B6SA 5CZXD 4FG6D 4J8RB 1W0VB 2NXZC 5MEQB 1YMME 4D2NA 4DCQB 3ZT5A 4GBXC 3P9WB 1PEWA 2QQLH 3WUWA 1UJ3A 3C8KB 4Q97A 4PLOB 5F7LB 1NDGA 4QOKD 2VZTA 3I2CL 5IEKA 1A02N 3KXFE 4UBDC 3IF1B 1HE7A 3CLFL 3KS0J 5C07D 4FFZL 2VISB 3FFCA 1T20B 1N2RA 3T8XB 5K59E 3BVNB 3MRFB 2AEPH 5B4MC 5IESH 4FTVB 1O5DT 3MRGB 1QUNA 5F88A 5AG9A 5D96B 2AEQL 1QOKA 4TUKL 3GKZA 3EUUA 2GJZA 4OCRH 4RAHA 4K8RD 1L6XA 4HSQA 3CSPA 2BNRB 4KMTL 2F5BL 1DBJL 5ETUB 1MCDA 4PJCB 5CJQH 3V4PL 2V7NB 3BRFA 5IBUG 2E8YA 2ZSWA 5AZ2L 4Q9QL 1R24B 2PO6C 2NTFB 3C08L 5FUZH 1A7OL 5JOFB 3GM8A 4ODTH 3QWRD 3RNQA 5IJVB 2C3VA 4O4YL 3UZEA 3ZKNC 1OAKH 1YNTB 4MD5A 1QRND 3VXMB 3IVKA 3W0WA 4O02H 2Y06L 2N56A 4LEOA 4I18A 3C60B 5JUEH 3QJHA 4F37K 4P2RD 2YK1L 3CDFA 1JUFB 4UDUB 3U9PH 1A7RH 4MB4A 3LKPB 3SN6N 3GKWH 5EZOL 3ARED 1HQ4A 3D18B 4GRMB 4IJ3B 5J0BA 2VDLH 3RGVB 1XCQB 1ACYH 3MX0A 4U7KA 4UOW1 3SPVA 1IGJA 1Q9LA 1DUYB 3ARFD 1Q38A 2HKFL 5M95B 3BP6B 4PRIE 1BEYH 3KYOB 4QRPA 1RZ7H 3V5HB 4F9LC 1ZT1A 3ZKXC 4WCYL 1RUKH 4K8RH 1BFOA 1IZKA 4G6AD 5DK2B 3SKMB 1BAFL 5BV7C 4LSTH 2I07B 4KJWC 5DJ6A 2LTQB 1NCTA 4WIQA 3TV3L 3UTQB 3AMLA 2Q76A 3AFLA 1R3LB 3OGCA 3HZMB 4AH2A 2IADA 1U42A 3MZTA 4Q9RL 5JDJA 5A16B 3BXNA 3GSWB 5CEZE 4NN5B 3TJEL 4GBXA 2G60H 1AO7E 1SYVB 4LLWB 4NNPL 4WFGD 4KRPB 4HPYH 2O5XH 2HP4A 5D72H 4O00A 2HJLA 4PRPE 4QRTB 5IFHH 4YJZL 3BZDA 3ZTNH 3RUGF 1S8DB 5ID1A 3EZJB 3AMKA 5F1NB 1CL7L 2B5IC 4UU9B 2DLHA 3V7AE 1RJCA 4G8FB 4ESKA 4X8JB 2XN9B 3BPCA 4YZFF 2JTDA 3TBVA 2ATKA 3WNKA 1P7QA 1B2WH 3RU8L 3WXVL 3MO1A 5CP3A 2BVOB 3LD8C 2ADIA 5HGBA 1QFHA 4D9QD 1MJ7L 3IS0X 5D6CA 5I15L 3LS4L 1HZHL 2GW5A 1TENA 1F2QA 3MRBA 4LSQH 4NNXB 1S7RA 5SWSD 1BX2A 3U7YH 3SDAC 1FRGH 1XF5B 5TPWH 1E28B 3UYRH 5F93C 1S7XA 1W72A 4XWOD 5IMKB 2VLJB 3LVEA 5HHVH 2DQTH 3OX8B 4WWKD 5EU4A 4K7PY 3ZTJH 7CGTA 2YD4A 3SCMC 5DMGC 3HC4L 3HLAA 