8FABB

Crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
214
Chain Sequence
AVKLVQAGGGVVQPGRSLRLSCIASGFTFSNYGMHWVRQAPGKGLEWVAVIWYNGSRTYYGDSVKGRFTISRDNSKRTLYMQMNSLRTEDTAVYYCARDPDILTAFSFDYWGQGVLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of murine anti-p-azophenylarsonate Fab 36-71. 1. X-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA HIL FAB (LIGHT CHAIN)
total genus 47
structure length 214
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB01
4UDUA 4X5XB 2P5EA 3PDOA 1QUNA 3WBDA 2IPUK 3BPCA 1ZWIA 5FECB 4AEHH 4EKXA 1B0GB 3TH4T 2Q76B 3I84A 3WXWH 1CDUA 1QSZA 1MUJA 2NY4B 2J8UE 2MCPL 2QR0A 3CU1A 2VABB 4ETQA 2WW8A 2CDEA 4KI5E 5CZVL 4YHOH 5SWQA 1SM3L 5IF0A 1LO5B 1RZJC 3N50A 3U1SL 3Q48A 4PLOB 3MACL 2K3TA 4CMHC 4MAYC 5EU7E 3LH2H 4YDIH 1Q1JL 5J4MA 4Y16B 2XA8H 3MODH 2UYLB 4MNQE 4XVUC 3Q6FB 2MFNA 5H35B 4QWWD 1U92B 2OTWB 3EOYG 3GMOA 4DKDC 2I60H 5E8DH 1A6VH 5GXBB 4C56B 4EOWL 5CJQH 3IU4L 3THMH 1IGTA 1L7IL 5DR5H 3HAEB 1URLA 1T2XA 3B9KB 3WN5C 3HE6D 2ICWA 3C6SB 4O00A 5DUBB 1IQDB 2EH8H 1MCKA 1GXEA 3O4LB 3BP5A 4XPFH 1TFHA 2BZDA 1T6VN 3W82A 4D8PB 1UWEL 1CZ8L 1X5ZA 1QPXA 1OF2A 3O6FA 2F53D 1OAYL 4F57L 2VYRE 5ICXB 2C3GA 4KGJA 1AIFB 3X3GL 5C0BD 2EXYC 1U3YA 1D5BA 4W4OC 5HVWA 1J05B 2YC1B 3O3AA 4XI5D 5ANMA 4J4PC 4RAUA 4XPTL 5F7HA 4O9HL 5CCKH 4ZSOA 4BZ2H 5LQBH 3AS2A 5T5NF 3IXTB 3TCLB 4EXKA 3MV8A 3NZHL 4TQEH 5B38B 3LN5B 3P4MA 4PJEA 4RFEB 2IEPA 2RCSL 4OCXL 4WJ5A 2FJGB 2F54D 4Y2DA 1GZQA 3BXNB 3ZE1F 3JWOH 2GTWA 1X7QA 5LCVH 3MRDA 5CBEB 1DBAL 3P0VL 4FFZH 4G9FA 3DX9B 5DD0L 2HG5A 3OV6A 3V52H 4S1QL 3GMQB 4WI2A 3QO1B 5E2WH 1MAJA 4W81A 1P84J 2A2QT 5JMRA 1UH4A 1KTLA 2GSIB 4OF8A 1OP5H 3LRSB 3HMWL 1BFOA 2EC9U 1NFIA 1I7UB 4ZOBA 1EO8L 4IOIB 4Y5XC 4LPYA 4WGVB 3TP4A 1WIUA 3VXMA 4U0RB 1IZJA 1A3QA 1T3FA 4D0CB 1MHHB 1GIGL 5D9SB 4CADB 3BKYL 1OGAD 1TLKA 1KTDA 3SDDB 2EKSB 5I16B 3E0GA 1OP9A 3J7HA 4WWKB 1LO5A 2P8MA 1YQVH 3RTQB 3PP4H 1PEWA 4JRYD 4Z5RA 5T1DH 3FB6A 4N0UE 3SGKA 3DROB 4IRZL 2Q1EA 4XVSL 3NCFB 4PJHB 3NA9H 1A6ZA 1A6UL 1BD2D 3Q6FA 1F00I 3VXUB 2HH0L 4DJMA 5D1XA 5I18L 2DQHH 2OI9B 5FO8B 5IQ7H 3T77B 1A1OA 5CD3B 1EO7A 3GBMH 3GRWA 1JYVA 3GI9L 3EAKA 5JLZA 3SJVE 3HE7A 3L6FA 4ERSH 1KYOK 1NBZA 3SDAD 2VISA 3WS6A 1BQLH 5E8OA 3VRJA 3FQWB 1FL6A 3EJZD 1CD9B 5KSAB 1EO8H 3L3HB 1CT8B 2C4FT 3C6LB 5I1KH 3M07A 2Q8AL 1FZJB 5ALBL 4LPVA 1AGFB 5ECJE 1FJ1A 3KLHD 1VB9A 1JI2A 4PJ5D 2W9DL 2J12B 4M48L 1DUYA 1A4KA 5F7NC 4AZ8A 4EUPG 4FQIL 3MLXL 3MRHB 1JNLH 1TCRA 2H2PC 4NM4H 3RY6C 3ALPA 3RVXC 2ITCB 3QIUD 1I3GH 5JTWA 1YDPB 2NW2A 1J7VR 4YDVA 2GAZA 4RDQF 3STZB 2HKFL 5JHLH 4J3SA 3I75A 1EJOH 4X80H 5D7JB 3LV3B 3G08B 2P5WE 4OFVA 4U6HB 3S36X 3CGTA 3V6OE 3BEWB 4P4RB 3ARBB 3UTQB 2I07A 4P5KA 1A4JA 4P46B 3RWCA 2HWZH 4Q9BA 2HAZA 1CGYA 1QFHA 4M6NL 4HJJL 4OM0L 1F8TL 1U93B 2DQJH 3PP4L 5FB8A 3U0WH 4MSWA 3KYMB 2ZSWA 3MUHL 5TE7H 2C3HA 3BWUC 3QNXA 1X5FA 3HNSL 1KCRL 5EUKA 2AK4B 1DQQB 1P7QA 3CPLA 3UYOD 4AH2A 1Q8MA 4XPHH 1OHQA 5DC0A 4JQXA 2DQUL 3W0WB 1FL5A 3Q1SH 1VFBB 1S7VB 4DN3H 1MCPH 4JLRB 3TWCL 4JPKH 4Y16D 4HUWA 1A6VL 1J12A 4X8JB 5DEZA 5FK9B 3V5KB 4L29A 1N26A 3VWKB 4OD3L 4BK4A 1BZ9B 3O6LH 3T0WA 5INDB 5F1SA 1VEOA 3FRPA 5EU6A 5TH2A 4QXUL 3NMEA 3S34L 2JIXB 3PWJB 1I7RB 4OQ1A 2FJFB 4OCMC 3F65A 3HNTL 4JFOA 1T5XA 3ME0A 1QLRA 1IC5L 5HDBE 5HI4C 3KLSA 2IFGA 1S7TA 3JUZA 4A2MA 4OLWL 4ODXA 4KVCL 3QNZA 4JQVC 3RL1A 4UBDD 3AREC 4OLUH 1NGPL 1UFUA 4YHKL 4HMCA 1CLOH 3QUZC 5MENE 3IDYC 3CDFA 1BAFH 1KXVC 3T77A 4JRYE 2GEEA 2VXVL 3QH3B 3W39B 3VFRA 2E7LC 4YDKH 4U0QB 2UWEF 4GAJL 3UPRB 3TT1L 1KJMB 1DLHA 1NUDA 2IALA 2VXQL 4PJDA 3I50H 5HYJB 2Y5EA 4M5ZH 4JPVL 3K1DA 3O2WH 3EGSA 2RBLA 5DUBA 1CDJA 3S36H 1NAMH 1NCDL 4WFED 5JW4M 2WUBL 1A6AA 2AJYL 2LABA 2EC9T 1EUTA 4WFGE 4QXTB 4I0CC 2G60H 2AABL 4M7JH 1G9MH 1B0RA 5D71H 5DLML 2VO5A 1JHTB 4ZD3L 4P23A 4F3FB 2WBKA 1NKRA 3ROLA 2EDOA 3LKQB 1JZ4A 4G8IB 4KUCF 4YXHL 1J10A 2BVTA 3DX6B 4JPKL 1PYWB 2VUYA 4NC1E 3CCHA 3KVQA 2XPGB 1S7XB 5JDSA 1B2WH 1R5VB 4YHPA 2EDWA 4OGAC 2CK2A 4PJ8C 2OTWA 4OM1H 3WKMH 1KACB 2WMPA 1FVCA 1R3KA 2DWEA 1TDQA 5KSUB 1UJTA 5BRZE 1BBJB 1YNTA 4G6AD 4JZOB 1BFTA 5JXEC 2PW2A 1CR9H 3BSZH 3IFOB 4ZFFA 4MDIB 1A3RL 4LSSH 2XZZA 3SO3C 1DUZB 4XNZC 3MRMA 5KOMC 1WZ1H 1ZMYA 1CXFA 4QHLA 4HJGB 5B3JE 5JXAH 4TUOA 3VXMB 4JRXE 5SWQB 3G6JF 4WV1A 1IL1B 3S5LG 1LO4H 2P5WB 3VFSA 1EHLL 3RWIB 1K85A 5DZOA 4OCSH 4PP2A 1MCNA 4WWKA 1FC1A 1UT9A 5EU7C 3HG1E 4QNPF 3FQXA 3FT4B 4LPCA 3K8MA 4S1SL 4WTXA 4JG0H 2QADC 3WFEL 5DS8A 1VGEL 3NZ8A 1IFHH 1EHXA 2Q87A 2J8UB 3F7VA 5DD1H 4E5XB 1RSFA 1U58B 4LL9A 2PTUA 1QR1B 3VXRE 2M26A 4DKEH 1QNZH 3O6ML 5D2LE 1PSKH 1NFKA 1JF1A 3MX0A 4KRPD 1XZ0A 2R1WB 3CDGA 3WIFA 4AM0B 4NUGH 1T1XB 1YJDH 3ZDZE 5HYSG 4NHUB 1KN4H 3FN3A 1CDIA 2NY5H 5GSRB 4UQ3B 5IMOA 3WFHA 3NABL 5GJSH 3GSUA 4OF5A 4XNMA 3HG1D 2JF1A 1UWXK 3MRRA 4KQ4H 3GB7A 4NWUL 5HJ3B 2UWEE 3VFTA 1H5BC 1LP9A 5FKAA 4AIZA 1JP5A 3QUXD 5D1QB 4P2RA 2H3NB 3M17A 3FN0H 2LE9A 5L9DH 5GS0H 1QOKA 2BJMH 2G5BB 3GMMB 4YHIA 2G75A 5I1LB 2B1AH 4XAKD 5AYUH 4QRQB 4JDTH 4EDXB 2HYMA 2NZIA 4KRMB 3GMOB 3RVXD 3W9EA 2H2PD 1SVCP 3QFJE 5FYJU 2CJUL 4QNPE 