8GSSA

Human glutathione s-transferase p1-1, complex with glutathione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
publication title The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 8gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 8gssA01
1GSUA 2GZPA 4MP4A 3C1RA 4G9HA 1WE0A 3WT2A 5DALA 4BVXB 3VFIA 5D8IA 3IR4A 4F9ZA 2C80A 4TXOA 2WS2A 5A4WA 3D5JA 1SD9A 5AISA 3F0IA 3NIVA 4RI6A 1O73A 2KP2A 1PKWA 1EEJA 2N5AA 3M8NA 1V9WA 1V2AA 1OC3A 4MZCA 5A5KA 5J5NA 3M9JA 4YQVA 3DMLA 4EF0A 4GF0A 2YCDA 4EDZA 2OA7A 4N0VA 4O92A 2CX3A 2H70A 4ZB6A 2K6VA 4X1UA 2B1LA 1T1VA 2O87A 3VURA 4HI7A 4KNDA 5FWGA 1G6YA 3O6TA 3L9SA 4IP1A 3ERFA 1PQNA 2LJAA 3W8SA 2HRKA 5DCGA 2RM6A 5LD0A 1JLVA 2MMOA 20GSA 1SJIA 1G7OA 1M2DA 4KA0A 4KSMA 3DGQA 1HYUA 1GLPA 1NSWA 1HNCA 2AB6A 5H5RA 4PQHA 1GL8A 4I6XA 2REMA 3WD6A 3CSHA 1K0BA 3D4TA 2R37A 5GSSA 4ECJA 1Y6EA 1S3CA 3TRXA 2GGTA 5ECOB 3GKXA 3KH7A 4LL4B 1VGLA 5CNWA 3GKKA 5HQPA 2JZRA 1YY7A 2LKUA 4L5OA 2P5QA 4YAPA 2YJHA 3W8JA 3AY8A 2K18A 1SKRB 2DJ2A 2CVBA 3ZREA 4KCAA 1QUWA 3GX0A 4POBA 3IK7A 1WIKA 3EC3A 3IXRA 1Z5YE 2LJRA 3LYKA 4USSA 4KAEA 1TU8A 2OADA 3EE2A 3HA9A 1V57A 2GVPA 3KMNA 2DJ3A 3ISOA 1FVKA 1XW9A 2OE0A 2FA8A 5ECHB 1EEMA 5EVOA 4GQFA 3ERGA 2FA4A 4MLYA 3TJKA 2F3MA 4YAVA 2C3QA 1GSYA 3M0FA 5E59A 2GSTA 1SJ6A 4ZL9A 2HLSA 2HE3A 4KDYA 2H0HA 4ZBAA 2CQ9A 1XVQA 2WULA 3HVVA 2H6ZA 1RW1A 1Z7RA 4BL7B 5IMZA 2DJKA 2C0DA 3HJMA 5CRGA 2XHFA 2D2ZA 2YOIA 4YQUA 3F9UA 3D0ZA 2GQMA 2LJKA 2CVKA 1TI3A 3GRXA 1VF3A 2KHPA 1SENA 3DKSA 4PNGA 2RIIA 3HZ4A 1ZMAA 1U87A 3FZ4A 2KOKA 1MEKA 3UJ1A 3ZLPA 1O8XA 5CRDA 4KE3A 1YEXA 4BWSA 1YQ1A 2OBIA 4CDOA 1EP8A 4BVYB 2LS5A 4MF6A 2C3TA 2B5XA 3MAKA 3M1GA 4GTUA 3C7MA 2OE1A 3ZFBA 5J9BA 2B7KA 2AHEA 3WGEA 5A4VA 3QAWA 4N11A 4L0WA 1AQVA 2C1YA 2DC5A 3F6DA 4HJMA 3WT1A 2H19A 1ERTA 3C73A 1M9BA 5ECQB 2MBSA 3GV1A 2E0QA 2CZ3A 1EOHA 5C00A 2ALBA 2MBTA 1TP9A 3F63A 2IN3A 3NZNA 2CZ2A 3WGDA 1FO5A 1BG5A 3HKRA 1XVWA 3D21A 2C3NA 4HUAA 4I2UA 2C8UA 3I69A 4J2FA 4XS1A 3A5WA 3GL3A 1KNGA 1A8LA 3P2AA 3ZTLA 2AAWA 2YWOA 2C0GA 4GWRA 3GH6A 4IN0A 5KEJA 3IAM2 2HSNB 1Z3EA 3HD5A 3RHBA 3UAPA 2BJXA 3UVTA 1YJ6A 2MMNA 3CTFA 5IQYA 4FYCA 1F3BA 4ML6A 1GNWA 4Q5NA 2F51A 1QFNA 1SK1A 5CP1A 2FGXA 4L0UA 1O85A 3KJYA 2Z9SA 4ULXA 5H5SA 3Q6OA 4KH7A 2YN1A 2DIYA 4ZILA 3KM6A 3QFBC 1XPVA 4MCUA 3IV4A 4TXVA 1Y25A 1FG4A 3HCZA 4FH8A 3QD9A 1B8XA 2IJYA 4ISDA 4POLA 3IE3A 1JZOA 4MF7A 5AGYA 1FW1A 2GLRA 3GL5A 3FKFA 1EGOA 1N2AA 2NVLA 2BMXA 3L78A 2NBSA 2G2QA 3GUSA 1PX6A 3TKSC 2J23A 1FB6A 2VLTA 4NMUA 4XS4B 1BEDA 3FR6A 2J9HA 2R4VA 4IQ1A 1SKSB 2VL2A 4D73A 2EIRA 1Z9HA 4MPFA 3ZRDA 5F0GA 4AJ7A 1GUMA 4I2TA 1TK8B 3FEUA 5D9XA 2HQTA 1LJRA 5DCHA 1IYHA 3F4TA 1M9AA 3G7IA 4RQXA 2YANA 1R4WA 3GNJA 6GSWA 1XWKA 3ZVJD 1AQWA 2FWHA 3RDWA 3TKSE 1K3YA 4MJCA 4G0KA 1F6MC 3GFKA 1J0FA 4EE0A 4WKWA 1MD4A 2YWNA 4P3YB 1M2AA 3UIWA 1WPIA 4HQZA 1GSQA 1ZCPA 4RUVA 1ML6A 1Q98A 2BTOT 3QAGA 1OKTA 2WDUA 3TJJA 3H79A 5IMVA 11GSA 1TW9A 4MDCA 1TRVA 6GSXA 4ML1A 1AXDA 3IOSA 5L71A 1B9YC 3Q18A 1G0TA 3RBTA 1O8WA 4NXIA 1WWJA 5COHA 3CBUA 3HYPA 3TCOA 4WR4A 2N5BA 1ERWA 4KF9A 8GSSA 2GDRA 3F3RA 1YZXA 4IVFA 1NW2A 2H0IA 2OE3A 2V6KA 1ZL9A 4OFTA 4NV5A 1AUCA 1ZOFA 3DD3A 4MZWA 4ECCA 6GSYA 4IBPA 1Z6NA 5DALB 1EGRA 3LEFA 2F9SA 1YEPA 4TXOB 2WFCA 4Q5FA 5KN3A 3TGZA 2EC4A 1F37A 5FT3A 2DSAA 3APQA 3TDGA 2AJQB 4V2MA 2CT6A 3DRNA 5DQSA 3C71A 3UOMA 1HNAA 3H1NA 5HFKA 3EU4A 2L4QA 1K3LA 3I6AA 4H86A 1JZRA 2LUSA 5JWOB 2GZZA 3PINA 2H71A 5GAPD 1PD21 1JZWA 2GTUA 3TJFA 4OCEA 2YWIA 3KH9A 1A2JA 5IMFA 3FZ9A 3ZYWA 1FHEA 4NHZA 3RAZA 5J9CA 3KP8A 3VK9A 1Z7PA 2HRKB 1K0AA 2CX4A 4ZL7A 1OE8A 5ECNB 3KD0A 3E0UA 1A2MA 1THXA 4ID0A 2H30A 5DJMA 1MDIA 2GT6A 3F4RA 3NOFA 2N5FA 1SL0B 1SL1B 1UVZA 2X8HA 2H72A 4TN8A 4YH2A 1CQHA 5ECRB 1GLQA 2LRTA 4OCFA 1TDIA 4K2DA 2L5OA 4OFNA 3ZL5A 3ZFLA 2V6OA 2HRFA 4EC0A 2LEGA 4TR0A 2DIZA 1XFLA 4IGJA 4WBJA 3PH9A 3GN3A 1PX7A 2OKAA 1XOBA 2R2JA 1ZZYA 2V1MA 3F3QA 2IMEA 1TJDA 1T4YA 4MF5A 3KIJA 2LRCA 3US3A 2OACA 1N8JA 1PSQA 4Q5RA 4G0LA 3TJGA 1V98A 4OD7A 1QGVA 5JWQB 2GS3A 5JCUA 5F8BA 3APSA 2GSRA 4IW9A 2RLIA 2QC7A 5KN0A 5LNKe 3L0HA 5INYA 5G31A 3VWXA 2PVOC 5G5EA 3ZIJA 1FVJA 3JCML 4ZBBA 2JACA 5HR1A 2VD1A 4E8HA 4ACSA 2VO4A 1GUHA 2VD0A 4MABA 2VCVA 3CRUA 2PGTA 3H93A 4NHWA 3MNGA 4EKZA 1H75A 1XOAA 5G1LA 2V41A 3V1WA 3GSTA 1T8EB 2R5GA 1I9DA 2TIRA 4OFMA 3GHAA 5ECPB 3P90A 2ES7A 3APOA 3VI7A 4HZ2A 3KXOA 4FO5A 5H5QA 3BCKA 3PGTA 4JBBA 3KGKA 3FRCA 3P8WA 2NTOA 4EVMA 3UMAA 4EL1A 4GRFA 3EYTA 1YF0A 1YF1A 2GZYA 6GSVA 2VOCA 1ERUA 5IOXA 3D22A 2KLXA 4IKHA 4F03A 4G2EA 2LQQA 1KBNA 3F4SA 22GSA 4F82A 1VF4A 2H1AA 1X5EA 3LXZA 2MYGA 2VCZA 1TKDB 1TRWA 3WGXA 3CRTA 2QGVA 3DEXA 4GSSA 1U3IA 2K8SA 3QFAC 3KP9A 5IPHA 1XBSA 1URMA 3BBYA 4LLRA 5ID2A 2FD3A 3E9JB 1T7PB 1XXUA 3M3MA 3WYWA 2LV3A 