4GAYA 4UZGA 2A77H 1UM6L 1QHPA 1W0YT 4OGXH 5HSFA 3QEGH 4JANB 1UXWA 4KJQD 2IPKA 3U4BL 3TVMA 1XF2A 2ZKHH 3P2TA 1FPTL 2XG4A 1BM3L 5BVPH 4ZUVB 4GKSA 3GJFK 2Y72A 2A1WL 3FL7A 3QQ9D 4BFEA 2XV6B 4POZD 4RMTA 2EYRA 5HTSA 3HR5A 1K5NA 3S9DB 1P53A 1TZHB 2FX9H 1AKJA 4F9LA 4G9DA 3MRQA 3I02B 4S1QH 1C5CH 4UIMA 3PL6A 1NANI 3VG9C 4D0DB 3ZZ1A 1ZLUK 3KG5A 2HLFD 5FGBC 1MNUH 1ITCA 5LAXA 1NEZA 1N3NA 4FQ1H 3V4UL 3QXVA 1KLUA 4HQQH 3QG7L 3TFKC 2MCPL 1IILE 4Y89A 4OGAD 4F7EB 3QPQD 2WLYA 3ILPB 3U46B 2GHWB 2KPNA 1INQB 3WSQH 4WEMB 4G9FA 2AGJL 2EO1A 2FEEI 3MLYH 4HKJB 2IQAB 4Y4KA 4Y4HD 1Z3GH 1R5VA 1W72L 1UM5H 4YE4L 3GFUA 3H9SB 3MRHA 4U1LB 4GQ9L 1IC5L 1T1ZA 1BFVL 4AEHL 3PDOB 1NUFA 5E8OA 1IGIL 1RFDH 1R5IB 2EDOA 2X89D 4G42A 5GGTH 3CVHA 3UPCA 1FNFA 1CTNA 4TVSa 3CFCL 4X6DF 5E6IC 1MOEA 4DVBA 4FQLL 1C7TA 2DM4A 1S9YA 1MCCA 2DQUH 4LBEA 3QIUB 4ZAKC 4KZDH 2VOTA 4PR5A 3CXDL 4MJIA 3CUPA 3GSQA 3E8UH 5DGQA 4G8EA 4POYA 2XKUA 2P8PB 2ESVB 5JA9A 2NY1B 2VDQH 3BPLB 1TZIB 3MRIA 4IEFB 4DGIH 3TN0B 4FA8A 1FV1A 4R26H 1A0QL 5C0BB 3SKNB 4K23H 2J88H 2P5EA 1U58B 1XGQB 3U48A 1M1SA 4MZ3A 1RHHB 3SCMA 1RIHL 3V6ZA 1U3HC 3QAZC 5K9OB 4LPYA 1HKFA 3GSXB 2XZZA 5C86A 5IOPB 3VXRB 1ZLVK 5LVEA 1GGIH 4R0LB 3PNWB 5GISL 1ND0B 4NCDA 2Z35B 1X5IA 1CBVL 4P2CG 5A43C 1WV7T 4F37F 5JQHC 1PYWA 3LZFH 4MNGE 1S7SB 4X7CC 4S1DC 1ZT7B 3MJ8B 3IDYC 4UT7L 4XMLH 5C70A 2CKNA 3DO7A 1U92B 3PV6A 2FIRT 4MS8C 1CXHA 4UIKL 4W4OA 1YPZF 5SWSE 4PV8A 5CBAA 4JFHE 3FZUD 1IRAY 2XTJC 3CFDB 4YDKH 2VXSH 1EMTL 2F74A 2KBGA 5B38A 5BXFA 4XCCH 3MLPA 4J4PD 1PFCA 3OKNB 5D7IF 3KPLA 5D2LF 5F96H 3LEVH 2ZOKB 2Z0BA 3QNZA 1SYSA 5SX4I 3Q5OA 3BGMB 1I85C 3H2WA 4PGCB 1VEPA 4GKOA 3T77B 1CD1B 4RX4A 4X6CF 4ZUSB 5H37G 1LNUB 3BP4A 4YHKH 3S97C 3VXSE 3QXTA 4Y8AA 1Y6NR 4XCFH 4LSSL 2JCCE 1QO3A 2ADJB 3DMMB 2XWBA 1SY6A 2QQKL 4C83B 4JPWL 4CDHA 1ETZA 3PJSB