4I4WB 4I9WE 4BUHA 3VXNB 4RGMB 4X4ME 3GDBA 3F62A 3GJEA 4U6XB 2D7OA 1LO3L 1BQHB 1IE5A 5E99L 3ARED 1CFNA 3OB0K 1IILE 1IQDA 4MHHG 3U7YL 5FCUH 1DN0B 2ITDA 2EDYA 3KHQA 3G08A 2VC2L 5E2TL 3D3VD 5DUMH 1TCMA 5K93A 3TM6A 4JZJC 5JHDE 4FFVD 4U1HA 2DTML 4FZ8H 1PSKL 2X10A 1UGNA 5SWSA 5SWZD 2VWEC 1S78D 1JZ6A 1XF4B 4Z77A 2O61A 1AGCB 5DFTA 4IIQA 3V6ZA 3LKNB 1RV6X 3U4AA 1MFAL 3MGTB 5M94B 1WBYB 2HRPL 1MUJB 1S3KH 3B2UD 3SKNA 2N7BA 3CSBA 1AXSB 4LGRB 3KLHC 1UACL 3OXSA 3GSQB 4K3JL 4K9EL 1ZANH 2VDNH 1JPGB 2DB8A 1C08B 4WI9A 1QSFA 4DVRL 1SEBA 3VXPA 5FYLL 3BD5A 3LRGA 4YXLL 4Y8AA 1BVZA 3GNMH 3EOAA 4I0PD 3M1BA 1J0HA 1F97A 3WFCH 3CC5B 1KLUB 3P0GB 2YD2A 1I8IA 1SJHA 2HLAB 4R7NA 1RURH 2VDLH 4Z7VF 3T1FB 1DBJH 3BRFA 3V4VL 2IAMB 3ORJA 2VDKL 2FX8H 1MAMH 4QHKI 4ZFOL 2WP3T 2W0LA 5AUMB 4ZFGL 4FTVE 2DIJA 1YUHA 2O5XL 1JNJA 5TDPB 4P3DB 4JFYB 2FH6A 2JELL 1OTSC 1XIWC 4KK5C 2WWKO 5FM8A 1U8PA 4LCCB 3ZLQC 2C4FU 1NL0H 1NANH 2RHEA 1ZLWH 1VGEH 4YNYA 5HHOE 1FFPA 2R9HD 1S5IH 3D39E 5IF0B 4Z9KB 5I15H 2DI8A 2GTZA 1T04B 2VNCA 3DSFL 2QBWA 1EJ6A 5F9OH 5CGMA 1D6VL 1BFVH 12E8L 1OSPL 3FT3B 2DMCA 5C6TH 3SE4C 3FO1A 2UVFA 5LCVL 5A3IC 3V8CA 3EJJX 1AO7E 3ZO0A 4JGMA 2YD7A 3MFFA 5L6YL 5DJXB 4S10A 5FDYA 3QDMB 3L3DA 1OP5K 2DMKA 4PRPD 2FD6H 1K6QL 4HK3N 5IKCA 5I1IH 2GFBB 3VDBA 1B0RB 4MJIB 1L7TL 1S78C 3ULUD 1NC2B 4M1DL 5E6IB 1Y18B 1SJEB 3O4OB 3L3OB 3ROLB 1ZT7B 1YEKL 3NCYP 4EN3B 4FQLL 1GGIL 2BNQA 3KJ4B 5T1LA 3L3HA 1C1EL 5SX5H 43C9A 1NSNL 4R0LA 1AGEB 3GMQA 3OG6B 4I3GA 5ID0A 4BFGA 1EIBA 1GC1H 2VJXA 4WGWB 3ZKQD 4X4XA 4ONFL 5DD6B 1EEUA 2ZPKL 1SYSB 4TNWF 1KJMA 1R3LA 1YEJH 4JFQB 4LBEA 2IALB 3WV0A 3LKNA 3O3AB 4JO1H 4AIXA 5IVNA 3LD8C 4GBXB 3G04B 4GMSL 4MD0B 4HWEL 5DGQA 4XNYH 3E6HB 2AV1B 3IXTA 2BCKB 2XTJB 4DKAA 2DLHA 3I6GB 2EDEA 4ISVB 3Q0HA 2AKRA 1T5XB 4OZFG 3TBVB 4S1DC 3GI8L 3GFUA 4ZOAA 4YDJB 3U82B 2JE8A 1KIPA 3NIDE 3MLVH 3VD7A 3RWEB 4XCYA 2V7NA 1E4WL 4D9LH 2QHRL 4B7IA 1T03H 2YA0A 5MHSD 43CAB 1EPFA 1NFIB 1JYXA 4XCCH 1MQKL 1X5AA 4UOJA 2VXTL 4KJYA 1P4IL 2DQGH 1WZKA 4NDMB 4ZOEA 3IJYA 1LEKA 3VW3L 1A2YB 1XZ0B 4JPVH 3KPOB 3O3BA 3TO4D 4BZ1H 4PTUB 1FGVH 1CGXA 2EXYD 4NN6C 3G6JB 1KTRL 2ADJA 1T0MB 2E8ZA 2J4WH 4JFZL 1CFBA 2MKLC 4K7PL 2YUWA 4U1GC 4P2QB 1G9MC 5FO9A 1WFUA 2IBZY 4RNRA 2VIRA 1QHOA 3EYUL 5DGRA 4PRHD 4WJ5B 4LOUD 4AEFA 3C2SA 5GRJH 2BNUB 1WK0A 4BUGA 4PGJA 3LSOB 4V2CB 5E8PA 4QOKE 5CGTA 3QDGD 2FATH 4MQXC 5EU4B 3EBAA 5ISZD 1DTUA 4HKXA 4HLZG 3WIHA 1BLNA 1T1ZB 5IB2A 1FNSL 1OD7A 2CSPA 1U6AL 5IHBA 1EXUB 4LKXA 2XA3A 1SJEA 4G7YL 1QKZH 1NUGA 3BHBB 1FIGL 4X9IA 1MCBA 2P4AB 2NX5A 5DK0A 5L88L 3OJDB 1I8KA 2VSDA 4U1NB 3HPLA 4XH2A 1WGOA 4KUCD 4MD5B 3SPVB 1NCNA 5EO9A 5ENWA 4XX1G 2P8LA 3V6OA 1U8OB 1BX2B 4NQCD 1HINH 4PR5B 2ITDB 4U6VH 5KVFH 2WP3O 5KSAA 1OAUH 2EDDA 1EFXB 2DM4A 1U41A 3NIGF 3DYOA 4PRHE 5GHWH 4KKLD 1ZGLP 4IOFC 2VWEE 3GMLB 1UCBH 5BCAA 4L9LC 1BVKA 1KV3A 3BP7A 3MRBA 1QSEA 4P2RD 4M7LT 3MOAH 5J8OA 4TTDC 4JO4L 3RY6A 1XCQA 4NRZB 4QRPB 4Y0GA 4FXGA 1P6AB 1T22A 4ZFGH 4HUVA 4PJ7F 1CTOA 1AJ7H 3QBTB 5D96C 5HSFA 4R4FH 1BP3B 2R1XB 4B53A 4Z0BH 3NPSC 5DVMA 3CFBA 2E9JA 3FRUB 1MCJA 3VFOB 4MVBD 5FYKE 5DJYA 5DVOA 4LLVA 2FR4B 2O5YL 1A22B 1F4HA 3LV3A 5DMGC 4EVNB 3VMPA 3HPJA 3LS5L 5I19H 1ZVSB 3BMWA 3MLPA 3ULSB 1KIPB 2DL9A 3E2HB 3SJVA 3HZVB 3RTQC 1Q0YH 1F3DJ 5DC9B 1IC1A 5F89A 3CZJA 1L0XA 5DRNB 4ERSL 5TGBA 4XP5L 1WJ3A 2NY6C 3SY0B 5BXFB 1G1CA 1AGBA 2KH2B 3REWB 5FUZL 5SX5K 1U42A 2IBBA 3T65B 4PJIA 3O8XD 1QEWB 3S34H 3BP6B 3RGVC 2GJZA 4LVHB 2DBJA 3B2VL 1IAIM 1L0QA 1LO0H 3TNMB 3BDYH 1T21B 2XZCH 3PL6D 5C0IA 1M05B 1AFVH 4MMZC 4KK9D 1F4XH 3FQUA 5EIQA 3H0TB 1LO0L 4RCAA 4XRCA 4NP4L 4PRHA 4OD2B 1FFPB 1MIEL 4LVOC 2R0LL 4NHCH 2H32H 5KSBF 1UWGH 4XCEB 4MVBC 4NO2B 1QLRB 1V05A 1PJ9A 4YBQC 1QSED 4JN1H 3VXPB 4OGXH 5J12C 3C9NB 3IJHB 3EYVB 2YPLE 2C26A 3TVMA 1UWXH 4G6JL 3VGEA 3X13B 1EK3A 4WO4D 3AY4A 3KGRA 4GXVH 3CDGB 5D2NA 4WO4C 4NQCA 4Q6IB 5JOFA 3RDTD 2BRQA 3VE0B 3SDCC 4ESKA 1DZBA 1NGXA 3ILPA 2QHLA 4WU5A 4NQUA 1RZJL 3ROOB 1GOHA 4U1HB 3T3ME 3WNNA 3GB7B 5HJ3A 2XZQL 4NRYB 3QWRD 2LAGB 2I9LB 2V17L 5DJ2A 3DMMC 3ZE2E 4P4KA 1H0DB 1I9JL 4G3YL 3UMTA 1C8PA 5C09D 4QRUA 4L8BB 1OPGL 3VGDA 1FZKA 5DRZA 4PJ9D 3MV7B 4JE4B 2FJHA 2R4SH 5KS9E 4KJWC 3PABB 4LCIL 4N0UA 1BIIB 4N0FB 3GIVA 4X6CB 2HLFC 4JO2L 4F7CA 3QUZD 3GGWA 4MNQA 3Q3GA 5IP4A 2Z4QB 2BOCB 1N2RA 3AGVA 1IAKB 5CJOL 5B38A 3AROA 3O8XC 1A3LL 3MUGA 4ORGB 5CJXC 2DLTA 2CO7B 2JJUA 2H26A 3EDFA 2C3VA 2BOBB 1GHFL 4MXVF 3ZDYE 4OIAA 3WDHA 4JPWL 4GW5A 4RMUA 4UINH 4WNQB 2GTWB 4ODSH 3L7FA 2JJSA 2MSPA 2WQ8A 3AS3A 3F58H 3Q5YA 5EOTA 2X7LA 3BH9B 2VR4A 2C9AA 5EUOA 4R7NB 4UILH 1K4DB 3EJYD 3ULSA 4GFTB 5C0FB 4GKSB 5GRVK 5D93C 3C8HA 2ARJB 5EC1A 3SDXA 4BZ1L 5T1LD 3MO1A 3QXWA 3TF7C 4Y5YC 5D7IF 1GGIH 1EHLH 5TDNB 1X5GA 3LMJH 4P57A 1NKOA 5FYKD 2IADB 3GBLA 1U3HC 4HUUA 2A9NL 3KLAB 3MJ9L 2D7TH 3ULVH 2W0KA 5EIIA 4RSVA 4LCCA 2R23A 5GGRB 5DRWA 1OM3H 4KVNH 2EO1A 2SEBB 4DFHA 4DW2H 3G5VB 3CUPB 5HY9B 1RUPL 3LN4B 3IXAA 3ULVL 1QFWM 1FL3A 4HX1A 4P2CG 4PRPA 4CNIA 3INUL 5TE6L 4QCIB 3ULUH 1L7IH 3VDCA 2WBJC 4HWBA 2E8YA 3C60B 3C5JB 5D5MF 4LFHG 4OLVL 4KJQC 2NY6D 25C8L 