3VWWA 4MH2A 1SK2A 4XS6A 2H76A 3TKRA 4F0BA 3IDVA 3LGCA 4EXJA 3UL3A 2JU5A 1A8YA 1SKWB 1V58A 2O85A 2H73A 1U6TA 3LJRA 3ZIVA 3FK8A 1F3AA 1GRXA 4BA7A 2X64A 2YZHA 1XIYA 1SL2B 3I43A 1X0RA 1BAYA 1GNEA 1B9XC 3VI5A 1OC9A 2I1UA 2XC2A 4OWYA 5J4UA 3U5RE 3ERWA 3TKSA 2YNXA 1OYJA 5ELAA 1E2YA 5HR2A 3TUEA 1AIUA 4IJIA 2ON5A 2VAFA 3A3TA 1VRSD 1DSBA 4CW9A 3J7Yk 4PNFA 1FAAA 3R3EA 1RK4A 1ON4A 1RQMA 6GSUA 1GTIA 4KDXA 3W6GA 1TRUA 2OBKA 2E2GA 5B8BA 1GSEA 4BPYA 4HQSA 1KEBA 2H8LA 5F05A 4JZQA 2PWJA 1PL1A 4HOJA 1ST9A 1DE2A 4POKA 4X0XA 2HFDA 5G5FA 2H6YA 4V2NA 3LG6A 5IMDA 2F8AA 4D73B 2ZUPA 2JSYA 2ZCTA 2PERA 2C0FA 3EWLA 4NV2A 3IAS2 3GKMA 2YJ7A 1GSFA 4K7OA 3OR5A 4TR1A 2A2SA 2YV9A 4NAXA 5DJLA 1A0FA 3SWLA 1UN2A 13GSA 4ZIJA 4BWQA 5IIZA 3K8NA 4RQRA 2M72A 2PU9C 2XBIA 4N30A 4TOPA 2O89A 2FWFA 2L5LA 2VCXA 3ZZXA 2RUFA 5CRHA 1PGTA 4K6XA 3N5OA 1X5DA 17GSA 5B6NA 1XW5A 1J08A 4JU5A 2L59A 1A2LA 1ZGNA 3DYRA 4FQUA 2H6XA 4X43A 4XIHA 2HI7A 4WEYA 3H4KA 3GIXA 5HR0A 4TRXA 4XRAA 2H0GA 5KN2A 1E6BA 4F2IA 1ACVA 1F2EA 4PX1A 2L6DA 5FHIA 18GSA 2LRNA 4K9ZA 3VWVA 1XZOA 5ABRA 5CO3A 4EO3A 1EOGA 1QK8A 2K8VA 2V2GA 1AC1A 2FCHA 4DSSA 1Z6MA 4HJ2A 1B48A 3S9FA 1JFUA 1X9WB 4QL7A 3TOUA 4MJAA 3DVWA 2CVDA 4WF5A 1NM3A 4HU7A 2H66A 2IFQA 2VCQA 4ZBDA 1TK0B 4TR4A 2IPAA 1BX9A 3F6FA 4MH3A 3M9KA 2JL4A 3LYPA 1LBKA 3FHKA 3QMXA 5DQYA 4NWYA 1GH2A 1BQ7A 2HSMA 2KUCA 1K0DA 4I8BA 1S3AA 2FNOA 2EIQA 3EVIA 5HFIA 4V1Ap 4IS0A 1YKCA 4ZB9A 3GH9A 2IWTA 4TKYA 2I81A 3ME7A 2X8GA 2H74A 3TB2A 5EL8A 3CMIA 1JZDA 5GAND 2VCTA 4ZL8A 3BJ5A 1EZKA 2H1GA 3F8UA 4TW5A 1TU7A 2PBJA 3U6VA 3GMFA 5G30A 1M7TA 3MSZA 3KCMA 1EP7A 4QL9A 4Z7XA 2I9HA 2MMZA 4IP6A 3L9VA 1WRYA 4TR3A 4HZ4A 1T00A 3CSJA 2HRNA 2YZUA 4IJ3A 1WOUA 2YP6A 1UA5A 3DVXA 2GT5A 4MA9A 2DMMA 1PN9A 1ABAA 2PMTA 2TRXA 1UC7A 2ON7A 5IM9A 5G1KA 5DAKA 6GSSA 3UARA 4PTSA 4JRRA 2NPBA 3EMPA 2HZFA 4JR4A 2CV4A 2HYXA 5JCWA 4I97A 4WR5A 5AIXA 2CAIA 2WGRA 1SYXA 2DJJA 5D73A 2M80A 3TOTA 1YDKA 3J7Yb 4KGIA 2X8CA 4NPBA 1T4ZA 4K7NA 4HU9A 5GZZB 2A2RA 1O81A 4L5LA 2I4AA 2VIMA 3DXBA 1USBA 5EPFA 2IMIA 1K0CA 1Q4JA 5ELGA 5CRWA 4G10A 3GTUA 5ECLB 5CYYA 2HSHA 1R7HA 4AJ8A 5F07A 5DVBA 2IIYA 1OVNA 2PUKC 5EY6A 1A24A 2LQOA 1TOFA 4V2LA 2HZEA 5E4WA 1PA3A 1XW6A 5F06A 1T3BA 1C72A 10GSA 4F0CA 3FW2A 4MPGA 1WP0A 4FYUA 3TJBA 4AJ6A 3UEMA 2K9FA 2H75A 3KMOA 4K1FA 4XCSA 1IYIA 3L4NA 1A23A 4E8EA 2YWMA 2XPEA 3LORA 4MJBA 3FR3A 5C04A 1HQOA 3GA4A 14GSA 1SD8A 4KB3A 4N10A 3RPPA 1K0MA 3CYNA 3IC8A 2EIOA 2L4CA 2TRCP 1SYRA 2QKEA 3D6IA 2YPMA 4BVXA 1O6JA 4WXTA 2LNTA 1G7EA 4FYBA 1X9SB 2JSZA 2L6CA 2X99A 2XPDA 3QOUA 1U3AA 2FWEA 4WF4A 2A4VA 2DJ1A 4LMVA 3BOAA 1NHOA 1EWXA 2HNLA 3MWHA 5ID2B 2HT9A 3ZITA 2FUG2 4GQCA 4ZB8A 1QMVA 3LXTA 1HD2A 3QDNA 4XRDA 1O7UA 4ILFA 4JEDA 3EINA 1DBYA 3MDKA 5B8AA 4MZBA 2R6KA 4G19A 2DJ0A 2AYTA 3G7YA 1XCCA 2H1BA 4OMVA 3GURA 5D9TA 3HDCA 4FIWA 3IA1A 1GSSA 3IPZA 4J57E 2IMKA 3R2QA 3UVHA 2YV7A 1SU9A 3KZQA 4PQIA 3QPMA 5IO0A 1OE7A 3VPQA 2C4JA 1JHBA 1OC9B 1NHYA 1JLWA 2E2MA 2HXKA 2P0GA 2PN8A 5IMCA 1GTBA 2RUEA 2IMFA 4N0ZA 4KSOA 3A2WA 3BD2A 1KTEA 5KN1A 1PRXA 16GSA 1W4VA 2VM1A 3VLNA 4XTSA 1AQXA 1J9BA 1R26A 1K3OA 3KTLA 1PL2A 3PPUA 12GSA 1AAZA 2DBCA 1PMTA 3DWVA 1OC8A 5ECMB 1TI1A 3EU3A 2CAQA 5J41A 2VLVA 5GSTA 1I5GA 5HFGA 1GTUA 3EURA 4MJEA 3KEBA 3BCIA 4GCIA 4LMWA 2FLSA 3G7JA 1MDJA 4GSTA 1R5AA 1MTCA 3I9V2 4LA1A 5ECIB 1W89A 1AW9A 4OO4A 1B4QA 1F9MA 5G2ZA 3PR8A 3TRQA 2PVQA 2B3SA 3HZ8A 4PXOA 2P5RA 4HS1A 3FZAA 1H4OA 4PGTA 2MZCA 2XBQA 2VCWA 4I5QA 2H1DA 4YQMA 3LSZA 4TR1B 5ENUA 4K0GA 1XWCA 5D9VA 3Q19A 1DE1A 2MMAA 3RHCA 1K0OA 1TRSA 4PURA 4BL7A 4ECIA 3ZMKA 4HEA2 1GTAA 1PKZA 2HRAA 2DLXA 3UBKA 5J3RA 1ZYQB 3KTBA 3FYGA 1ILOA 1M2BA 1OKDA 3HY2A 3ZMLA 3H8QA 5D9WA 3HVXA 2WRTA 4JE1A 3TRPA 3CXGA 1LU4A 4PUFC 1B4PA 3P7XA 4O32A 4DSRA 3LFLA 3EMXA 2NDOA 1ZYEA 1CQGA 1QXHA 3L9UA 1MDKA 4BVYA 2VUPA 1GULA 2WJUA 2RM5A 1G6WA 4O5RA 2B7JA 4DVCA 1TK5B 9GSSA 2CA8A 4WETA 4WBRD 2B6MA 3ED3A 2JZSA 3IC4A 2VL9A 3VWUA 4TVEA 1QQ2A 3VPTA 5D93A 3LWAA 4POMA 4HDEA 4PQ1A 4GSNA 1SJZA 4IHUA 3LQ7A 2P31A 3O3TA 4DSSB 5D96A 3ME8A 4G0IA 3Q74A 5IPGA 3D4MA 4EUYA 5B7CA 2QSIA 2IL3A 1GSDA 2F8FA 2VL3A 4K0NA 1XWAA 2IFQB 3GKNA 3IK9A 4GXZA 1YKAA 1WMJA 3G9BA 4KW6A 1ERVA 3CSIA 1FB0A 2HSYA 1MD3A 2C0EA 1OAZA 3IBHA 4XHMA 1R5PA 2KP1A 1M0UA 1BYEA 2UZ8A 2I3YA 5DDLA 5CREA 4QQ7A 2H01A 4RI7A 2FWGA 2VLUA 2HSMB 3CTGA 2LSTA 1SK0A 2B5EA 2G0FA 3HXSA 5CAXA 4IELA 3HVSA 2M46A 5ECKB 3SBCA 4J56E 5JWRB 5IO2A 2LNSA 1V40A 4CHSA 2OJLA 1VF1A 1BJXA 2WCIA 2JADA 4MMMA 4EDYA 2O7KA 7GSSA 4L8EA 1K0NA 1TTZA 1FOVA 3C8EA 1M99A 2V32A 4ECBA 5LCZA 1A0RP 2O8VB 3RPNA 5IOWA 2GQKA 4KDUA 3UBLA 2VM2A 4MK3A 4K8MA 4XS4A 4JR6A 4K7IA 5AN1A 5HR3A 4GLTA 2FHEA 4O7HA 1S3DA 5A4UA 3QCPA 1GP1A 3FR9A 2WB9A 3O76A 3IHQA 2FY6A 5DAKB 3C1SA 5AIVA 3HJPA 4KX4A 1THOA 1TXXA 1U88A 1HNBA 4IQAA 4V1Ag 4ZXGA 1WJKA 2DMLA 5B6MA 2L57A 1VF2A 2PPTA 1X5CA 3TKQA 1EV9A 2AUVA 3QAVA 5JCGA 1EV4A 3HHVA 3A2VA 4AF2A 1X9MB 3DIEA 4OO5A 2VL2C 3GX8A 4DSQA 1GUKA 3FY7A 3N9JA 1DUGA 3ZVJA 5BMUA 3GTUB 2B1KA 3GYKA 4LL1B 4KCEA 2R3XA 19GSA 5ECSA 2GSSA 2ZNMA 4KUNA 3GSSA 4Q5QA 5IMAA 3A2XA 2HZEB 5DBQA 2E7PA 2AV4A 2IMDA 3IRAA 2WZ9A 3TKPA 2LTKA 3HJOA 4AGSA 1XWBA 1XWGA 3QR6A 3E3EA 2JZTA 3FZ5A 2GSQA 1GWCA 6GSTA 2B5YA 4DEJA 4PUAA 2GQLA