4RBPH 1ONQB 2BY0A 1M7XA 4N1HB 4LOUC 1NBQA 5IESL 4LPTA 3AUVA 1RZKL 3QIUC 4OFKA 3ZZ1A 1RUKL 1RZGA 1JTPA 4IMLA 5IESH 1HXYB 5D7LE 4KAQH 3BESR 2J3SA 1ZT7A 4PRIB 4ODHL 3SE3A 4NQCB 1BLNB 5CIPB 2V7NB 4ZFFB 1CDBA 4O2FA 3CMOL 4X6CE 4CN1A 5HPOA 4ONHB 4JFHE 3RPIB 3EJZC 2YPLD 1I9EA 3OGCB 4Z95H 4YGVA 3FCTB 4HWNA 3QI9A 1AGFA 3ZHLA 2R1YA 2D31B 2A9NH 3L9RB 3HC4L 4HHAA 4WHCA 1F3JB 3S37H 5FF6A 1FVDA 3TJHD 5ACZB 5MERA 3DARA 2OJEA 4D0BB 3DSNA 4LEOA 1KIRB 4RZCB 1T2QL 1UZ8B 3MRJB 2DYPB 2EDTA 1EGJL 3W81A 4Z7WE 1T22B 4WW2C 4HUVB 5F7UA 2HT4C 4JCMA 1XF2B 2P8PA 5DYOA 2JJTA 3MRLA 4PJGA 2AI0H 2BXZA 1Q9WA 5E8PB 4FQQA 5EA0H 2IPKA 4HQQH 3P40A 5T1LB 4MLSA 3BKJL 1Z6JT 3VRLF 3P77A 3U2SA 4QHMB 2BHZA 4HFUL 1U93A 3SKOA 3S5LA 4WFHD 4YHZH 3T4AB 2W60B 1KB5B 3GSRA 3UROR 1FNLA 5TF1L 4FQCH 4HIEB 4MJ5A 5ACMA 3QDJD 1RZ8A 4LCWA 4OB5L 5DFVC 1CG9A 4JJ5A 3WIHH 2ICWI 3JV4A 3TV3H 4D3CH 5HYIA 4NQTA 4RMTA 2B2XL 1JZ8A 2M2DA 1YEHL 1EZVY 3HMXA 1FVEB 4U31A 3BGAA 2XRAL 2G75B 4G8GB 4S11A 1K8DB 4I1NB 1QSEB 3ZDZF 2WIIB 3L5HA 3LS4H 4F33B 5EBLB 3WXWL 4O2CA 3O9WC 1FNEA 3HG1B 5L2KB 2V5TA 4XCYB 4H5SA 4HKBA 4RISH 2DBLL 2R2BB 3FQNA 2N7AA 3MLRL 2VLRB 1FO0B 1SY6L 3G5XA 3D9AL 2BNRA 1QBMH 2IPTL 4LIQL 1UEMA 5F7EL 1U92A 2HFEA 5IQ9B 2CRYA 3QHZH 3UYRH 1FZMB 1U95A 5EWIH 1UXSB 2CR3A 3DXAE 1RAMA 3BHBA 2R8SH 3V8OA 1FYTE 1OTUC 2B39A 2VLJA 1XIWA 3IDMB 5DI8A 1NEZA 2JTDA 2GIYA 2IFFH 2C4XA 5J6HB 1YECH 3BN9C 3MROA 4KQ3L 1WBZB 2GHWB 1FAIL 1FE8L 3ZKXB 5CJ8A 1EAPB 4MS8D 5H94B 5I75B 1ZLVH 3IFLH 5HHMB 3TC9A 1A21A 2DQEH 5I71C 2VDPL 4K9EC 2A77L 1QSFB 1CIUA 5EFIA 1N6QL 1F4XL 2ZNXA 1JE6A 1CFSB 1KT2B 4KHTH 3HI5H 3C09C 5IMLB 1AGDB 2OTUA 4C59B 3TIDA 1F45A 5E9DE 3H0TA 3DXAD 1UZ8A 1GOGA 1SMOA 1MHEA 1YMHB 3MRJA 4XTRD 5I18H 3KAAA 5DMIL 5C0BE 3OB8A 5FGCB 2NX5B 5GS0L 5C09E 1INDL 3DLQR 4N90E 3BKML 5I1EL 3MRLB 5ADPL 2F54E 4JY6B 3GMNB 2AEPL 2NY4D 1FSKC 4O9HH 3EYVA 3E3QC 1L6XA 4GS7C 1MJ7L 3IS1X 3OKKA 3WSQH 1G0DA 4P3DA 2X4OA 5CSGA 4M5YH 2Y7QA 5DRNA 5CFHA 4LLYA 3T4AA 1EBAA 3I6KA 4WY7H 4PJDF 1XGPA 3ZDXF 3VXOB 2B1AL 3MRIA 4YNYB 5JR1L 3VRLE 4KRLB 4IRSA 1AHWA 3IF1B 3MBED 4NP4H 3PGFH 3EYSH 3V0AC 4GAYA 3ROOA 3QUYD 1H3PL 4D0CA 1T20B 1JWSB 3DPBA 2Q76A 1CCZA 3DHJA 4X83A 3P11H 1A6PA 4ZMAT 4UDTA 4BFEA 5C0ND 3FQTA 4NNYA 2F8OA 5T1KD 5JQ6L 1TQBB 2PW1A 2HJFA 3I2CL 4YHNB 5I1HL 3MRNB 4LP5A 2X2YA 1Q94B 4GRMB 3TZVC 1X6NA 4PRNB 1GPOH 5F71A 2J88L 3NFNB 3U48A 2D7QA 3T0ED 4UOW1 4Y4FA 2CIIB 4ZODA 5K33A 1OGTB 1RIHH 1JZ3A 5SWSE 4MQTB 3QRGH 1J1PL 4HG4K 5AAMA 5BO1L 4LLQA 1MI5B 3NAAH 3ARGA 4KVNL 3C2AH 4WUUB 4DW2L 2BVUA 4LMQI 5E1HB 4P49A 1FCGA 2FDBP 4XPTH 4EQ2A 3B3IA 2ADFH 3QFDA 5BMFL 4HKZB 2BHYA 2XKNB 2DJ4A 3PNWA 4H20H 4QLRA 4UV4L 1W2KT 2IJ0C 4QWWC 3BISA 1JGLL 5CILL 2Y06L 5F7YC 5C9KA 4K2UH 4BH7A 1RJYB 2KBGA 3OR7A 1RJZB 4FXKB 1EFXA 5DZLA 4KJPD 1DBKL 5E94A 2F5BH 3FCTA 3CX5K 4NWTL 5FO9B 5DHXB 4OSUL 3V5DA 4KV5E 3C9NA 4P2OA 1WAAF 4PJGF 3QJHB 2VAAB 3BVNB 1MFEL 4CNIB 1VHPA 3BZ4B 3VXQA 1TTUA 2IG2L 2B5IC 4PJ5E 2WWMC 2BOBA 3TIEA 5IB2B 1TZIA 4MJIE 5T5NG 4N8VB 1FIGH 3S9DB 4V1DE 1IT9L 1CLZH 1KUMA 5JR1H 3JV6A 3JVGA 3OL2A 4ZG1A 2ERJC 3MRDB 2I9LA 3MXWL 4JHAL 4ELMA 4FTVD 1CVRA 1A47A 1J8HE 3O2WL 4XWOC 2DLGA 5GS0C 3NACH 4GG6A 2LAAA 1CFTA 1DP0A 3GEWB 3CVHA 3ARBD 2AS5M 2P48B 4WV1C 4YFEA 2VLMD 1MRFH 3MNVB 4S0TD 2AEPH 2F15A 2ARJQ 3X17A 5BW7C 5ADPH 4KI1A 1F4AA 1ZHBB 4I48B 4Q9RH 3S36L 4TRPL 4U1SA 3R06A 3RX5A 5T1KA 4YR6B 1IGCH 1M71B 4H88L 4WFFD 1XR9B 3R1GH 1MY7A 3CFBB 4ONOA 2VZOA 1NJ9A 3S3PA 4OCYL 1AP2B 1IAOA 3STLB 4Y16A 5DVKA 3SE9L 2KUTA 2YWZA 4KKAC 2XN9E 4IRSD 4YFDB 4D9LL 4Z7WA 2H1PL 1KC5H 1MELA 4LSDA 2XYCA 3SDAA 1DL7H 1G6RB 3HZYA 2ICWB 1KJ2B 4QXGL 4F7TA 3NFPB 4J8RB 3RJDA 3SCMB 5DEGA 1RUAH 2ICES 3MJ8A 5IGXL 2XACC 4U2YA 2AW2A 4QHMA 5DD5H 1LK2B 1S9XB 3U46A 1PY4A 5CSZB 2EDKA 1CBVH 2PTTB 3ULVF 4AT6B 1VACA 1CU4H 4HS8H 1I8LA 1BFSA 1X6LA 3EFFA 4NZJA 3JZ7A 2JCCA 4IRZH 3WD5H 3MOBH 4D2NA 2QTEA 2CRMA 1A6AB 3CVIH 1MVUA 2YZ8A 1H0DA 5HGGS 2CKBA 5MERB 4NKMB 2ENSA 5DJXA 3ULUF 4Q9QL 1BF8A 1KCUH 4V2BA 4ZS6C 2O5YH 4XWOD 1MH5A 1CFSA 2CH8A 4XAWH 5C0EA 5CP3H 4EI6A 3LEYH 4NKIH 4ODWA 3CVHH 1NC2A 3OKDB 5IUSA 1R6VA 4EXPX 5D5MA 4ZFZA 3BRGC 1CGUA 3CVHL 2LU3A 4GKOA 4OUUA 4MB3A 3MBEB 2WUCL 5JDJA 5L2JB 1I7UA 3WLBA 4Z7WF 3G5YA 5A16B 5FA3B 1ZT1B 2OXGA 2X4PB 3CU7A 4KC3B 2AERT 1TJGL 2VDPH 3GMNA 2AJZB 2I07B 4P5KB 2ZJSH 4XNQA 3JWDC 5HPMA 4XC3H 1BQLL 5CBAB 4U1KB 2CLZB 4KQ3H 4I3SL 3SJVD 3CMGA 4NQDD 1NUNB 2VQUA 4TVPE 3K1KC 1C7TA 4JDZB 1U8NB 2HFFB 1K3ZA 1OSZB 4DZ8B 3STBA 1I8MA 5DF0A 1G7QB 5AAWA 5I1GL 1QBML 4YO0A 4MXQC 5KTEH 1F42A 4LSQH 4JANB 4JB9H 4OFYD 2A6IB 3BGFC 3FB8B 4O5LL 1VESA 2ORBH 2HVKA 4YHYB 3FO2A 1E4KC 5JXAL 1ZE3C 5D70H 2YD3A 4GAGL 2H6PB 4H25A 2XQYG 2F9BT 4GRWB 1JHKL 4LCWD 4K23H 4MJ6A 5C0AE 4GKSA 5JLZB 4J12A 4Z7QE 1RURL 4F7MB 5BOPA 1FZMA 1U95B 1HHKA 2DD8L 3D69A 4WO4B 1IGCL 3T2PA 2MPAH 4NDMA 3FN9A 2OYPA 4M6ML 5GRXG 2Y7QB 1CXEA 1H8NA 4NM8H 5I6XC 2CQVA 2F19L 4K3JH 4QF1A 4QHUA 5GSRA 5HY9A 4C56E 3Q3GB 3JV5A 4ALAH 1S8DA 5L8JB 1HZHL 1MQ8A 2YBRB 3FB5A 4JFFD 1T03L 3BPLC 4GAYB 1BVLA 4CMMA 3OKNA 4YUEL 1E6OL 3BQUB 3PL6B 3UZVB 1UB6A 1G0XA 2R2BA 5MEPB 2A83A 5ILTH 3ZYJA 5DMKB 3KS0J 4E41B 3FB7B 3S35X 4LSVH 3HUJF 4Z76A 3QNYB 4JFXA 3ARBA 4MNGE 4P9HH 4UQ2A 2AJYH 1NCAL 1FFRA 3SE3C 2BNQD 3MCLH 4R0LC 3DI3B 2VMFA 4PJFE 4KPHH 4JREC 5H8DA 4JY6A 2P1YA 5FHBH 3TA3A 3OJMB 1SMAA 4UT7H 1IQWH 2EEDA 3X3GH 1NGWA 2VE6A 3BJLA 4X9HA 1P2CA 5T3XE 2X4OB 3BZFA 2NMSA 1KB9J 4HGWA 2XWJB 4FNLH 1JPFB 4NN7B 1DBKH 2SEBA 3N85L 3GSNB 4UOW0 3V2AR 1HH6A 4Y5XA 5C08A 1KB5A 1B4JH 1ZSDA 1FNGB 4NOBA 5KOVC 1JPST 2R0ZL 4P2OD 2X4NA 1X5HA 3NTCH 4HMEA 1RIUH 4QOKA 5C0GA 4LLWB 1CDCA 1U8QA 3T0EB 4HDIA 2NY1B 5EBMA 3SGJA 5DJCB 2QSCH 2ZSVA 4QXUH 3MODL 5C08D 4JHZA 4QYOB 5IBUG 4Y4HC 1FLRH 4L8DA 3LB6C 4MD4A 2NY3B 1HYSC 1G84A 3FHQA 4TVPD 2FSEB 1ZLUK 4WUKH 1ZA6B 4A6YL 2NXYD 1TIUA 3KPLA 4XBGB 3WHXA 3RX8A 1UJ3A 2HTKD 1OGTA 3HCVB 1S9YA 5D1XC 1NMCC 4YLQT 2GT9B 2X05A 3LRSA 1RFDH 4G5ZL 2IGFH 1TJIH 3HE7C 1J1XH 5D72H 2BRRH 3HE6C 3P3YA 4ZO6A 3RUGF 4X6DE 1NCCL 5GRUH 3TA3D 2HWZL 1SEQL 4UNUA 3OB0H 4E0RB 3RUGE 5EC2A 1AY1L 4LRIC 5F9WB 1ZV5A 3DUUB 3O4LD 2GJ6B 3G9AB 3LN9A 1NSNH 1YEIL 2FHCA 3I6LE 1BD2B 1TNMA 4CVUA 5L0QB 4M7LL 2CXGA 4OM0H 1FNAA 4JGJA 5I1JL 4YWGL 2YD1A 3BZ4A 3SCMC 5I17A 3QXAA 4G9FB 3UDWC 4Z7NF 1YYMH 3OKMA 5JDSB 1FH5H 1RQ5A 4P5TB 4ODUA 1QZ1A 5LXGL 1BM3L 3L3JB 1U36A 3IFLL 3DBXB 4OZFB 1A1OB 3PGDA 1JUFA 4OLXL 1T0NB 1MWAL 1ZTXH 5TDOB 4ZXBA 2XXMB 3JV6B 5CD5D 5HHVH 2VR9A 3B9VA 5IIEA 4XBPA 1R3JA 5DJ0A 3KYAA 3GJFH 2ZCLL 3U9UA 3S4SG 1N5YL 5EORL 4PJXE 2MTPA 2ZSWB 3TVMD 1BEYH 3BPOB 1ITCA 5C07D 4XT1C 3QA3A 3I3BA 1DSFL 4Y4KC 3CPLB 2R0KL 4NRXB 3U83A 2R56H 1GCFA 5F9JB 3OX8A 4F7CB 3RNKB 1QRNB 3MXVH 4JM2D 4I0PA 2NY3C 4JZNA 4ZPTA 4UT6L 3MCKA 3PGFL 4JFPA 1QSFD 4PBWD 1LP9E 5FK9A 1JWMA 1QBBA 1RK0B 5SWZA 3V5KA 5HDOA 2ZOKB 1IC7H 2H8PA 3QZWA 1LEIA 4NKMA 4ZAKC 4PBVC 2A6JB 4DN4H 2YMXL 1BPVA 5FO8A 3L5XH 4FQXB 3KPRE 4KMTL 1KNOB 5DFWH 2ESVE 3HS0A 4XGZA 1JF1B 1BGXH 5E5MA 3AREA 1V7NH 4PG2A 4PJCA 2XWBA 4G9DA 5FB8B 2PO6D 4UUJB 5F7KC 1ORSA 1MFBH 4HH9B 3FOMA 1HCFX 1NC2D 4QXWA 3RY4A 1DCLA 1TITA 4JEGB 5IMOB 4EUPB 1WISA 1KN4L 4NO3B 2Y07H 3DV6A 3VA2C 1VFBA 2CKBL 4OCLC 1CE6A 1VEMA 4LCYB 5FKAB 1NAMA 3VFSB 3LHPH 2OXHA 4HBCL 4FP8L 1IBGL 2YD8A 4OLXH 3EZ8A 2BVEA 3MRHA 3MLWH 5C2BL 3LHPL 3B9DA 3ZT6A 1QO3B 4PJGE 2HJFB 2IMNA 2CK0H 5ABDE 4NO0B 1EERB 3BGFB 5IWLC 5D2NC 2XWTA 2Z92B 3V0WL 5ITFB 1IVLA 1F3DH 5EU5B 1A4JB 4P46A 1JVKA 4WI5A 3MFFB 1DBML 3OKDA 5AYQA 4CVWA 4OZGE 2OM5A 4ODUB 2DQCL 3NFPA 2GI7A 4KXZH 4E41A 4RWYH 1EGJH 2YK1H 1O7VA 3H9HA 1OLLA 1S7SA 3L5XL 3PHOA 5CIPA 3T0DA 5HI3D 4JR9H 4HEME 4KRPC 2BY2A 1FZOA 5JIKA 4HCRL 5ISZE 3E1F1 4NBYB 4UTAH 1NBYA 1XGTB 5HGDB 2NX5D 1IC7L 1VSCA 2G9HA 3TBWB 2QV2A 1VA9A 3PNWB 1MRDL 4Q58C 2IH3B 3DJ9A 4LPWA 1L4IA 2ERJB 3KPTA 4BKLB 2OK0H 4AIZB 3JV0A 4PP1C 3GJFB 2A0LD 5D7SH 3HZKB 3UTOA 3G6AB 5CJXA 3DETC 2VLME 4E9LA 4L4TB 1JGVL 3BP7B 3UBXA 3MRMB 1CLCA 2XI9A 2W9EL 3RNQB 4MMXC 1N59A 1CICA 4BSVB 3UZEA 3QI9D 4PJ7B 4U6VL 5KVFL 1BZ7B 1DL7L 1NMBH 5FYLE 5D8JH 2WLZA 4K7FB 1H8OA 5TF1H 3SBWC 3V6FA 4NZDA 3QDJE 3TO4A 1TETH 2FGWL 1GGUA 1OAZH 1PYWA 2ATPA 5DMKA 3MUJA 1G6RL 1QVOA 4ZFOA 4LPUA 4KK9C 4OCNC 2NCMA 4M61A 5FA4A 5DDHB 1WCBB 2BX5A 2XKUA 3TBSB 3TZVB 4L5FL 3WJLC 1CFQB 5F9WC 2O61B 1EHAA 4UV4H 2JKXA 4U1LB 3HRZA 4KROD 2WINA 2I24N 4YHLL 2QADD 4NO3A 2A73B 5F7DA 1JGEB 3DETD 4X6EB 1U91A 2EE9A 4PRAB 5DJDB 5KVMC 5A2IH 1UXWA 1NAKL 4L4VB 2IF7A 4R96B 5IVZB 5HGBB 4P23B 5DR5L 1MCFA 1KCVL 2Y6SD 5EBLA 2ZOLA 5E5RB 3QEUA 5K9JL 4NQSB 4YEFA 1WZLA 5CS7A 2R0WL 1EX0A 1REIA 3QIWA 4UILL 1RULL 1ADQL 4LSVL 4Z7UB 5B8CC 1HZHH 35C8L 4R6UA 4RNRB 3Q6GL 4N90D 4KKBC 4WHYH 4HC1A 2V7HA 5HHQB 3F7YB 5LAXB 4UINL 3RBGA 2M1KA 3PXJA 1E4WH 1LDPH 4ELME 1MJJA 4JDVB 2W07A 4Q9CA 3IU3A 2MQ3A 5I6XB 5IV2B 3VXNA 1S7SB 1KPUA 1SJVA 1YEFH 3LEXB 3KPMA 3HCVA 2VISB 1FGNH 3CXHK 3QIWD 4U7KA 5I8OL 1EAPA 2ICCA 3VH8B 3QUKA 2ZUTA 5L0QC 1DBJL 4AT6A 4FHBD 2AJZA 3ZYIA 3NPZB 4RWYL 3VJ6A 3P9MA 3LQZB 1UA6L 2VZ3A 1JK8B 1X4YA 4JO1L 1YMME 5E2UH 3CDCA 1A4KB 1KPRA 3L3DB 1MCQA 2H3NA 4U1MB 1X5YA 5EC2B 1NC4A 4ONFH 3B8SA 4HDIB 1U8NA 2HFFA 2MHAA 5EU6D 3D2UD 5ICYB 1CICB 3N1PC 2JB5L 3MJ9H 2VDML 1XCTA 3AAZB 5E6YA 2NR6D 4JREB 1YDPA 3N0PB 4RGNB 2W0FA 4KY1H 5B3NA 2VKWA 4XZUB 4JPIA 4JAMA 4GO6B 3CJJA 3JTSA 2I27N 3MBEA 5HGHA 3OKKB 5MEND 3HUJA 2FR4A 4M48H 2XWJA 2Y07L 2PYFA 3EW3B 4TULH 3EOBB 3VG0H 3MNZA 1JPSH 2J6EH 2JJVA 4P57B 3BPOC 3AS1A 4S1RH 1MREL 5IMKA 2H9GB 4IRJB 4LK4A 4LLMB 5GGUB 3I3EA 3OAUL 3T0EA 4JHWH 1JZ2A 3H9SE 5FV1L 5EOCL 4KU1A 1EVTC 5JOPD 4K71B 1FV1A 5BZWB 1PAMA 4HIXL 2JJWA 3GBNH 5IW6A 2DI9A 2BSRA 4NJ9L 3RPKA 5AYUL 2AKRB 5C86A 3TNMA 5KJRH 1H5BB 5EIVA 3I9GH 3D3VE 1CK0H 5BVJA 3VFWA 5T1DL 4AENB 3D85B 4WHTB 2FX7H 1Y0LA 5EZJA 4WCYH 3P0YL 3QUYA 1XF3B 2VLJD 2F53E 1T80A 1W72B 3W9DA 3IS0X 4YZFE 3UO1L 3OPZL 4PLJC 2MQCA 2R9HC 2IQAA 1INQB 5JW4N 1PLGH 4E41D 1YJDL 3IAPA 1T0NA 2BNRD 4ZXBB 5TDOA 1TTGA 4I8DA 2YPKA 3JWOC 4RFNC 3AREB 1Z0MA 1RI8A 4I3SH 1QNZL 4U49A 3MRKB 2NY2D 3ISWA 4KDTA 5FKPB 4K94L 4AL8H 1H9VA 3S3JA 1U9KA 3MV8D 4W70A 5ANME 5I1KL 1XF5B 3MLYL 1OW0C 2D2OA 4K94H 4AL8L 4BJLA 3NN8A 1FH5L 4FQPA 3PWNA 1IBGH 1HINL 