chains in the Genus database with same CATH superfamily
4EIQA 1GSUA 2GZPA 4MP4A 3C1RA 4G9HA 1WE0A 3WT2A 5DALA 4BVXB 3VFIA 5D8IA 3IR4A 4F9ZA 2C80A 4TXOA 2WS2A 5A4WA 3D5JA 1SD9A 5AISA 3F0IA 3NIVA 4RI6A 1O73A 2KP2A 1PKWA 1EEJA 2N5AA 3M8NA 1V9WA 1V2AA 1OC3A 4MZCA 5A34B 5A5KA 5J5NA 3M9JA 4YQVA 3DMLA 4EF0A 4GF0A 3CWGA 2YCDA 2X49A 4EDZA 2OA7A 4N0VA 4K5RA 4O92A 2CX3A 2H70A 3FMWA 4ZB6A 2K6VA 4X1UA 2H1LA 2B1LA 1T1VA 2O87A 3VURA 4HI7A 4KNDA 3EPTA 5FWGA 1G6YA 3O6TA 3L9SA 4IP1A 4EIPA 3ERFA 1PQNA 2LJAA 3W8SA 2QA2A 3HVNA 2HRKA 5DCGA 2RM6A 5LD0A 1JLVA 2MMOA 20GSA 1SJIA 1G7OA 1M2DA 4KA0A 4KSMA 3DGQA 1HYUA 1GLPA 1NSWA 1HNCA 2AB6A 5H5RA 4PQHA 1GL8A 4I6XA 2REMA 3WD6A 3CSHA 1K0BA 3D4TA 2R37A 5GSSA 4ECJA 1Y6EA 1S3CA 3TRXA 2GGTA 2WVYA 5ECOB 3GKXA 3KH7A 4LL4B 1VGLA 5CNWA 3GKKA 5HQPA 2JZRA 1YY7A 2LKUA 4L5OA 2P5QA 4G01A 2DKIA 4YAPA 2YJHA 3W8JA 3AY8A 2K18A 1SKRB 2DJ2A 1BG1A 4O5UA 2CVBA 3ZREA 4KCAA 1QUWA 3GX0A 4POBA 3IK7A 1WIKA 3EC3A 3IXRA 1Z5YE 2LJRA 3LYKA 4USSA 4KAEA 1TU8A 2OADA 3EE2A 3HA9A 1V57A 2GVPA 3KMNA 2DJ3A 3ISOA 1FVKA 1XW9A 2OE0A 2FA8A 5J47A 5ECHB 1EEMA 5EVOA 4GQFA 3ERGA 2FA4A 4MLYA 3TJKA 2F3MA 4YAVA 2C3QA 2O5VA 1GSYA 3M0FA 5E59A 2GSTA 1SJ6A 4ZL9A 2HLSA 2HE3A 4KDYA 2WZSA 2H0HA 4ZBAA 2CQ9A 1XVQA 2WULA 3HVVA 2H6ZA 1RW1A 1Z7RA 4BL7B 5IMZA 2DJKA 2C0DA 3HJMA 5CRGA 2XHFA 2D2ZA 2YOIA 4YQUA 3F9UA 3D0ZA 2GQMA 2LJKA 2CVKA 1TI3A 4PI2C 3GRXA 1VF3A 2KHPA 1SENA 3DKSA 4PNGA 2WVXB 2RIIA 3HZ4A 1ZMAA 1U87A 3FZ4A 2KOKA 1MEKA 3UJ1A 2WW3A 3ZLPA 1O8XA 5CRDA 4KE3A 1YEXA 4BWSA 1YQ1A 2OBIA 4CDOA 1EP8A 4BVYB 3TU3B 2LS5A 4MF6A 2C3TA 2B5XA 3MAKA 3M1GA 4GTUA 3C7MA 2OE1A 3ZFBA 5J9BA 2B7KA 2AHEA 3WGEA 5A4VA 3QAWA 4N11A 4L0WA 1AQVA 2C1YA 2DC5A 3F6DA 4HJMA 3WT1A 2H19A 1ERTA 2WW2A 3C73A 1M9BA 5ECQB 2MBSA 3GV1A 2E0QA 2CZ3A 1EOHA 5C00A 2ALBA 2MBTA 1TP9A 3F63A 2IN3A 3NZNA 2CZ2A 3WGDA 1FO5A 1BG5A 1YEWC 3HKRA 1XVWA 3D21A 2C3NA 4HUAA 4I2UA 1ZYNA 2C8UA 3I69A 4J2FA 4XS1A 3A5WA 3GL3A 1FOHA 1KNGA 1A8LA 3P2AA 3ZTLA 2AAWA 2YWOA 2C0GA 4GWRA 3GH6A 4IN0A 5KEJA 3IAM2 2HSNB 3A5IA 1Z3EA 3HD5A 3RHBA 3UAPA 2BJXA 3UVTA 4N3ZA 1YJ6A 2MMNA 3CTFA 5IQYA 4FYCA 1F3BA 4ML6A 1GNWA 4Q5NA 2F51A 1QFNA 1SK1A 5CP1A 2FGXA 2QA1A 4L0UA 1O85A 3KJYA 2Z9SA 4ULXA 5H5SA 3Q6OA 4KH7A 2YN1A 2DIYA 4ZILA 3KM6A 3QFBC 1XPVA 4MCUA 3IV4A 4TXVA 4ZB7A 1Y25A 5KOWA 1FG4A 3HCZA 4FH8A 3QD9A 1B8XA 2IJYA 4ISDA 4POLA 3IE3A 1JZOA 4MF7A 5AGYA 1FW1A 2GLRA 3GL5A 3FKFA 1EGOA 1N2AA 2NVLA 2BMXA 3L78A 2NBSA 2G2QA 3GUSA 1PX6A 3TKSC 2J23A 1FB6A 2VLTA 4NMUA 4XS4B 1BEDA 3FR6A 2J9HA 2R4VA 5A5HB 4IQ1A 1SKSB 2VL2A 4D73A 2EIRA 1Z9HA 4MPFA 3ZRDA 5F0GA 4AJ7A 1GUMA 4I2TA 1TK8B 3FEUA 5D9XA 2HQTA 1LJRA 4FXYP 5DCHA 1IYHA 3F4TA 1M9AA 3G7IA 4RQXA 2YANA 1R4WA 3GNJA 4Z2TA 6GSWA 1XWKA 3ZVJD 1AQWA 2FWHA 3RDWA 3TKSE 1K3YA 4MJCA 4G0KA 1F6MC 3GFKA 1J0FA 4EE0A 4WKWA 2EFHA 1MD4A 2EFDA 2YWNA 3MYDA 4P3YB 1M2AA 5BMUB 1WPIA 3UIWA 4HQZA 1GSQA 1ZCPA 4RUVA 1ML6A 1Q98A 2BTOT 3QAGA 1OKTA 2WDUA 3TJJA 3H79A 5IMVA 11GSA 1TW9A 4MDCA 1TRVA 6GSXA 1PFOA 4ML1A 1AXDA 3IOSA 5L71A 1B9YC 3Q18A 4GDFA 1G0TA 3RBTA 1O8WA 4NXIA 1WWJA 5COHA 2VKZG 3CBUA 3HYPA 3TCOA 4WR4A 2N5BA 1ERWA 4KF9A 8GSSA 2GDRA 3F3RA 1YZXA 4IVFA 1NW2A 2H0IA 2OE3A 2V6KA 1ZL9A 4OFTA 4NV5A 1AUCA 1ZOFA 3DD3A 4MZWA 4ECCA 6GSYA 4IBPA 1Z6NA 5DALB 1EGRA 3LEFA 2F9SA 1YEPA 4TXOB 2WFCA 4Q5FA 5KN3A 3TGZA 2EC4A 4YKGA 4AKXB 1F37A 5FT3A 2DSAA 3APQA 3TDGA 2AJQB 4V2MA 2CT6A 3DRNA 5DQSA 3C71A 2EFCA 3UOMA 1HNAA 3H1NA 5HFKA 3EU4A 2L4QA 1K3LA 3I6AA 4H86A 1JZRA 2LUSA 5JWOB 2GZZA 3PINA 2H71A 5GAPD 1PD21 1JZWA 2GTUA 3TJFA 4MNNA 4OCEA 2YWIA 3KH9A 4O5QA 1A2JA 5IMFA 3FZ9A 3ZYWA 1FHEA 4NHZA 3RAZA 5J9CA 3KP8A 3VK9A 2O36A 1Z7PA 2HRKB 1K0AA 1BF5A 2CX4A 4ZL7A 1OE8A 5ECNB 3KD0A 3E0UA 1A2MA 1THXA 4ID0A 2H30A 5DJMA 1MDIA 2GT6A 3F4RA 3NOFA 4PHZC 2N5FA 1SL0B 1SL1B 1UVZA 2X8HA 2H72A 4TN8A 4YH2A 1CQHA 5ECRB 1GLQA 2LRTA 4OCFA 1TDIA 4K2DA 4K2XA 2L5OA 4OFNA 3ZL5A 3ZFLA 2V6OA 2HRFA 4EC0A 2LEGA 4TR0A 2DIZA 1XFLA 4IGJA 4WBJA 3PH9A 3GN3A 1PX7A 2OKAA 1XOBA 2R2JA 1ZZYA 2V1MA 3F3QA 2IMEA 1TJDA 1T4YA 4MF5A 3KIJA 2LRCA 3US3A 2OACA 1M3IA 1N8JA 1PSQA 4Q5RA 4G0LA 3TJGA 1V98A 4OD7A 1QGVA 5JWQB 1XG8A 2GS3A 5JCUA 5F8BA 3APSA 2GSRA 4IW9A 2RLIA 2QC7A 5KN0A 5LNKe 3L0HA 5INYA 5G31A 3VWXA 2PVOC 5G5EA 3ZIJA 1FVJA 3JCML 4ZBBA 2JACA 5HR1A 2VD1A 4E8HA 4ACSA 3LW9A 