4MYWB 2DL2A 2FHFA 2YZ1A 4JFEB 4F7PB 3UYPA 4CJ1A 2MNUA 5C92A 1OL0A 1UZ6F 5E8EA 3JWOL 4G8FA 1A1NA 4Y4HD 3MCKB 3MV7A 3OAZK 2MHAB 2CJUH 4PRPE 1KCSH 5DTFA 1YEDA 4M6OL 2PF6A 4TNWK 2YRPA 4Q9QH 1FNSH 1E28B 5FCUL 4ODBD 2Z31B 3L3OA 1RZKC 3BPNC 4YX2L 5FYJD 4KRPB 1Z5LB 4PGDA 3TBVA 1BGXL 2FIKB 3FFDB 3GRWH 4M4PA 3CFDB 5JW3H 5FYKU 2DIAA 1W0WB 2X4UB 3MR9A 1IGIH 1RD6A 4FABH 1E0OB 1UJ3B 3RHWK 4X0KB 3QEQB 1PX3A 3WCYA 4ZNEE 5IT2L 1J0YA 1HSBA 1HYRC 2XKSA 3OKLB 3KDMB 4JZNB 4JY5H 1C16A 3BQUA 4Y2DD 5TJWK 3HC0A 1GRWA 3LQAC 1YEEH 4PRHB 3T04D 4L8CB 4CMHB 2AV1A 3I3DA 4PTUA 1IEBA 3WXVH 1LHZA 5B4MC 3WNKA 2CDEB 3VMOA 3I6GA 4CVZA 3WS6C 3DUUA 1UVQB 4F33A 4FG6C 4XAKE 4TTGA 3KPNB 4WI4A 1Q72L 4HV8B 4XVTH 2VR5A 5L8LB 4NC1C 5D1QC 1Q0XH 2EC8A 3DIFB 5C9JB 1NCDH 2ZOLB 2D7MA 5JORA 3K4DA 2BNRB 4ZXBD 1QR1A 4PGEA 3X13A 3RRQA 1B4JL 3SY0A 3QDJA 2F5BL 4R0LB 4HH8A 5ESQA 2ADFL 2GT9A 2FO1A 5CZVH 3MJ8B 3HE6A 5D4QA 4XHQA 3JTTA 4M9PA 1U3HB 2F8VA 2VXVH 4YC2B 4JVWA 4JCLA 4UIMB 3S37L 3WFDH 3ZYOA 3O2DA 3HB3D 1WF5A 1G7MA 1S7UB 5JIHA 3ARYA 1NBZB 5I1JH 5GS2D 3UCRA 5C0CA 1BIHA 1B0GA 1AXTL 4F2MA 1IKFL 4P2OC 2DYPD 4L3CA 2AJ3B 2R29H 2JCCB 3IKCA 4PJIF 1CQKA 1CLZL 5DWUH 4NZUH 1U8JB 4M6OH 1XR8A 4ORZC 4NN7C 4V1DB 1P4LA 3V95A 2EIZA 5E95B 1FG2B 3R4DA 4ETYA 2IBGA 3TPUB 2EIDA 1GHFH 2DQGL 5MEOB 3U6RA 4KROC 1MHEB 1MCWM 1XGRB 1II4E 1RUKH 3KPSB 2A77H 4FMKA 3MLYH 4LARH 3I75B 5D7JA 2A6DB 4P48A 4GW4A 3LKRB 3KJ6H 1A7QL 1FPTL 1GGTA 4XB8A 4U1IA 5J0BA 4M61B 2JELH 3S6CA 3KXFB 4AMKL 2KZ1B 3OKEB 1YNKH 3IJYB 3CLEH 1N5AA 3ABZA 3EFDH 3PIQB 4JY5L 3U0WL 3GIZH 4GKZA 4XP4H 3BMVA 3RIAK 1DLFH 4HSQA 1ED3A 2CUHA 2ICEA 1YPZB 2CLRB 3QQ4B 3OR6A 4W6XB 3QDGE 1BFOB 1TENA 3MGTA 4MA7L 1KLFA 3ALXA 2OTPA 5ADOL 5IEKB 1MFCH 1FFQA 5C8JB 4P2QA 3QXVA 5F7FA 3BZEB 2HLFD 1AHWC 1GSMA 3QXUA 4G43B 1F2QA 4PJ9C 2R29L 3WFCL 4G80A 4YQXL 3UXFA 4OZHA 4OLWH 5I17B 3BEVA 1BZ9A 2ZUWA 5BMFH 1G9NC 4D0DB 1EEQA 4U1MA 3HC3H 3QEUB 2GSGA 2Y23A 4LLVB 3VGHA 4Z8FH 1OGAB 3DI2B 4YE4L 4G6FD 4M3JA 2C1OB 2BC4A 2UYLA 2YN3A 3IFPB 4PG2C 5C0JA 3KYOA 1RZGB 4K3GA 1V7ML 2IAMA 1P5UA 2E7HA 4PJBA 2WNGA 2P7TB 3MRGA 2VRAA 3RVTD 1OY3B 1WWWX 3D69B 4WO4A 3EIFA 1AFVL 2ARWA 1A1MA 4MJ4A 1N6UA 1H3PH 3D39D 4HXBH 1A0QH 5GS1B 4RBPK 4TULL 3QULA 3RIFF 1XGUB 4PRAA 1MWAA 3VWJC 4P59H 1GH7A 2I9TB 1MCDA 3C6LC 2DQHL 3QT2A 3FQRB 5JQ6H 3IT8D 2D03H 3QUXB 2V5SA 5DRXB 1HQRA 4KHXH 1DQDL 1A6UH 2K7QA 3H9SD 5J57B 4LQFH 1ETZB 4RISL 4G6ML 5DJ2B 3U0TA 3TCLA 1RJZA 4OLEA 4XCFL 5T3ZH 4RAUB 2ZOKA 4GG8A 5B8CB 1XR8B 2X1WL 1FSKB 4P46C 5L9DL 4N0UB 4PJGB 1ZOXA 3OSKA 4IMLB 2RJMA 3RVVC 2Y36L 4RFNB 4ZPVB 1MJJB 1CK0L 2J5LB 1I7TA 3DMMD 2DD8H 1JMXA 3BWAB 1HOCA 5CP3A 3B9KC 1CXHA 2PXYA 4YX2H 4HAFA 3OPZH 5DJZA 4U7MA 4HIIB 3UTZB 3MZGB 2GK0A 5KANG 1LVEA 4YGVB 4LSRL 1GGYA 3WEXB 4NO5A 3NIGE 4J23A 4M7KH 5GS0D 2HN7A 5EORH 4U1JA 2CGRH 3FKUS 3TJEL 1XEDA 3MOBL 4S1RL 5E7BA 5E4EC 2FB4L 4H1LA 3G6AA 1DANU 1I1YA 4YH6A 1MJUL 2F58L 4LEOB 1EEYB 1N6VA 2AK1L 4TTDD 3CZFB 1FV1B 5BZWA 1UH2A 2VITA 4JKMA 2HH0H 5DQ9A 2C1PA 1WEJL 3NZHH 4HXBL 1FNEB 3HG1A 1UB5B 4HUWB 1EDQA 4NQDA 2D4DA 4EI5C 5J13B 3AS0A 1X5JA 2WBJA 3NH7H 3VFVB 5C0DB 5EBWB 2DLFL 3CH1A 4LDLB 4WHTA 1XMWA 1S9KC 2VC2H 1KEML 3GSWA 1R24A 2YEZB 3P73A 3WS3A 1CZ8H 3WO4C 5IQ7L 3VXTA 4KK8D 3SDXF 2DICA 5E99H 1NGQL 2PXYD 2R2CA 1AH1A 1DFBH 1VFAA 4KTYA 4Y4FB 3MLRH 4PGZA 2B4CL 3FQWA 3SDAC 2XN9D 4YZFF 1MPAL 4Q9RL 4L8BA 4XPBL 5HXMA 2ILLA 2EDJA 2EYRB 2FX9L 3DRQA 4OZ4B 4WEBH 4WWKD 1F11B 4ZUSB 4BFIB 4LEXH 3KPMB 3FQRA 1EBPA 3V5HB 3OGOE 5IMLA 5ISZA 4NFDA 4JLRA 4APQD 2QHRH 3QDGA 3OKYA 1IRAY 1LO2H 3D85D 3MRCA 1VADB 4TVPH 1AKJA 4L9DA 3TPKA 1C16B 3RI5K 4L3CB 2VQ1A 4X6CF 4AK1A 4F7PA 4P99A 4GG8B 5B8CA 3F8UB 1P1ZB 2NY5L 1DQLL 4CRPA 4L9LB 1VGKB 2F5AL 1UEYA 3VGAC 4DEPC 1A7QH 1JN6B 1HNFA 2FBJH 2OJEB 5IBLD 3RKDC 1T1ZA 4I3RL 4WW2A 1RUAL 1YNLH 4J3TA 1JTTA 4WWID 3HAEH 5D7KE 3AAZA 1HXMA 3MA9L 4POZC 5MEQB 3I02A 1S7WB 4JDVA 5FGBA 3PGCA 1I3RB 5CEYA 3WMSA 3KYKL 3OQ3B 4HIIA 3UTZA 3CCHB 4GAJH 2N4IA 4FQ2L 5IFAH 4ELMF 3UPCA 3VD5A 2G60L 3U2SB 3VA6A 4JY4A 5HPMB 4TQEL 4X0KA 3F5WA 3TLRA 1J1PH 1TZHB 2VXUH 3R1GL 4M43L 3B43A 4UI2A 1UZ6E 3QA3B 5FOBB 3CSGA 5IVZA 5I1AB 1BVKB 4U3CA 1TVDA 1IKFH 3T2NL 3RQ3A 1UM4H 5HYQA 4CKVX 1NUFA 1J18A 1Q72H 4RGND 7FABL 1X5KA 2YA2A 1YMHA 4JM2C 1D9KD 2QEJA 4WTZA 5JW4Q 5KSBB 4JO3L 3WLWC 4YO0B 4I3RH 2Q7YB 4PJEB 3ZMRA 1HDMA 2NTSP 1K5NA 4LIQE 4X7TB 1KFAH 4OFPA 4HLJA 2FD6L 5C71A 3M1BB 3QSKB 1KNOA 1V5JA 4YEEA 5CJQL 5EOCJ 4DGVL 4L1DA 2XZCL 3SQOL 3BGMB 4R4NC 2WAHA 5EO0A 1TZGL 4POYA 4AENA 3P4NB 1I3VA 2GCYA 4TVPL 4O2FB 5GRYA 5CD5C 1D5XA 2PYFB 5D7JD 5DK2B 3UC0L 3IDXH 2R39A 3HNSH 3ARFA 4ZYKB 1RK1A 1PG7W 1QQDA 2R2HA 1YUHB 5E1AA 5LGHH 1BBJA 4L3AA 3JV4B 3LOWA 4I18B 4M6MH 1IM3B 1YEGL 4F9PC 2QL1A 1F3JA 2ZPKH 5F6HJ 3IFNH 1D9KB 4G8GA 1PG7L 5ICYA 1U8IA 1ACZA 4GXUM 2DQDH 5IEKA 3NGBB 1T66D 3GHBL 5LBSL 2VLRD 2OL3H 1GGBL 4HUXB 3I85A 5EFIB 2ESVA 5FM5M 3RWIA 1XF2A 1KN2L 2QQKH 2Z92A 4OFDA 4OZHE 4JJHA 1Y0LB 5EZJB 3U4BH 5GGVH 3IDYB 4HIHB 3ECBB 2OL3A 5CGYC 4R97C 5FYKL 3QO1A 3HRPA 2PUQT 6FABH 3O8XB 4K9EH 3DWTA 1I1RA 3VRIB 3FTGA 4MHHI 1UKQA 4DWHA 4HW6A 4FQ1L 3DX8A 2Y5TA 3AVEA 3PGCB 4HIEA 4MJ5B 1YA5A 2NXYB 3O6FC 2LVCA 2RAMA 2HVJA 1T7YA 1NMBL 4NUJB 1ZT1A 2X4PA 1MIMH 2CGRL 5F8QC 1PQZB 5K59E 4Y5XB 5C08B 2J8OA 2AAVA 4X99A 2EEBA 1G7HB 4PRBB 1AC6A 3K0WA 4HJGA 1OAKH 4RIRB 2VERN 4X5WB 2F74A 3MZTA 1V7NL 1ZHBA 4I48A 4PG9B 4PJAB 1GAFH 1LO3H 4RX4D 3N06B 2RFXA 4U6YB 3K2MC 1CD1A 1BZ7A 1J0IA 5GGSB 2FLRT 1AJ7L 1OSZA 4DZ8A 1M71A 1OTUD 4IOSD 1RZJH 1YEIH 3ZT5A 2DDQH 4NJ9H 3DO7A 1C08A 4OTXL 1INEH 2MCG1 4JR9L 2IQAB 1O0VA 3LVEA 1PX4A 4OCWL 4IDJL 5CLTA 3D18A 3QWOA 1CGSH 4POZD 2OBGA 3REVB 2NXZB 5F88A 2UZIH 1BQHA 1N0LA 4PB0L 1Z3GH 4LGSB 1IGTB 1INDH 1JPSL 2J6EL 2FYYB 3VXTB 3H9ZA 3ARGC 2IC2A 2X1PA 1CL7H 2GK0B 3KLAA 2UUDH 4IRSB 1G7PA 1U8HA 3S35L 2DQTL 1F13A 3MOQA 5EIIB 3DXAA 4JKPH 5EU3A 3MV7D 4ZSOE 1PKQB 3MV9B 4JRYA 1IM3A 4NQDE 4UT6H 1KBGL 4APQC 4Z78A 1MLBB 4HX1B 2DKUA 4K3EL 4HBQA 5KVDH 1ES0B 2ZG2A 3RVUD 1BQSA 3AM8C 3QQNA 3VGGA 3ZKXC 5D7LD 2GK2A 3GSQA 1ACYH 2C3XA 5IFHH 3GHEL 3V4PL 5A40E 1T89C 4OZIB 5LQBL 1MCLA 4MQ7A 1BVLB 1MIML 3X11B 2PO6B 1G7IB 3V52L 4HIJA 1PKOA 5BJTB 3TYFB 1OWWA 1OB1B 1AI1H 1UM5L 5KAQF 1P1ZA 5E08H 5FA3A 2X4UA 2RCSH 3T08A 1I8IB 1YYLH 2Q8BL 3L3JA 5GGTA 4XAWL 1C5BL 2OR8A 2FLBT 5DJZB 3ULVC 3QIBC 2XICA 4I5BB 4WHDA 1ND0A 3JVGC 3ZE2F 4XCFH 1S7RA 4Y4KB 3THML 4Q97A 4PJDB 3HC4H 3TYGL 5BV7H 1T3FB 2MQ0A 1J8HD 2O5ZH 1ZLVK 4IS6A 3VI3E 4L1HA 2Z0BA 5T3ZD 1RJLB 4X7DC 3O45A 1D5ZB 1LK3L 2FEDC 3V6ZB 3QB7C 2EYRA 3K4ZA 2A6KB 2IQ9L 1IT9H 2ED9A 2R0WH 3EUUA 1QD0A 5HHOD 3MLVL 4FXGB 2VAAA 1R5IA 1OAUL 2AJVL 3CX2A 1DEDA 2ZCLH 3MRCB 4HWBH 2I60L 1F2XK 4OZHB 4OFIA 3K7UA 1XGRA 4HPYH 3V9FA 4N0YH 1ZAGA 5HHVL 1KLGB 2Z35A 3WE6B 4DAGL 4YHZL 2E9IA 2QQLH 1OARH 2VZUA 1HDMB 4NYLA 1IGMH 3C08L 2X42A 2BY1A 1FBIH 3P77B 4RMVA 3MYJA 3S5LB 5JHDD 2D7TL 1SYVA 2BNRE 1FGVL 1MF2H 2XWBB 4OZFH 3VMNA 1J8HB 2YD4A 2UUDK 2B4CH 1UKSA 3HR6A 2PW2B 5DJ8A 3RUGA 4M7LH 3VXRA 5ADOH 4GLRH 3D2UA 5CEZE 3RU8H 1I85A 2OP4H 4QTIH 5TFSH 2BSTA 4LAQH 1NGZB 5DD6A 4HULB 1FJ1B 2OCFD 4TSAL 3UPAA 2OX5A 1KB9K 3TO2B 2P8MB 4G80B 5TQ2L 4BQ9A 2AEWA 4MGXA 3GNML 3N1QC 4OF7A 3UTTB 2KZWA 5IROC 3F6LA 5E00B 1T0MA 3WO4B 4J3WA 1IKNA 3T3PF 3OTTA 1CI5A 4DCQA 4Q6IC 4LARL 4BM7A 3SE8L 2AK1H 5D7LB 1JNHA 1VFUA 4U3HA 4UT9H 1JYNA 4ODSL 1MJ8H 4JM4H 4KROB 5F96L 1ZEAH 1HILA 4ZPVA 3OKEA 1DVFB 1Q9OA 4KAQL 5FHAH 1DQTA 5E24E 3TA3B 5HD8D 3TYGH 4LF3A 5DHVA 1ZEAL 4DZBB 1XIWB 4KKCC 5H37G 2Q6WA 2R2EA 5JUEL 1S9XA 4R4BA 1QBLH 5D7IE 2Y5TB 2I9TA 3V4VH 2IQ9H 5BV7C 1JPFA 1YMMB 3ET9F 5GSVB 1KJ3L 3ESUF 3H3BC 1KCRH 1HH6B 4CMMB 5J1TC 1KCVH 1U8OA 3S37X 3I50L 1A8JH 3BIKB 4ELKA 5C0NC 5D1ZC 1B90A 2DKSA 2ADJB 3H2WA 4IIQB 2CUIA 4UTAL 4MD4B 3OAYH 3E6FA 2MCPH 3NFSL 1JFQL 4R3SB 2AVGA 3P30H 1P7QD 3NZ8B 1OGAE 2WWKT 3MJ7A 3WO3B 4C83A 4PGCA 5JO5B 3JWDL 4RAHA 1BREA 4OF3A 1JWMB 3BWAA 4QRPD 1ORQA 1AQDA 3N9GH 4R7DB 3UBXI 5SX4I 2V2XB 2CKBH 1YN7B 1HSAB 5C0RH 1BF2A 2P5EE 4DOHE 3QWQB 3IAQA 1M4KA 2X1XR 4XXCA 5F8RC 1L7TH 4H25B 3ARGD 4G8EB 5ALBH 4UB0L 3HS0B 2AQ3A 4LCUA 5I8CB 1DQQA 1BD2E 1CFQA 1RVFL 2A74A 3MUY1 3QIUA 4QXGH 1A9EB 5HVHB 1FRGL 5ILTL 1MCRA 5FDWB 3CXDL 3RVVD 1NGYB 1S7VA 4Y89A 3L5JA 1MFDL 2XFXA 2JIXD 1CD0A 3HI6H 3BKCH 1WTLA 3C60C 3B6SB 5DA0B 3BP6A 1G7QA 4PJAF 3CXHJ 5GZND 3U7YH 4PJ5A 5E8NB 1AQKH 1K5NB 2WUCH 3FT2B 4EEEA 5HHPB 1JTOA 3LSOA 3MYZA 3HC3L 2IPTH 5ISZB 4KUZH 3SGEI 1TQCC 4I4WA 1Z2KA 3FB8A 3QI9C 2APBA 5I30H 4NNPH 4M7KL 3I9GL 1AD0B 4HCRH 1FN4A 2R4RL 4JFFB 5HGAB 4Z7VA 5I19L 2VL5B 5SWZE 2CIIA 5DJ6B 4PREA 4OLYH 4Y4KD 5IMMA 5HDLA 3RDTA 3QDJB 1MI5D 5CMAB 3DBXA 3SPVA 1A6TA 5JZ7C 4MJIA 1JNLL 3PGDB 1T7VA 1RUMH 3EHBD 3TVMB 2DQIH 3MMEB 5DK0B 4GSDL 3HE7D 2VOTA 3UJJH 4JHWL 3B3IB 2FBOJ 3DVFA 4J4PA 5MI0C 4E0RA 3PQYB 4LDOB 4XTRC 4EN3D 2YXFA 2JJTC 3PHOB 5T1MB 4JDZA 4FQCL 4NUJA 1XFPA 1X44A 3MRBB 4B5EA 4LHQB 5DD5L 1ZANL 4IOFD 3RNKA 3V5HA 2ZUSA 3L5IA 5DQ9B 2GTZB 1BD2A 1PKQE 3MV9E 4JFDA 1OWRM 3BJ91 4LMQE 5C0IB 3V79C 4RIRA 3PL6A 3FQUB 4PJAA 1XCQB 1F6AB 2PNDA 4NRZA 4QRTB 3RWHA 2V5MA 1NCBH 2I25N 2R69H 3BYTA 5GRJL 5JNYB 3ZT7A 3L3GB 3QDAA 4JG0L 3WFEH 2FWOA 4F9LC 3VXMD 1YY9C 3AB0C 5KZCB 3MCG1 3QHZL 5C07B 5KVGL 3G04A 4MD0A 3UO1H 3DVIA 3QAZB 2BOCA 4Z6AT 4YHMH 2A6JA 2EDXA 5DS8B 7CGTA 2X40A 2PO6A 5F89B 4WCYL 5CJ5A 1J0JA 1FFOA 5ESVA 4HLZH 4NNPL 5TGBB 2HVJB 1K2DB 2VXQH 4LSPH 1KN2H 1ITBB 1A9BA 2YMXH 2Z8SA 4OTXH 1I7ZB 3PWPD 1V3MA 3A6OA 2XRAH 4MDIA 5FUCC 1QRNE 2YHGA 1QR4A 1TJHL 4MX7A 1VKXB 1C5DB 2F74B 3P4OA 3NCYS 1QTYT 5I1AA 2YD5A 5FO7A 3Q5OA 1GIGH 2X1QA 4S2SA 3SOBL 1BBDH 4JM2A 4DGVH 5HTSA 4WUKL 5LGJA 4XI5C 4YDLB 4JVUA 3PDDA 2Y4SA 1GPOL 3ARXA 4X6DA 3VG0L 3O6FD 4UB0H 4JM4L 4YAQA 3B5TA 3R8QA 2XY2A 1T1WB 4C4KT 3ULUE 2GSGB 3IDJA 1R5WA 4OGYL 4OZHF 5HGBA 5F1NA 2PKDA 1BJ1H 2HT3C 2ED7A 4K8RD 5GGTL 5TPWH 5CEZD 4K8RC 5H2BA 1EMTL 1PG7X 5F6IC 4AMKH 4GW5B 5TQ0L 3KPLB 4XBGA 4NQSA 3WHXB 3T2QA 1WSST 1I4FB 2DQUH 1SM3H 3NFSH 5D7IB 5IBTL 2A9MH 2WUBH 3VE0A 5FYKH 1YY9D 2AJSL 4AY0A 5TE7L 2XZAH 4NCC2 3D25A 4P2QE 5IR1A 1JUFB 1NEZB 1LE5A 5D1QD 2P5EB 4JRXA 5SWSB 5C6WH 1B0WA 3MRKA 3SE4A 5J56B 2ICWJ 1UM4L 2NW3B 5C70A 2FJHB 1FL6B 1HQRB 4OZIE 2P8LB 5IB3B 