1SVOA 2VO4A 1GUHA 2VD0A 4MABA 2VCVA 3CRUA 2PGTA 3H93A 4NHWA 3MNGA 4EKZA 4K5SA 1H75A 1XOAA 5G1LA 2V41A 3V1WA 3GSTA 1T8EB 2R5GA 5A1NA 1I9DA 2TIRA 4OFMA 3GHAA 5ECPB 3P90A 2ES7A 3APOA 3VI7A 4HZ2A 3KXOA 4FO5A 5H5QA 3BCKA 3PGTA 4JBBA 3KGKA 3FRCA 3P8WA 2NTOA 4EVMA 3UMAA 4EL1A 4GRFA 3EYTA 1YF0A 1YF1A 2GZYA 6GSVA 2R0GA 2VOCA 1ERUA 5IOXA 3D22A 2KLXA 4IKHA 4F03A 4G2EA 2LQQA 1KBNA 3F4SA 22GSA 4F82A 1VF4A 2H1AA 1X5EA 3LXZA 2MYGA 2VCZA 1TKDB 1TRWA 3WGXA 3CRTA 2QGVA 2WW1A 3DEXA 4GSSA 1U3IA 4QMKA 2K8SA 3QFAC 3KP9A 5IPHA 1ZYPA 1XBSA 1URMA 3BBYA 4LLRA 5ID2A 2FD3A 3E9JB 1T7PB 1S4BP 1XXUA 3M3MA 3WYWA 2LV3A 3VWWA 4MH2A 1SK2A 4XS6A 2H76A 3TKRA 4F0BA 3IDVA 3LGCA 4EXJA 3UL3A 2JU5A 1A8YA 1SKWB 1V58A 2O85A 2H73A 1U6TA 3LJRA 3ZIVA 3FK8A 1F3AA 1GRXA 4BA7A 2X64A 4AKGA 2YZHA 1XIYA 1SL2B 3I43A 1X0RA 1BAYA 1GNEA 1B9XC 3VI5A 1OC9A 2I1UA 2XC2A 4OWYA 5J4UA 3U5RE 3ERWA 2WVZA 3TKSA 2A4HA 2YNXA 1OYJA 5ELAA 1E2YA 5HR2A 3CQFA 3TUEA 1AIUA 4IJIA 2ON5A 2VAFA 3A3TA 1VRSD 1DSBA 4CW9A 3J7Yk 4PNFA 1FAAA 3R3EA 1RK4A 1ON4A 1RQMA 4CY8A 6GSUA 1GTIA 4KDXA 3W6GA 1TRUA 2OBKA 2E2GA 5B8BA 1GSEA 4BPYA 4HQSA 1KEBA 4PI0C 2H8LA 5F05A 4JZQA 2PWJA 1PL1A 4HOJA 1ST9A 1DE2A 4POKA 4X0XA 2HFDA 5J4YA 5G5FA 2H6YA 4V2NA 3LG6A 5IMDA 2F8AA 4D73B 2ZUPA 2JSYA 2ZCTA 2PERA 2C0FA 3EWLA 4NV2A 3IAS2 3GKMA 2YJ7A 1GSFA 4K7OA 3OR5A 4HSCX 4TR1A 2A2SA 2YV9A 4NAXA 5KOXA 5DJLA 1A0FA 3SWLA 5J40A 1UN2A 13GSA 4ZIJA 4BWQA 5IIZA 3K8NA 4RQRA 2M72A 2PU9C 3RGBC 2XBIA 4N30A 4TOPA 2O89A 2FWFA 2L5LA 2OT3A 2VCXA 3ZZXA 2RUFA 5CRHA 1PGTA 4K6XA 3N5OA 1X5DA 17GSA 5B6NA 1XW5A 1J08A 4JU5A 3HMJG 2L59A 2R0PA 1A2LA 1ZGNA 2DKHA 3DYRA 4FQUA 2H6XA 4X43A 4XIHA 2HI7A 4WEYA 3H4KA 3GIXA 5HR0A 4TRXA 4XRAA 2H0GA 5KN2A 1E6BA 4F2IA 1ACVA 1F2EA 4PX1A 2L6DA 5FHIA 18GSA 2LRNA 4K9ZA 3VWVA 1XZOA 5ABRA 5CO3A 4EO3A 1EOGA 1QK8A 4A5PA 2K8VA 2V2GA 1AC1A 2FCHA 4DSSA 1Z6MA 4HJ2A 1B48A 3S9FA 1JFUA 1X9WB 4QL7A 3TOUA 4MJAA 3DVWA 2CVDA 4WF5A 1NM3A 4HU7A 2H66A 4ICYA 2IFQA 2VCQA 4ZBDA 1TK0B 4TR4A 2IPAA 1BX9A 3F6FA 4MH3A 3M9KA 2JL4A 3LYPA 1LBKA 3FHKA 3QMXA 5DQYA 4NWYA 1GH2A 1BQ7A 2HSMA 2KUCA 1K0DA 4I8BA 1S3AA 2FNOA 2EIQA 1YVLA 3EVIA 5HFIA 4V1Ap 4IS0A 1YKCA 4ZB9A 3GH9A 2IWTA 4TKYA 2I81A 3ME7A 2X8GA 2H74A 3TB2A 5EL8A 3CMIA 1JZDA 5GAND 2VCTA 4ZL8A 3BJ5A 1EZKA 2H1GA 3F8UA 4TW5A 1TU7A 1TXUA 2PBJA 3U6VA 3GMFA 5G30A 1M7TA 3KCMA 3MSZA 1EP7A 4QL9A 4Z7XA 2I9HA 2MMZA 5J4VA 4IP6A 3L9VA 1WRYA 4TR3A 4X4JA 4HZ4A 1T00A 3CSJA 2HRNA 2YZUA 4IJ3A 1WOUA 2YP6A 1UA5A 3DVXA 2GT5A 4MA9A 2DMMA 3RFRC 1PN9A 1ABAA 1SVMA 2PMTA 2TRXA 1UC7A 2ON7A 5IM9A 5G1KA 5DAKA 6GSSA 3UARA 4PTSA 4JRRA 2NPBA 3EMPA 2HZFA 4JR4A 2CV4A 2HYXA 5JCWA 4I97A 4WR5A 5AIXA 2CAIA 2WGRA 1SYXA 2DJJA 5D73A 2M80A 3MIXA 3TOTA 1YDKA 4CY6A 2X4AA 3J7Yb 4KGIA 2X8CA 4NPBA 1T4ZA 4K7NA 4HU9A 5GZZB 2A2RA 1O81A 4L5LA 4W66A 2I4AA 2VIMA 3DXBA 1USBA 5EPFA 2IMIA 1K0CA 1Q4JA 5ELGA 5CRWA 4G10A 3GTUA 5ECLB 5CYYA 2HSHA 1R7HA 4AJ8A 5F07A 5DVBA 2IIYA 1OVNA 2PUKC 5EY6A 1A24A 2LQOA 1TOFA 4V2LA 2HZEA 5E4WA 1PA3A 1XW6A 5F06A 4Z2UA 1T3BA 1C72A 10GSA 4F0CA 3FW2A 4MPGA 1WP0A 4FYUA 5A1NB 3TJBA 4AJ6A 3UEMA 2K9FA 2H75A 3KMOA 4K1FA 2EFEA 4XCSA 1IYIA 3L4NA 1A23A 4E8EA 2YWMA 2XPEA 3LORA 4MJBA 3FR3A 5C04A 1HQOA 3GA4A 14GSA 1SD8A 4KB3A 4N10A 3RPPA 1K0MA 3CYNA 3IC8A 2EIOA 2L4CA 2WW0A 2TRCP 1SYRA 2QKEA 3D6IA 2YPMA 4BVXA 1O6JA 4WXTA 2LNTA 1G7EA 4FYBA 1X9SB 2JSZA 2L6CA 2X99A 2XPDA 3QOUA 1U3AA 2FWEA 4WF4A 2A4VA 2DJ1A 4LMVA 3BOAA 1NHOA 1EWXA 2HNLA 3MWHA 5A34A 2A2PA 5ID2B 2HT9A 3ZITA 2FUG2 4GQCA 4ZB8A 1M3JA 1QMVA 3LXTA 4BIKA 1HD2A 3QDNA 4XRDA 1O7UA 4ILFA 4JEDA 3EINA 1DBYA 3MDKA 5B8AA 4MZBA 2R6KA 4G19A 2DJ0A 2AYTA 3G7YA 1XCCA 2UV8G 2H1BA 4OMVA 3GURA 5D9TA 3HDCA 4FIWA 3IA1A 1GSSA 3IPZA 4J57E 2IMKA 3R2QA 3UVHA 2YV7A 1SU9A 3KZQA 4PQIA 3QPMA 5IO0A 1OE7A 3VPQA 2C4JA 1JHBA 1OC9B 1NHYA 3IHGA 1JLWA 2E2MA 2HXKA 2P0GA 2PN8A 5IMCA 1GTBA 2RUEA 2IMFA 4N0ZA 4KSOA 3A2WA 3BD2A 1KTEA 5KN1A 1PRXA 16GSA 1W4VA 2VM1A 3VLNA 4XTSA 1I1IP 1AQXA 1J9BA 1R26A 1K3OA 3KTLA 1PN0A 1PL2A 3PPUA 12GSA 1AAZA 2DBCA 1PMTA 3DWVA 1OC8A 5ECMB 1TI1A 3EU3A 2CAQA 5J41A 2VLVA 5GSTA 1I5GA 5HFGA 1GTUA 3EURA 4MJEA 3KEBA 3BCIA 4GCIA 4AI6A 4LMWA 2FLSA 3G7JA 1MDJA 4GSTA 1R5AA 1MTCA 3I9V2 4LA1A 5ECIB 1W89A 1AW9A 4OO4A 1B4QA 1F9MA 5G2ZA 3PR8A 3TRQA 2PVQA 2B3SA 3HZ8A 4PXOA 2P5RA 4HS1A 3FZAA 1H4OA 4PGTA 2MZCA 2XBQA 2VCWA 4I5QA 2H1DA 4YQMA 3LSZA 4TR1B 5ENUA 4K0GA 1XWCA 5D9VA 3Q19A 1DE1A 2MMAA 3RHCA 1K0OA 1TRSA 4PURA 4BL7A 4ECIA 3ZMKA 4HEA2 1GTAA 1PKZA 2HRAA 2DLXA 3UBKA 5J3RA 1ZYQB 3KTBA 3FYGA 1ILOA 1SVLA 1M2BA 1OKDA 3HY2A 3ZMLA 3H8QA 5D9WA 3HVXA 2WRTA 4JE1A 3TRPA 3CXGA 1LU4A 4PUFC 2WVXA 1B4PA 3P7XA 4O32A 4DSRA 3LFLA 3EMXA 2NDOA 1ZYEA 1CQGA 1QXHA 3L9UA 1MDKA 4BVYA 2VUPA 1GULA 2WJUA 2RM5A 1G6WA 4O5RA 2B7JA 4DVCA 1TK5B 