2EXWC 4OM1L 3WKML 4NC2B 4FXLA 1M7DB 2ADGB 4LNVA 3O4LA 4XMLH 2Z8WC 1CYGA 4MCZA 4W4OA 4YIQB 1YZZA 2JB6A 1OB1A 2C5DC 3JUYA 3QR2A 1DJSA 2EYTB 4JPWH 4PG9A 4YUEH 4ZFOB 4DK6A 2H26B 1XGQA 5EN2B 1NH6A 1QSFE 5K9QI 1KIRA 3D3VB 1N6QH 1T1YA 2H45A 1XH3A 2CDFB 4OGZA 2YUXA 4DAGH 4O2EA 4FS0A 2YKLL 43CAA 3K74B 2AK4D 4JQXC 2YOCA 4WDIA 1FFNA 5IM7B 5DD3H 2FBJL 3UTQA 4FQJL 5I8EB 4ZUVB 3O0RH 3TBWA 4XZUA 4Z7QF 1C7SA 1VERA 3DMMB 4C56A 2AJUH 3TZVA 1BBDL 5AG9A 3PWLB 1IGFL 1BX2A 3O11A 2NR6C 4MDJB 4NT6B 4P3WA 4HF5L 4U1KA 2VDKH 1MCOH 4I2XE 1MRDH 4U1LA 4IRJC 4XPHL 4JRWA 3VXOA 3UAJD 3IDGA 2B1HL 5SV3A 4OSUH 3LKPB 2QSTA 3RU8L 3CFEA 3S3SA 4S2SB 1KOAA 4D8PA 2LV4A 2RB8A 4D9RD 2E5EA 4R8WL 5LKNA 4K7FA 4P9HC 2X70B 4YK4B 3PP3K 3FO1B 2GYSA 2O5XH 2E27H 2WV3A 2GY5A 1LNUB 1E4XL 5C0DA 4MA1B 2FIRT 3VI4E 3DVGB 1IC4H 2VZ1A 4RZCA 4LKCA 3TCXA 2LFGA 2ZCHH 4ZS7L 1BZQK 4HT1H 2WZPD 1ZLUH 2YUZA 4PRNA 2ATKB 5EPMA 1T5WA 1WC7A 2Z9TA 1RHHB 2VDQL 3OJDA 1MHPL 5BVJB 4FOMA 4XB7A 5ITFA 4GAFB 1FO0L 3WIIL 5D8JL 3BO8A 5ENWB 4YHYC 2HP4A 2NPLX 5B22A 3QO0B 2P5ED 3VXSD 5AUMA 1WFOA 4KMLB 4GRLA 2Y72A 2BVPB 5DHVH 2BP3A 1CGWA 3CSYA 4Y7MA 4D9QE 1CGVA 5GJTH 4Z18A 1QP1A 3D25B 3O6FB 3VXUD 1I9IH 2P42B 1EUUA 1CE6B 4LCYA 5I8CA 4UTBH 3SDCB 3D39B 2FZ3B 2EIBA 3QI9B 5A2FA 2RIKA 1HHJA 3NA9L 2PN5A 1CD1B 2AI0L 4DOHB 4RGNE 3TN0B 4IS6B 4PGBA 4KKCD 5F3HB 1KTDB 3SDDA 1NEZG 5HD8C 4KRNA 3DO7B 2Z8RA 3VFNB 1P5VA 2JB5H 4MNQD 2XWTB 4BH8B 1KXQE 4NM8L 1ULVA 1Z3GL 1S9WB 2DBLH 5FGCE 2L7JA 5CCKL 4PUBH 4OV5B 4HKJA 5IB1B 2Y1VA 3LKQA 1XF1A 4NWUH 5IB4A 1MAML 3TIDB 1CDGA 4GSDH 1QLFB 3D1MC 5C7XL 3D3VA 4P4KD 3LEVL 3UJTL 1AD0A 1WIPA 2GSIA 5E56A 1RJCA 3U4EA 1KGCE 1A6WH 5I0DA 1YN6B 3FONB 2HFEB 1TPXC 4ZQKA 2CDGA 4LHUD 1WT5C 2AJXH 4C58B 4ZUTA 4G6AC 4G8EA 4H8WC 2XY1A 3KYNB 4M4RA 4TNVF 3WIHL 3IU4H 1RPQA 4EOWH 1L6ZA 4OFYA 1IAII 2J6EA 3QP3A 4Z78B 1KPRB 5FYLH 1BQUA 2MMXA 2VB5A 1IGJB 5H94A 4RAVB 3L3KA 3SQBA 3EDKA 3CFEB 3MV11 4HIXH 2Y25A 2V2TA 2KKQA 2NY6B 3GMPA 4U33A 4OZIA 2ZCHL 5CEZL 1N0XH 3DURA 1A7OH 4H1LH 3RWDB 3IDIB 3E8UH 4XP5H 5C09B 5KS9F 2C7UA 3FQNB 4XVSH 1F58L 1T7ZA 5C0BB 1QFOA 3V6FB 5EOQL 4PJAE 1FO0H 3ES6B 1JJUA 1ZHLB 1KLGA 2V2XA 1NCTA 5TQ2H 5DSCA 3BUTA 5IQ9A 3VCLB 3H9HB 4PJ7E 3ZSTA 2FJFA 3EO0A 3T8XA 3UYRL 1OM3L 4HAGA 3QIWB 4HFUH 4QGYA 3C8KB 5EZOH 2GITA 4CJ0A 3ARUA 3MROB 2B8OT 4YFLI 2YXMA 3X3FL 5LBSH 4XMKL 4ODTL 4LF3B 3EYFA 1D5ZA 3GK8L 4KXZI 3V0VA 1K8IB 1PFCA 3O3UN 1JGEA 1I7ZA 4I9WD 3EDDA 4RGOL 4GG6E 1QFWI 4KK8C 2EDNA 3QUXA 1S7UA 1BJ1J 1NDGA 3EDEA 3QRFM 4XP4L 5L2KD 3G5ZA 2E9WA 4WI6A 2DTSA 1LDPL 3TV3L 4D3CL 5I73C 1MSPA 2D31A 1PD6A 1CQYA 1CF8H 3FO0L 1FDLL 2GAZB 5FAAA 3ARWA 3FAWA 3LKOA 3ZTJH 4PJFF 1NEUA 1HK6A 4NSKA 3Q5TA 5CINH 2CR6A 2EIZB 1BJMA 2XTLA 4GT7A 2CLVB 1A7NH 4HWEH 3GSNL 3BX7C 2Z31A 5HHXH 2HJKB 1GZPB 3RWGA 1G7JA 2IANA 5C07E 3MNWA 4P5MB 3JTSB 3EYUH 4WEMB 1P7QB 3G5YB 4X4YA 5A16A 2OL3L 4F7EB 4CBPA 1G9ML 4FQHA 4I77H 1B88A 2AJSH 3ZDYF 4NWTH 3VWJD 3CLFH 3LKRA 3MLZH 1TNNA 3RGHA 4X6EA 1XGPB 1J86A 1E4KA 3GM0A 4JFDB 1J0KA 4KKLC 1MPAH 2Y06H 4P23D 3GMLA 4XMKH 4HZLA 4NT6A 3D0VB 2NY4C 3QEHA 5MHSE 2AQ1A 3X12A 1WIOA 2XNAA 2CMRH 3N1MC 3QIBD 5KW9L 3PWUB 1MQKH 5C3LD 3CZFA 4JQIL 4FG6D 1FVEA 1S5HB 5B4MD 3DIFA 2FGWH 2GKIA 1NDMB 3HLAA 4N0YL 3MRPB 4MAYB 3KPPA 1NPUA 4PJBF 2W0FB 1J11A 1KPVA 3NACL 2F5AH 2OR7A 3CLEL 1X5XA 3RVWC 5CBEA 1LD9A 1EMTH 4Z5RB 4WUUE 2HG5B 2HLAA 5HHNB 1KPUB 3BRDA 1U3HA 3VFRB 4MJ6B 1FN4B 4Z7VB 2BFVH 2XPGA 3OKOA 5CEZH 5C0AD 5D5ME 4L4VE 5B38G 4LCCC 1DVFC 5IM7A 3FO0H 4GW1A 1MJUH 2F58H 4FABL 4OD1L 3BE1L 1CVSC 1M7IB 3ARBC 1A6TB 1OT1A 3KPSD 4Y1AD 25C8H 3VJ6B 3WDIA 3MSPA 4HJJH 4M6NH 4DKFL 5BZDB 3JBG7 3EYFB 3VWKC 3IDMA 5DVNA 3KR3H 4OLZL 4XMPL 2UY7A 4LHUG 5ANMB 3V4UH 3TA3C 4L3EA 3RIFK 4IDJH 3RZCA 2DJSA 4QF1B 1IEBB 3IVKB 2VXUL 4M43H 2HMIC 4LEXL 5D6CB 4G6KH 3IDGB 3QJFB 1M7DA 1GC1L 3KPNA 2X4QB 4MNHB 1NDGB 5E2VH 3OF6D 3M8OH 1KCKA 4WI3A 2VQ1B 4D9QD 3FMGL 4HK0B 4PRDA 3WHE1 3F12A 3QPXH 4KZDH 2XZQH 1WITA 2C3VB 4P2RB 2D0HA 4KHTL 4R7DA 4QRSA 2ADIB 3WUWB 3MA7A 3BUYA 1HSAA 4CU7A 1G1YA 3GUTA 5IOPA 4KK6C 4U6TA 3ESVF 4L8SB 4NOFA 4UAOC 5D2NB 4U05A 5I1GH 4YC2C 4OKVA 1W0VB 4R4ND 4EBQL 4MA8L 3ZE0F 3EO1B 4OV5A 3MLWL 1T66C 1N5YH 5T33L 4L4JA 4KVCH 2FNBA 5DI8B 3MLXH 1HOCB 2F54B 3BAEL 3BDYL 5JMOC 5M95B 4GQ9L 5C08E 2Q86B 2GY7B 3BYYA 4PS4L 4UZGA 3V0WH 2GUOA 3O11B 4W6WB 3WLBB 4MQXD 3WL9B 4DGIL 3LCYA 4FFYH 1IGYA 2FCBA 3CFKB 1E4XI 1S9VA 2XTJD 1AE6L 1S7QA 3RX7A 1QSVA 3WFHB 3UBXB 1G9EA 4YR6A 1ZA3A 5LVEA 2G2RA 1RUQL 4PP2B 4F9LA 4H1LB 2BK8A 1MCPL 2DOCA 3R0MA 4G8FB 4RAVA 2WLYA 1DBBH 4U0RC 3ARSA 1D5MB 5DHYA 2C1OA 3GHBH 1CWVA 4ENED 1MCSA 1H3VA 3SGKC 3RDTB 1OT2A 3IDIA 4GMTH 3ULUC 4RQQA 2N1KA 1Z9LA 3CK0H 2HFGL 3UP1A 1F8TH 2DQJL 1I1AB 4YDJA 4L3ED 5FEBA 2FX7L 4QT5B 3RWCB 3ZKMD 1MEXH 2W9LA 3DUHA 3PV6B 2NYYD 3ZKMC 1EZVX 1LK2A 2ZCKH 1SJHB 1UG9A 3TESA 2OI9C 4FA8A 3SCMA 2YS4A 4G5ZH 4NN6B 4P59L 1LDSA 4EZMA 1VFAB 4MX7B 1VKXA 5I73B 4JFDE 3HAEG 1MIEH 3H7BA 3AM8A 4NUGL 2PTTA 1QFPA 3PHQA 4TSBH 1DR9A 4R2GB 1UXWB 1YNKL 3BEVB 2CIKB 1J88A 1FRGH 3MOAL 2VLKA 5F93C 5A3ID 1U8IB 1OGAA 2YKLH 6CGTA 5E00A 3H7LA 3GMPB 3OR7B 1T5WB 1WC7B 1R5WB 2VDOL 5I71B 1E28A 3BKJH 4FFVC 1JRHL 4JN2B 3ZHDA 1V3LA 1XIWD 3GI9H 4KK5D 3CC5A 3U30C 4F8QA 8CGTA 1FG2A 3M45A 3KXFE 1DN0A 1PLGL 1OQXA 5SWSD 2DQDL 5IKCB 1QKZL 4Q7DA 5D7JC 4G8IA 2YRZA 3QULB 5D6DC 2EH8L 4NO5B 4LLQB 4GOSA 1YC8A 3QEQA 2EYSB 4G9FD 1MCWW 4U1JB 4ZQKB 2OQJB 5IHUL 1AC0A 3IFNL 1N4XH 3MC0A 2PYEB 1OCWH 2F54A 2NY2C 1A7RL 1AGCA 1G7MB 4GRWH 4R90L 1A7BA 2IAND 4XBPB 4ZS6D 1NGWB 2VE6B 2EZ0D 5C0CB 4KQ4L 4XPAL 1NLBH 1GGBH 2VL4A 5HHME 3T2OA 4M8QB 3JXAA 2V6HA 1B9ZA 2C1PB 4NZTL 2PW1B 4KH2A 2D3VA 1QRNA 4NN5C 1MFDH 2WIIA 1LGVA 2F53A 4K8RH 3U9PH 3F6IA 4R9HA 1DQLH 1SEQH 4OB5H 4RA3A 1R24B 1VPOH 1WWAX 3RL1B 2VLKE 1V3JA 1T1YB 1RZFH 1LEIB 5EBGA 4H0IA 4UQ2B 5D7IA 5ETUB 3BDBA 5JPNB 3A6BH 1QBAA 3C8KA 4B0MM 5DD0H 3GSRB 4LVEA 5F44A 1I85C 1HHKB 2B4CC 4MDJA 4IHOB 4OZ4A 3ZKNC 4YQXH 2P7TA 2AV7A 3O3DA 3OKOB 3ZYZA 5IB3A 4U4BA 4F7EA 2AEQL 2X89A 1RJYA 3QUMA 4YBLB 5C0AB 4UU9B 4PLJD 3QCTH 2AEQH 4LNRB 4N5ED 4N8PA 5CLWA 1KEGH 4PJDE 5KZCD 3QRGL 3NGBC 3SKJL 2HMID 4AEHL 1JRHH 3LMJL 1VGKA 3X12B 3MXWH 2VZSA 1KENL 2Y6SC 3TIEB 4D0DA 2OR9L 5AWNH 1Q0XL 5JXED 2YPLA 2VQTA 4P9HL 4PD4K 2VXTH 2VDNL 4OZIF 4ISVA 4LCIH 5K9KB 2W65A 3QNYA 4JFXB 4PY7A 3GM8A 4HK0A 4PRDB 3QZWG 4ACPA 1OAZL 2WBWB 1TQCB 1EAJA 3B9KD 3ILQC 4MZ2A 2A0LC 3KS0H 3D87B 1VCAA 4P4KC 2X41A 3QXAB 4PJ8A 4P5TA 5HDQL 1H3XA 2J5LC 3QFJA 4NKDB 3WJJC 5JPMA 2OQJA 5CINL 4OKVB 2G5RA 4FQHB 2PYEA 1XGTA 2IBZX 5MENB 1RIVH 3F5WB 4WY7L 1YEEL 3VDAA 4XP1H 3V7MA 1VADA 1DE4B 3CIQA 3KYNA 4O51B 3QEHB 2CLZA 3BW9A 4C57C 5E4EB 4LLWA 3DVGA 3D48R 1D3CA 3RWFB 1EJOL 4X80L 4OZGF 3QJFA 1CIDA 5DEFA 4YBHA 4TPRH 4YGAB 1ZA6A 4PRIE 4Y19A 1Q94A 4GRMA 1C5BH 4XX1E 4ZO7A 4CVXA 4EI5A 2E6PA 3KPPB 4ZDHB 4G7VH 4HBCH 1JV5B 4L5FH 4YXLH 2N56A 4P3CL 4JVPA 5CWSB 5KTEL 4PTTB 4PP1D 2B7DT 1WAAE 3W5NA 3KPQA 5DK2A 4CGTA 2YSSA 2H8PB 1KJ2L 1HEZA 1IM9D 2BSSA 2Z91A 5GGQL 3MJ9A 4QTHB 1AQKL 2GCYB 4UBDC 5F97E 3HPJB 3MR9B 3EO0B 3T8XB 1TZHA 5EC1B 5I8KH 3QIWC 1ZKAA 5C6PB 4GQ9H 1QFUH 5CEXA 5B21A 3HAEA 2NY0C 5I74C 1PY9A 3HFML 1MREH 1O7SA 4HH9A 1LE9B 3LD8B 1JPTH 3MLUL 5ALCL 4PR5A 1CGSL 5J06A 3K81A 2GJ6A 3BDXA 3SDXE 5J1AA 3QUZA 5DMGD 2DWDA 5A43C 1NLDL 1UQSB 4PJXB 1CXKA 3V0VB 4BH7B 2R4SL 1INEL 3ARRA 4NNYB 1GVIA 4UNTA 1CL7L 4OCYH 5IW3A 4PRPB 5J89A 5C09A 5F9AC 3TN0C 2X6MA 1S8DB 3RDTC 2H32A 1HIML 2O5ZL 3TN0D 3HB3C 2E6QA 2UZIL 5D5MB 1IAMA 3CH1B 4NCC1 1ONQA 2PXYB 5MEPA 2ADIA 3WUWA 2VDRH 4PY7B 1IKNC 1YMMD 1GZQB 3BXNA 2D4FA 1M6OA 3GSOA 5EU5A 2DDQL 3HZMB 4DTGL 1BECA 1MCIA 5BOZG 1FC2D 4NZRH 5B39G 5TDPA 2VXSH 3CAFA 1XF4A 1MCEA 4UTBL 4HKZA 1QA9A 4R2GC 3VH8A 1ACYL 1CTNA 4EBQH 1DSFH 2V2TB 4IIQC 3MPCA 3QUMH 4M02A 3WFBH 2Y9RT 1OF2B 1YY8A 1HKFA 3I6LD 5GPRA 4K3EH 4X4XB 3SN6N 5CAYB 5IW1B 5FM4A 5BQ7B 1F3RB 2IFFL 1R3LB 4P2OB 4I0PB 5HVGB 1GGCL 4M8QA 1QYGL 2PO6C 4XRCB 4MA3B 5MEOA 3O8XA 3U30B 1JI1A 5GGQH 1ZVSA 4O58L 5E70A 4N8VA 5E0QA 4PGCB 3D9AH 4F7MA 1DEEB 3PQYD 4K2UL 3KPRB 5FIEA 1Q9WB 4MAYA 2J8UF 1EFQA 2OMNA 3ARDA 4M9OA 1YEGH 4ZO9A 3FZUC 1WWCA 2FEDD 2FO4B 4M5ZL 3QWOB 3IRZA 4H20L 4N8CL 1PGRB 4PJEE 3KXFA 1A14H 3LS5H 1OQOA 4TPRL 1JFQH 3RGVB 4K3DL 2D0FA 3IDNA 1I1AD 4LCUB 1G7HA 4PRBA 5IG7A 5TE4L 4RA0C 1LQSR 1H8SA 4HS3A 3UAJC 5CEXB 4AG4L 4P2RE 2FECL 3ZL4H 3BKYH 3VH8G 2EZ0C 2ZUQC 5E8OB 4XVJL 4PLKC 4XP6L 2ENYA 4KI5F 9CGTA 2BRRL 4KMQA 3VXRB 4XVTL 5GGTH 1D6EB 5DRWB 1LILA 4HS6A 4N0FA 1NGZA 5J12B 3RI5F 2GFBA 2G5BA 3GMMA 4YHIB 3V7AE 5T3XD 4L8DB 2J2ZA 5KSAD 4DGYL 2CLVA 4XNXL 5ESAA 2O93L 4KDVA 3LDBC 2QQQA 3REVA 1T0PB 4Y2OA 3VFUB 2HJKA 1OW0A 4HUXA 1C5CL 1RHHA 5IB5B 3DROA 5IVXA 4JHAH 4X5LA 3T3MF 1E27B 3DGGA 1YEJL 4HD9A 5DJ6A 3U7WH 1NFDF 1HN1A 5KVEL 5DO2D 2AABH 3GKWH 1KGCD 1S9YB 5EUOB 3UTPE 3N85H 4J7RA 2Z93A 1KF9B 1I75A 3CLFL 3MLZL 3PWPA 2LTQB 1A7PH 3HUJE 3PHQB 5DMJB 1MWAB 2X9XA 1IGIL 3DUSB 3U46B 4YHLH 3GJFA 3MUZ1 3SKJH 1RIUL 2PR4H 5BV7L 5FECA 1JL8A 1MJ7H 2XNAB 3OJVC 3KPOA 3C09B 3D0LA 5DFVD 3RKPA 2VSCA 1WVZA 3MCLL 4OI9A 4UIKH 2NQCA 3QUKB 2HKFH 3SKNB 4LASL 4MXWL 5IJVA 4W68A 2AXFB 2X09A 4UIKL 4J3UA 3QCVL 1PVHA 4QCIA 5J11B 5HVFB 2OTUB 3QCUL 4IRJD 4J3OC 4PJ7A 3EOAB 3HNVH 1VEPA 4QRSB 2X7LB 3BH9A 3BH8A 1I7RA 1H15A 4OGYH 5FXCH 1OARL 2QQLL 2A9ML 3K3QA 4BQCA 3KNBA 4PY8I 5I74B 2NY2B 4UDUB 4Z7VE 3QNZB 5JPNA 3VXME 2ZKHL 1GJIA 2FO4A 2RQ8A 3U7WL 4Y5VB 3VI4F 1WCBA 3TBSA 4XGZB 3SJVB 3IGAA 1RJLA 3E2HC 1YN7A 5L8KB 1YJDC 3QEGL 4XNXH 4QEGA 5F9OL 4YHOL 3ALWA 4ZD3H 4NJAH 1ZLWK 5FCSH 3PQYE 5EWIL 3RVWD 4L4VA 1S9VB 4K23L 5D1ZB 1EEYA 1NMCB 1B6DA 1NL0L 2F19H 1U91B 4XCNB 4OD3H 1RZ8B 1SY6H 4QRRD 2VIRB 3VFPB 4LNRA 3UTTA 3DVNA 5HYJD 5DO2C 3MTRA 3LDBB 5LWYH 1HE7A 4KTDL 1MRCH 3AXLA 4ZSOB 1HIMH 3S97C 3BUYB 1UM6L 3MRNA 2DI7A 4NQXA 1MNUH 1A5FH 1WUNT 4MAUH 3GBNL 2R0LH 4NHCL 2MJWA 4PRIA 2YUVA 3RHWF 3X11A 3KYKH 1CLOL 1FYTA 2B2XH 2EDRA 4ODXB 4WW2F 4IBLT 3PV7A 4MD5A 4MNGA 5F88B 2X4RA 4M1CD 5INCA 5AD0A 3OAYK 3C6SA 5GZNC 1K4CA 5KSBE 4PBXA 3RL2B 5FUCE 2CK0L 4EUPA 4PJCF 3S4SB 3QH3A 4XBEL 4FFYL 3P9MB 5KSAC 1F11A 3MNZB 3HMXL 1B4RA 4JRXB 1PKQA 3MV9A 5KSVB 1QYGH 3L6FB 3AU1B 2XV6B 3T0AA 1KYOJ 4QRPA 5BVPH 4XP9L 4PJHE