9GSSA 2CA8A 4WETA 4WBRD 2B6MA 3ED3A 2JZSA 3IC4A 2VL9A 3VWUA 4TVEA 1QQ2A 3VPTA 4AKIA 5D93A 3LWAA 4POMA 4HDEA 4PQ1A 4GSNA 1SJZA 4IHUA 3LQ7A 2P31A 3O3TA 4DSSB 2R0CA 5D96A 3ME8A 4G0IA 3Q74A 5IPGA 3D4MA 4EUYA 5B7CA 1Y1UA 2QSIA 2HSNA 2IL3A 1GSDA 2F8FA 2VL3A 4K0NA 1XWAA 2IFQB 3GKNA 3IK9A 4GXZA 1YKAA 4Z2RA 1WMJA 3G9BA 4KW6A 1ERVA 3CSIA 1FB0A 2HSYA 1MD3A 2C0EA 1OAZA 3IBHA 4XHMA 1R5PA 2KP1A 1M0UA 1BYEA 2UZ8A 2I3YA 5DDLA 5CREA 4QQ7A 1N25A 2H01A 4RI7A 2FWGA 2VLUA 4YKFA 2HSMB 3CTGA 2LSTA 1SK0A 2B5EA 4E68A 2G0FA 3HXSA 5CAXA 4IELA 3HVSA 2M46A 5ECKB 3SBCA 4J56E 5JWRB 5IO2A 1S3RA 2LNSA 1V40A 4CHSA 2OJLA 1VF1A 1BJXA 2WCIA 2JADA 4MMMA 4EDYA 2O7KA 7GSSA 4L8EA 1K0NA 1TTZA 1FOVA 3C8EA 1M99A 2V32A 4ECBA 5LCZA 2O3EA 1A0RP 2O8VB 3RPNA 5IOWA 2GQKA 4KDUA 3UBLA 2VM2A 4MK3A 4K8MA 4XS4A 4JR6A 4K7IA 5AN1A 5A5HA 5HR3A 4GLTA 2FHEA 4O7HA 1S3DA 5A4UA 3QCPA 1GP1A 3FR9A 2WB9A 3O76A 3IHQA 2FY6A 5BRTA 5DAKB 3C1SA 5AIVA 3HJPA 4KX4A 1THOA 1TXXA 1U88A 1HNBA 4IQAA 4V1Ag 3CHXC 4ZXGA 1WJKA 2DMLA 5B6MA 2L57A 1VF2A 2PPTA 1X5CA 3TKQA 1EV9A 2AUVA 3QAVA 5JCGA 1EV4A 3HHVA 3A2VA 4AF2A 1X9MB 3DIEA 4OO5A 2VL2C 3GX8A 4DSQA 1GUKA 4AKHA 3FY7A 3N9JA 1DUGA 3ZVJA 5BMUA 3GTUB 2B1KA 3GYKA 4LL1B 4KCEA 2R3XA 19GSA 5ECSA 2GSSA 2ZNMA 4KUNA 3GSSA 4Q5QA 5IMAA 3A2XA 2HZEB 5DBQA 2E7PA 2AV4A 2IMDA 3IRAA 2WZ9A 3TKPA 2LTKA 3HJOA 4AGSA 1XWBA 1XWGA 3QR6A 3E3EA 2JZTA 3FZ5A 2GSQA 1GWCA 6GSTA 2B5YA 4DEJA 4PUAA 2GQLA
chains in the Genus database with same CATH topology
4EIQA 1GSUA 2GZPA 4MP4A 3C1RA 4G9HA 1WE0A 3WT2A 5DALA 4BVXB 3VFIA 5D8IA 3IR4A 4F9ZA 2C80A 4TXOA 2WS2A 5A4WA 3D5JA 1SD9A 5AISA 3F0IA 3NIVA 4RI6A 1O73A 2KP2A 1PKWA 1EEJA 2N5AA 3M8NA 1V9WA 1V2AA 1OC3A 4MZCA 5A34B 5A5KA 5J5NA 3M9JA 4YQVA 3DMLA 4EF0A 4GF0A 3CWGA 2YCDA 2X49A 4EDZA 2OA7A 4N0VA 4K5RA 4O92A 2CX3A 2H70A 3FMWA 4ZB6A 2K6VA 4X1UA 2H1LA 2B1LA 1T1VA 2O87A 3VURA 4HI7A 4KNDA 3EPTA 5FWGA 1G6YA 3O6TA 3L9SA 4IP1A 4EIPA 3ERFA 1PQNA 2LJAA 3W8SA 2QA2A 2HRKA 5DCGA 2RM6A 5LD0A 1JLVA 2MMOA 20GSA 1SJIA 1G7OA 1M2DA 4KA0A 4KSMA 3DGQA 1HYUA 1GLPA 1NSWA 1HNCA 2AB6A 5H5RA 4PQHA 1GL8A 4I6XA 2REMA 3WD6A 3CSHA 1K0BA 3D4TA 2R37A 5GSSA 4ECJA 1Y6EA 1S3CA 3TRXA 2GGTA 5ECOB 3GKXA 3KH7A 4LL4B 1VGLA 5CNWA 3GKKA 5HQPA 2JZRA 1YY7A 2LKUA 4L5OA 2P5QA 4G01A 2DKIA 4YAPA 2YJHA 3W8JA 3AY8A 2K18A 1SKRB 2DJ2A 1BG1A 4O5UA 2CVBA 3ZREA 4KCAA 1QUWA 3GX0A 4POBA 3IK7A 1WIKA 3EC3A 3IXRA 1Z5YE 2LJRA 3LYKA 4USSA 4KAEA 1TU8A 2OADA 3EE2A 3HA9A 1V57A 2GVPA 3KMNA 2DJ3A 3ISOA 1FVKA 1XW9A 2OE0A 2FA8A 5J47A 5ECHB 1EEMA 5EVOA 4GQFA 3ERGA 2FA4A 4MLYA 3TJKA 2F3MA 4YAVA 2C3QA 2O5VA 1GSYA 3M0FA 5E59A 2GSTA 1SJ6A 4ZL9A 2HLSA 2HE3A 4KDYA 2H0HA 4ZBAA 2CQ9A 1XVQA 2WULA 3HVVA 2H6ZA 1RW1A 1Z7RA 4BL7B 5IMZA 2DJKA 2C0DA 3HJMA 5CRGA 2XHFA 2D2ZA 2YOIA 4YQUA 3F9UA 3D0ZA 2GQMA 2LJKA 2CVKA 1TI3A 3GRXA 1VF3A 2KHPA 1SENA 3DKSA 4PNGA 2RIIA 3HZ4A 1ZMAA 1U87A 3FZ4A 2KOKA 1MEKA 3UJ1A 3ZLPA 1O8XA 5CRDA 4KE3A 1YEXA 4BWSA 1YQ1A 2OBIA 4CDOA 1EP8A 4BVYB 3TU3B 2LS5A 4MF6A 2C3TA 2B5XA 3MAKA 3M1GA 4GTUA 3C7MA 2OE1A 3ZFBA 5J9BA 2B7KA 2AHEA 3WGEA 5A4VA 3QAWA 4N11A 4L0WA 1AQVA 2C1YA 2DC5A 3F6DA 4HJMA 3WT1A 2H19A 1ERTA 3C73A 1M9BA 5ECQB 2MBSA 3GV1A 2E0QA 2CZ3A 1EOHA 5C00A 2ALBA 2MBTA 1TP9A 3F63A 2IN3A 3NZNA 2CZ2A 3WGDA 1FO5A 1BG5A 3HKRA 1XVWA 3D21A 2C3NA 4HUAA 4I2UA 1ZYNA 2C8UA 3I69A 4J2FA 4XS1A 3A5WA 3GL3A 1FOHA 1KNGA 1A8LA 3P2AA 3ZTLA 2AAWA 2YWOA 2C0GA 4GWRA 3GH6A 4IN0A 5KEJA 3IAM2 2HSNB 3A5IA 1Z3EA 3HD5A 3RHBA 3UAPA 2BJXA 3UVTA 4N3ZA 1YJ6A 2MMNA 3CTFA 5IQYA 4FYCA 1F3BA 4ML6A 1GNWA 4Q5NA 2F51A 1QFNA 1SK1A 5CP1A 2FGXA 2QA1A 4L0UA 1O85A 3KJYA 2Z9SA 4ULXA 5H5SA 3Q6OA 4KH7A 2YN1A 2DIYA 4ZILA 3KM6A 3QFBC 1XPVA 4MCUA 3IV4A 4TXVA 4ZB7A 1Y25A 5KOWA 1FG4A 3HCZA 4FH8A 3QD9A 1B8XA 2IJYA 4ISDA 4POLA 3IE3A 1JZOA 4MF7A 5AGYA 1FW1A 2GLRA 3GL5A 3FKFA 1EGOA 1N2AA 2NVLA 2BMXA 3L78A 2NBSA 2G2QA 3GUSA 1PX6A 3TKSC 2J23A 1FB6A 2VLTA 4NMUA 4XS4B 1BEDA 3FR6A 2J9HA 2R4VA 5A5HB 4IQ1A 1SKSB 2VL2A 4D73A 2EIRA 1Z9HA 4MPFA 3ZRDA 5F0GA 4AJ7A 1GUMA 4I2TA 1TK8B 3FEUA 5D9XA 2HQTA 1LJRA 5DCHA 1IYHA 3F4TA 1M9AA 3G7IA 4RQXA 2YANA 1R4WA 3GNJA 4Z2TA 6GSWA 1XWKA 3ZVJD 1AQWA 2FWHA 3RDWA 3TKSE 1K3YA 4MJCA 4G0KA 1F6MC 3GFKA 1J0FA 4EE0A 4WKWA 2EFHA 1MD4A 2EFDA 2YWNA 3MYDA 4P3YB 1M2AA 5BMUB 1WPIA 3UIWA 4HQZA 1GSQA 1ZCPA 4RUVA 1ML6A 1Q98A 2BTOT 3QAGA 1OKTA 2WDUA 3TJJA 3H79A 5IMVA 11GSA 1TW9A 4MDCA 1TRVA 6GSXA 4ML1A 1AXDA 3IOSA 5L71A 1B9YC 3Q18A 4GDFA 1G0TA 3RBTA 1O8WA 4NXIA 1WWJA 5COHA 2VKZG 3CBUA 3HYPA 3TCOA 4WR4A 2N5BA 1ERWA 4KF9A 8GSSA 2GDRA 3F3RA 1YZXA 4IVFA 1NW2A 2H0IA 2OE3A 2V6KA 1ZL9A 4OFTA 4NV5A 1AUCA 1ZOFA 3DD3A 4MZWA 4ECCA 6GSYA 4IBPA 1Z6NA 5DALB 1EGRA 3LEFA 2F9SA 1YEPA 4TXOB 2WFCA 4Q5FA 5KN3A 3TGZA 2EC4A 4YKGA 4AKXB 1F37A 5FT3A 2DSAA 3APQA 3TDGA 2AJQB 4V2MA 2CT6A 3DRNA 5DQSA 3C71A 2EFCA 3UOMA 1HNAA 3H1NA 5HFKA 3EU4A 2L4QA 1K3LA 3I6AA 4H86A 1JZRA 2LUSA 5JWOB 2GZZA 3PINA 2H71A 5GAPD 1PD21 1JZWA 2GTUA 3TJFA 4MNNA 4OCEA 2YWIA 3KH9A 4O5QA 1A2JA 5IMFA 3FZ9A 3ZYWA 1FHEA 4NHZA 3RAZA 5J9CA 3KP8A 3VK9A 1Z7PA 2HRKB 1K0AA 1BF5A 2CX4A 4ZL7A 1OE8A 5ECNB 3KD0A 3E0UA 1A2MA 1THXA 4ID0A 2H30A 5DJMA 1MDIA 2GT6A 3F4RA 3NOFA 2N5FA 1SL0B 1SL1B 1UVZA 2X8HA 2H72A 4TN8A 4YH2A 1CQHA 5ECRB 1GLQA 2LRTA 4OCFA 1TDIA 4K2DA 4K2XA 2L5OA 4OFNA 3ZL5A 3ZFLA 2V6OA 2HRFA 4EC0A 2LEGA 4TR0A 2DIZA 1XFLA 4IGJA 4WBJA 3PH9A 3GN3A 1PX7A 2OKAA 1XOBA 2R2JA 1ZZYA 2V1MA 3F3QA 2IMEA 1TJDA 1T4YA 4MF5A 3KIJA 2LRCA 3US3A 2OACA 1N8JA 1PSQA 4Q5RA 4G0LA 3TJGA 1V98A 4OD7A 1QGVA 5JWQB 2GS3A 5JCUA 5F8BA 3APSA 2GSRA 4IW9A 2RLIA 2QC7A 5KN0A 5LNKe 3L0HA 5INYA 5G31A 3VWXA 2PVOC 5G5EA 3ZIJA 1FVJA 3JCML 4ZBBA 2JACA 5HR1A 2VD1A 4E8HA 4ACSA 3LW9A 1SVOA 2VO4A 1GUHA 2VD0A 4MABA 2VCVA 3CRUA 2PGTA 3H93A 4NHWA 3MNGA 4EKZA 4K5SA 1H75A 1XOAA 5G1LA 2V41A 3V1WA 3GSTA 1T8EB 2R5GA 5A1NA 1I9DA 2TIRA 4OFMA 3GHAA 5ECPB 3P90A 2ES7A 3APOA 3VI7A 4HZ2A 3KXOA 4FO5A 5H5QA 3BCKA 3PGTA 4JBBA 3KGKA 3FRCA 3P8WA 2NTOA 4EVMA 3UMAA 4EL1A 4GRFA 3EYTA 1YF0A 1YF1A 2GZYA 6GSVA 2R0GA 2VOCA 1ERUA 5IOXA 3D22A 2KLXA 4IKHA 4F03A 4G2EA 2LQQA 1KBNA 3F4SA 22GSA 4F82A 1VF4A 2H1AA 1X5EA 3LXZA 2MYGA 2VCZA 1TKDB 1TRWA 3WGXA 3CRTA 2QGVA 3DEXA 4GSSA 1U3IA 4QMKA 2K8SA 3QFAC 3KP9A 5IPHA 1ZYPA 1XBSA 1URMA 3BBYA 4LLRA 5ID2A 2FD3A 3E9JB 1T7PB 1XXUA 3M3MA 3WYWA 2LV3A 3VWWA 4MH2A 1SK2A 4XS6A 2H76A 3TKRA 4F0BA 3IDVA 3LGCA 4EXJA 3UL3A 2JU5A 1A8YA 1SKWB 1V58A 2O85A 2H73A 1U6TA 3LJRA 3ZIVA 3FK8A 1F3AA 1GRXA 4BA7A 2X64A 4AKGA 2YZHA 1XIYA 1SL2B 3I43A 1X0RA 1BAYA 1GNEA 1B9XC 3VI5A 1OC9A 2I1UA 2XC2A 4OWYA 5J4UA 3U5RE 3ERWA 3TKSA 2A4HA 2YNXA 1OYJA 5ELAA 1E2YA 5HR2A 3TUEA 1AIUA 4IJIA 2ON5A 2VAFA 3A3TA 1VRSD 1DSBA 4CW9A 3J7Yk 4PNFA 1FAAA 3R3EA 1RK4A 1ON4A 1RQMA 4CY8A 6GSUA 1GTIA 4KDXA 3W6GA 1TRUA 2OBKA 2E2GA 5B8BA 1GSEA 4BPYA 4HQSA 1KEBA 2H8LA 5F05A 4JZQA 2PWJA 1PL1A 4HOJA 1ST9A 1DE2A 4POKA 4X0XA 2HFDA 5J4YA 5G5FA 2H6YA 4V2NA 3LG6A 5IMDA 2F8AA 4D73B 2ZUPA 2JSYA 2ZCTA 2PERA 2C0FA 3EWLA 4NV2A 3IAS2 3GKMA 2YJ7A 1GSFA 4K7OA 3OR5A 4TR1A 2A2SA 2YV9A 4NAXA 5KOXA 5DJLA 1A0FA 3SWLA 5J40A 1UN2A 13GSA 4ZIJA 4BWQA 5IIZA 3K8NA 4RQRA 2M72A 2PU9C 2XBIA 4N30A 4TOPA 2O89A 2FWFA 2L5LA 2OT3A 2VCXA 3ZZXA 2RUFA 5CRHA 1PGTA 4K6XA 3N5OA 1X5DA 17GSA 5B6NA 1XW5A 1J08A 4JU5A 3HMJG 2L59A 2R0PA 1A2LA 1ZGNA 2DKHA 3DYRA 4FQUA 2H6XA 4X43A 4XIHA 2HI7A 4WEYA 3H4KA 3GIXA 5HR0A 4TRXA 4XRAA 2H0GA 5KN2A 1E6BA 4F2IA 1ACVA 1F2EA 4PX1A 2L6DA 5FHIA 18GSA 2LRNA 4K9ZA 3VWVA 1XZOA 5ABRA 5CO3A 4EO3A 1EOGA 1QK8A 4A5PA 2K8VA 2V2GA 1AC1A 2FCHA 4DSSA 1Z6MA 4HJ2A 1B48A 3S9FA 1JFUA 1X9WB 4QL7A 3TOUA 4MJAA 3DVWA 2CVDA 4WF5A 1NM3A 4HU7A 2H66A 4ICYA 2IFQA 2VCQA 4ZBDA 1TK0B 4TR4A 2IPAA 1BX9A 3F6FA 4MH3A 3M9KA 2JL4A 3LYPA 1LBKA 3FHKA 3QMXA 5DQYA 4NWYA 1GH2A 1BQ7A 2HSMA 2KUCA 1K0DA 4I8BA 1S3AA 2FNOA 2EIQA 1YVLA 3EVIA 5HFIA 4V1Ap 4IS0A 1YKCA 4ZB9A 3GH9A 2IWTA 4TKYA 2I81A 3ME7A 2X8GA 2H74A 3TB2A 5EL8A 3CMIA 1JZDA 5GAND 2VCTA 4ZL8A 3BJ5A 1EZKA 2H1GA 3F8UA 4TW5A 1TU7A 1TXUA 2PBJA 3U6VA 3GMFA 5G30A 1M7TA 3MSZA 3KCMA 1EP7A 4QL9A 4Z7XA 2I9HA 2MMZA 5J4VA 4IP6A 3L9VA 1WRYA 4TR3A 4X4JA 4HZ4A 1T00A 3CSJA 2HRNA 2YZUA 4IJ3A 1WOUA 2YP6A 1UA5A 3DVXA 2GT5A 4MA9A 2DMMA 1PN9A 1ABAA 1SVMA 2PMTA 2TRXA 1UC7A 2ON7A 5IM9A 5G1KA 5DAKA 6GSSA 3UARA 4PTSA 4JRRA 2NPBA 3EMPA 2HZFA 4JR4A 2CV4A 2HYXA 5JCWA 4I97A 4WR5A 5AIXA 2CAIA 2WGRA 1SYXA 2DJJA 5D73A 2M80A 3MIXA 3TOTA 1YDKA 4CY6A 2X4AA 3J7Yb 4KGIA 2X8CA 4NPBA 1T4ZA 4K7NA 4HU9A 5GZZB 2A2RA 1O81A 4L5LA 4W66A 2I4AA 2VIMA 3DXBA 1USBA 5EPFA 2IMIA 1K0CA 1Q4JA 5ELGA 5CRWA 4G10A 3GTUA 5ECLB 5CYYA 2HSHA 1R7HA 4AJ8A 5F07A 5DVBA 2IIYA 1OVNA 2PUKC 5EY6A 1A24A 2LQOA 1TOFA 4V2LA 2HZEA 5E4WA 1PA3A 1XW6A 5F06A 4Z2UA 1T3BA 1C72A 10GSA 4F0CA 3FW2A 4MPGA 1WP0A 4FYUA 5A1NB 3TJBA 4AJ6A 3UEMA 2K9FA 2H75A 3KMOA 4K1FA 2EFEA 4XCSA 1IYIA 3L4NA 1A23A 4E8EA 2YWMA 2XPEA 3LORA 4MJBA 3FR3A 5C04A 1HQOA 3GA4A 14GSA 1SD8A 4KB3A 4N10A 3RPPA 1K0MA 3CYNA 3IC8A 2EIOA 2L4CA 2TRCP 1SYRA 2QKEA 3D6IA 2YPMA 4BVXA 1O6JA 4WXTA 2LNTA 1G7EA 4FYBA 1X9SB 2JSZA 2L6CA 2X99A 2XPDA 3QOUA 1U3AA 2FWEA 4WF4A 2A4VA 2DJ1A 4LMVA 3BOAA 1NHOA 1EWXA 2HNLA 3MWHA 5A34A 2A2PA 5ID2B 2HT9A 3ZITA 2FUG2 4GQCA 4ZB8A 1QMVA 3LXTA 1HD2A 3QDNA 4XRDA 1O7UA 4ILFA 4JEDA 3EINA 1DBYA 3MDKA 5B8AA 4MZBA 2R6KA 4G19A 2DJ0A 2AYTA 3G7YA 1XCCA 2UV8G 2H1BA 4OMVA 3GURA 5D9TA 3HDCA 4FIWA 3IA1A 1GSSA 3IPZA 4J57E 2IMKA 3R2QA 3UVHA 2YV7A 1SU9A 3KZQA 4PQIA 3QPMA 5IO0A 1OE7A 3VPQA 2C4JA 1JHBA 1OC9B 1NHYA 3IHGA 1JLWA 2E2MA 2HXKA 2P0GA 2PN8A 5IMCA 1GTBA 2RUEA 2IMFA 4N0ZA 4KSOA 3A2WA 3BD2A 1KTEA 5KN1A 1PRXA 16GSA 1W4VA 2VM1A 3VLNA 4XTSA 1AQXA 1J9BA 1R26A 1K3OA 3KTLA 1PN0A 1PL2A 3PPUA 12GSA 1AAZA 2DBCA 1PMTA 3DWVA 1OC8A 5ECMB 1TI1A 3EU3A 2CAQA 5J41A 2VLVA 5GSTA 1I5GA 5HFGA 1GTUA 3EURA 4MJEA 3KEBA 3BCIA 4GCIA 4AI6A 4LMWA 2FLSA 3G7JA 1MDJA 4GSTA 1R5AA 1MTCA 3I9V2 4LA1A 5ECIB 1W89A 1AW9A 4OO4A 1B4QA 1F9MA 5G2ZA 3PR8A 3TRQA 2PVQA 2B3SA 3HZ8A 4PXOA 2P5RA 4HS1A 3FZAA 1H4OA 4PGTA 2MZCA 2XBQA 2VCWA 4I5QA 2H1DA 4YQMA 3LSZA 4TR1B 5ENUA 4K0GA 1XWCA 5D9VA 3Q19A 1DE1A 2MMAA 3RHCA 1K0OA 1TRSA 4PURA 4BL7A 4ECIA 3ZMKA 4HEA2 1GTAA 1PKZA 2HRAA 2DLXA 3UBKA 5J3RA 1ZYQB 3KTBA 3FYGA 1ILOA 1SVLA 1M2BA 1OKDA 3HY2A 3ZMLA 3H8QA 5D9WA 3HVXA 2WRTA 4JE1A 3TRPA 3CXGA 1LU4A 4PUFC 1B4PA 3P7XA 4O32A 4DSRA 3LFLA 3EMXA 2NDOA 1ZYEA 1CQGA 1QXHA 3L9UA 1MDKA 4BVYA 2VUPA 1GULA 2WJUA 2RM5A 1G6WA 4O5RA 2B7JA 4DVCA 1TK5B 9GSSA 2CA8A 4WETA 4WBRD 2B6MA 3ED3A 2JZSA 3IC4A 2VL9A 3VWUA 4TVEA 1QQ2A 3VPTA 4AKIA 5D93A 3LWAA 4POMA 4HDEA 4PQ1A 4GSNA 1SJZA 4IHUA 3LQ7A 2P31A 3O3TA 4DSSB 2R0CA 5D96A 3ME8A 4G0IA 3Q74A 5IPGA 3D4MA 4EUYA 5B7CA 1Y1UA 2QSIA 2HSNA 2IL3A 1GSDA 2F8FA 2VL3A 4K0NA 1XWAA 2IFQB 3GKNA 3IK9A 4GXZA 1YKAA 4Z2RA 1WMJA 3G9BA 4KW6A 1ERVA 3CSIA 1FB0A 2HSYA 1MD3A 2C0EA 1OAZA 3IBHA 4XHMA 1R5PA 2KP1A 1M0UA 1BYEA 2UZ8A 2I3YA 5DDLA 5CREA 4QQ7A 1N25A 2H01A 4RI7A 2FWGA 2VLUA 4YKFA 2HSMB 3CTGA 2LSTA 1SK0A 2B5EA 4E68A 2G0FA 3HXSA 5CAXA 4IELA 3HVSA 2M46A 5ECKB 3SBCA 4J56E 5JWRB 5IO2A 2LNSA 1V40A 4CHSA 2OJLA 1VF1A 1BJXA 2WCIA 2JADA 4MMMA 4EDYA 2O7KA 7GSSA 4L8EA 1K0NA 1TTZA 1FOVA 3C8EA 1M99A 2V32A 4ECBA 5LCZA 1A0RP 2O8VB 3RPNA 5IOWA 2GQKA 4KDUA 3UBLA 2VM2A 4MK3A 4K8MA 4XS4A 4JR6A 4K7IA 5AN1A 5A5HA 5HR3A 4GLTA 2FHEA 4O7HA 1S3DA 5A4UA 3QCPA 1GP1A 3FR9A 2WB9A 3O76A 3IHQA 2FY6A 5BRTA 5DAKB 3C1SA 5AIVA 3HJPA 4KX4A 1THOA 1TXXA 1U88A 1HNBA 4IQAA 4V1Ag 4ZXGA 1WJKA 2DMLA 5B6MA 2L57A 1VF2A 2PPTA 1X5CA 3TKQA 1EV9A 2AUVA 3QAVA 5JCGA 1EV4A 3HHVA 3A2VA 4AF2A 1X9MB 3DIEA 4OO5A 2VL2C 3GX8A 4DSQA 1GUKA 4AKHA 3FY7A 3N9JA 1DUGA 3ZVJA 5BMUA 3GTUB 2B1KA 3GYKA 4LL1B 4KCEA 2R3XA 19GSA 5ECSA 2GSSA 2ZNMA 4KUNA 3GSSA 4Q5QA 5IMAA 3A2XA 2HZEB 5DBQA 2E7PA 2AV4A 2IMDA 3IRAA 2WZ9A 3TKPA 2LTKA 3HJOA 4AGSA 1XWBA 1XWGA 3QR6A 3E3EA 2JZTA 3FZ5A 2GSQA 1GWCA 6GSTA 2B5YA 4DEJA 4PUAA 2GQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSU A;  2GZP A;  4MP4 A;  3C1R A;  4G9H A;  1WE0 A;  3WT2 A;  5DAL A;  4BVX B;  3VFI A;  5D8I A;  3IR4 A;  4F9Z A;  2C80 A;  4TXO A;  2WS2 A;  5A4W A;  3D5J A;  1SD9 A;  5AIS A;  3F0I A;  3NIV A;  4RI6 A;  1O73 A;  2KP2 A;  1PKW A;  1EEJ A;  2N5A A;  3M8N A;  1V9W A;  1V2A A;  1OC3 A;  4MZC A;  5A5K A;  5J5N A;  3M9J A;  4YQV A;  3DML A;  4EF0 A;  4GF0 A;  2YCD A;  4EDZ A;  2OA7 A;  4N0V A;  4O92 A;  2CX3 A;  2H70 A;  4ZB6 A;  2K6V A;  4X1U A;  2B1L A;  1T1V A;  2O87 A;  3VUR A;  4HI7 A;  4KND A;  5FWG A;  1G6Y A;  3O6T A;  3L9S A;  4IP1 A;  3ERF A;  1PQN A;  2LJA A;  3W8S A;  2HRK A;  5DCG A;  2RM6 A;  5LD0 A;  1JLV A;  2MMO A;  20GS A;  1SJI A;  1G7O A;  1M2D A;  4KA0 A;  4KSM A;  3DGQ A;  1HYU A;  1GLP A;  1NSW A;  1HNC A;  2AB6 A;  5H5R A;  4PQH A;  1GL8 A;  4I6X A;  2REM A;  3WD6 A;  3CSH A;  1K0B A;  3D4T A;  2R37 A;  5GSS A;  4ECJ A;  1Y6E A;  1S3C A;  3TRX A;  2GGT A;  5ECO B;  3GKX A;  3KH7 A;  4LL4 B;  1VGL A;  5CNW A;  3GKK A;  5HQP A;  2JZR A;  1YY7 A;  2LKU A;  4L5O A;  2P5Q A;  4YAP A;  2YJH A;  3W8J A;  3AY8 A;  2K18 A;  1SKR B;  2DJ2 A;  2CVB A;  3ZRE A;  4KCA A;  1QUW A;  3GX0 A;  4POB A;  3IK7 A;  1WIK A;  3EC3 A;  3IXR A;  1Z5Y E;  2LJR A;  3LYK A;  4USS A;  4KAE A;  1TU8 A;  2OAD A;  3EE2 A;  3HA9 A;  1V57 A;  2GVP A;  3KMN A;  2DJ3 A;  3ISO A;  1FVK A;  1XW9 A;  2OE0 A;  2FA8 A;  5ECH B;  1EEM A;  5EVO A;  4GQF A;  3ERG A;  2FA4 A;  4MLY A;  3TJK A;  2F3M A;  4YAV A;  2C3Q A;  1GSY A;  3M0F A;  5E59 A;  2GST A;  1SJ6 A;  4ZL9 A;  2HLS A;  2HE3 A;  4KDY A;  2H0H A;  4ZBA A;  2CQ9 A;  1XVQ A;  2WUL A;  3HVV A;  2H6Z A;  1RW1 A;  1Z7R A;  4BL7 B;  5IMZ A;  2DJK A;  2C0D A;  3HJM A;  5CRG A;  2XHF A;  2D2Z A;  2YOI A;  4YQU A;  3F9U A;  3D0Z A;  2GQM A;  2LJK A;  2CVK A;  1TI3 A;  3GRX A;  1VF3 A;  2KHP A;  1SEN A;  3DKS A;  4PNG A;  2RII A;  3HZ4 A;  1ZMA A;  1U87 A;  3FZ4 A;  2KOK A;  1MEK A;  3UJ1 A;  3ZLP A;  1O8X A;  5CRD A;  4KE3 A;  1YEX A;  4BWS A;  1YQ1 A;  2OBI A;  4CDO A;  1EP8 A;  4BVY B;  2LS5 A;  4MF6 A;  2C3T A;  2B5X A;  3MAK A;  3M1G A;  4GTU A;  3C7M A;  2OE1 A;  3ZFB A;  5J9B A;  2B7K A;  2AHE A;  3WGE A;  5A4V A;  3QAW A;  4N11 A;  4L0W A;  1AQV A;  2C1Y A;  2DC5 A;  3F6D A;  4HJM A;  3WT1 A;  2H19 A;  1ERT A;  3C73 A;  1M9B A;  5ECQ B;  2MBS A;  3GV1 A;  2E0Q A;  2CZ3 A;  1EOH A;  5C00 A;  2ALB A;  2MBT A;  1TP9 A;  3F63 A;  2IN3 A;  3NZN A;  2CZ2 A;  3WGD A;  1FO5 A;  1BG5 A;  3HKR A;  1XVW A;  3D21 A;  2C3N A;  4HUA A;  4I2U A;  2C8U A;  3I69 A;  4J2F A;  4XS1 A;  3A5W A;  3GL3 A;  1KNG A;  1A8L A;  3P2A A;  3ZTL A;  2AAW A;  2YWO A;  2C0G A;  4GWR A;  3GH6 A;  4IN0 A;  5KEJ A;  3IAM 2;  2HSN B;  1Z3E A;  3HD5 A;  3RHB A;  3UAP A;  2BJX A;  3UVT A;  1YJ6 A;  2MMN A;  3CTF A;  5IQY A;  4FYC A;  1F3B A;  4ML6 A;  1GNW A;  4Q5N A;  2F51 A;  1QFN A;  1SK1 A;  5CP1 A;  2FGX A;  4L0U A;  1O85 A;  3KJY A;  2Z9S A;  4ULX A;  5H5S A;  3Q6O A;  4KH7 A;  2YN1 A;  2DIY A;  4ZIL A;  3KM6 A;  3QFB C;  1XPV A;  4MCU A;  3IV4 A;  4TXV A;  1Y25 A;  1FG4 A;  3HCZ A;  4FH8 A;  3QD9 A;  1B8X A;  2IJY A;  4ISD A;  4POL A;  3IE3 A;  1JZO A;  4MF7 A;  5AGY A;  1FW1 A;  2GLR A;  3GL5 A;  3FKF A;  1EGO A;  1N2A A;  2NVL A;  2BMX A;  3L78 A;  2NBS A;  2G2Q A;  3GUS A;  1PX6 A;  3TKS C;  2J23 A;  1FB6 A;  2VLT A;  4NMU A;  4XS4 B;  1BED A;  3FR6 A;  2J9H A;  2R4V A;  4IQ1 A;  1SKS B;  2VL2 A;  4D73 A;  2EIR A;  1Z9H A;  4MPF A;  3ZRD A;  5F0G A;  4AJ7 A;  1GUM A;  4I2T A;  1TK8 B;  3FEU A;  5D9X A;  2HQT A;  1LJR A;  5DCH A;  1IYH A;  3F4T A;  1M9A A;  3G7I A;  4RQX A;  2YAN A;  1R4W A;  3GNJ A;  6GSW A;  1XWK A;  3ZVJ D;  1AQW A;  2FWH A;  3RDW A;  3TKS E;  1K3Y A;  4MJC A;  4G0K A;  1F6M C;  3GFK A;  1J0F A;  4EE0 A;  4WKW A;  1MD4 A;  2YWN A;  4P3Y B;  1M2A A;  3UIW A;  1WPI A;  4HQZ A;  1GSQ A;  1ZCP A;  4RUV A;  1ML6 A;  1Q98 A;  2BTO T;  3QAG A;  1OKT A;  2WDU A;  3TJJ A;  3H79 A;  5IMV A;  11GS A;  1TW9 A;  4MDC A;  1TRV A;  6GSX A;  4ML1 A;  1AXD A;  3IOS A;  5L71 A;  1B9Y C;  3Q18 A;  1G0T A;  3RBT A;  1O8W A;  4NXI A;  1WWJ A;  5COH A;  3CBU A;  3HYP A;  3TCO A;  4WR4 A;  2N5B A;  1ERW A;  4KF9 A;  8GSS A;  2GDR A;  3F3R A;  1YZX A;  4IVF A;  1NW2 A;  2H0I A;  2OE3 A;  2V6K A;  1ZL9 A;  4OFT A;  4NV5 A;  1AUC A;  1ZOF A;  3DD3 A;  4MZW A;  4ECC A;  6GSY A;  4IBP A;  1Z6N A;  5DAL B;  1EGR A;  3LEF A;  2F9S A;  1YEP A;  4TXO B;  2WFC A;  4Q5F A;  5KN3 A;  3TGZ A;  2EC4 A;  1F37 A;  5FT3 A;  2DSA A;  3APQ A;  3TDG A;  2AJQ B;  4V2M A;  2CT6 A;  3DRN A;  5DQS A;  3C71 A;  3UOM A;  1HNA A;  3H1N A;  5HFK A;  3EU4 A;  2L4Q A;  1K3L A;  3I6A A;  4H86 A;  1JZR A;  2LUS A;  5JWO B;  2GZZ A;  3PIN A;  2H71 A;  5GAP D;  1PD2 1;  1JZW A;  2GTU A;  3TJF A;  4OCE A;  2YWI A;  3KH9 A;  1A2J A;  5IMF A;  3FZ9 A;  3ZYW A;  1FHE A;  4NHZ A;  3RAZ A;  5J9C A;  3KP8 A;  3VK9 A;  1Z7P A;  2HRK B;  1K0A A;  2CX4 A;  4ZL7 A;  1OE8 A;  5ECN B;  3KD0 A;  3E0U A;  1A2M A;  1THX A;  4ID0 A;  2H30 A;  5DJM A;  1MDI A;  2GT6 A;  3F4R A;  3NOF A;  2N5F A;  1SL0 B;  1SL1 B;  1UVZ A;  2X8H A;  2H72 A;  4TN8 A;  4YH2 A;  1CQH A;  5ECR B;  1GLQ A;  2LRT A;  4OCF A;  1TDI A;  4K2D A;  2L5O A;  4OFN A;  3ZL5 A;  3ZFL A;  2V6O A;  2HRF A;  4EC0 A;  2LEG A;  4TR0 A;  2DIZ A;  1XFL A;  4IGJ A;  4WBJ A;  3PH9 A;  3GN3 A;  1PX7 A;  2OKA A;  1XOB A;  2R2J A;  1ZZY A;  2V1M A;  3F3Q A;  2IME A;  1TJD A;  1T4Y A;  4MF5 A;  3KIJ A;  2LRC A;  3US3 A;  2OAC A;  1N8J A;  1PSQ A;  4Q5R A;  4G0L A;  3TJG A;  1V98 A;  4OD7 A;  1QGV A;  5JWQ B;  2GS3 A;  5JCU A;  5F8B A;  3APS A;  2GSR A;  4IW9 A;  2RLI A;  2QC7 A;  5KN0 A;  5LNK e;  3L0H A;  5INY A;  5G31 A;  3VWX A;  2PVO C;  5G5E A;  3ZIJ A;  1FVJ A;  3JCM L;  4ZBB A;  2JAC A;  5HR1 A;  2VD1 A;  4E8H A;  4ACS A;  2VO4 A;  1GUH A;  2VD0 A;  4MAB A;  2VCV A;  3CRU A;  2PGT A;  3H93 A;  4NHW A;  3MNG A;  4EKZ A;  1H75 A;  1XOA A;  5G1L A;  2V41 A;  3V1W A;  3GST A;  1T8E B;  2R5G A;  1I9D A;  2TIR A;  4OFM A;  3GHA A;  5ECP B;  3P90 A;  2ES7 A;  3APO A;  3VI7 A;  4HZ2 A;  3KXO A;  4FO5 A;  5H5Q A;  3BCK A;  3PGT A;  4JBB A;  3KGK A;  3FRC A;  3P8W A;  2NTO A;  4EVM A;  3UMA A;  4EL1 A;  4GRF A;  3EYT A;  1YF0 A;  1YF1 A;  2GZY A;  6GSV A;  2VOC A;  1ERU A;  5IOX A;  3D22 A;  2KLX A;  4IKH A;  4F03 A;  4G2E A;  2LQQ A;  1KBN A;  3F4S A;  22GS A;  4F82 A;  1VF4 A;  2H1A A;  1X5E A;  3LXZ A;  2MYG A;  2VCZ A;  1TKD B;  1TRW A;  3WGX A;  3CRT A;  2QGV A;  3DEX A;  4GSS A;  1U3I A;  2K8S A;  3QFA C;  3KP9 A;  5IPH A;  1XBS A;  1URM A;  3BBY A;  4LLR A;  5ID2 A;  2FD3 A;  3E9J B;  1T7P B;  1XXU A;  3M3M A;  3WYW A;  2LV3 A;  3VWW A;  4MH2 A;  1SK2 A;  4XS6 A;  2H76 A;  3TKR A;  4F0B A;  3IDV A;  3LGC A;  4EXJ A;  3UL3 A;  2JU5 A;  1A8Y A;  1SKW B;  1V58 A;  2O85 A;  2H73 A;  1U6T A;  3LJR A;  3ZIV A;  3FK8 A;  1F3A A;  1GRX A;  4BA7 A;  2X64 A;  2YZH A;  1XIY A;  1SL2 B;  3I43 A;  1X0R A;  1BAY A;  1GNE A;  1B9X C;  3VI5 A;  1OC9 A;  2I1U A;  2XC2 A;  4OWY A;  5J4U A;  3U5R E;  3ERW A;  3TKS A;  2YNX A;  1OYJ A;  5ELA A;  1E2Y A;  5HR2 A;  3TUE A;  1AIU A;  4IJI A;  2ON5 A;  2VAF A;  3A3T A;  1VRS D;  1DSB A;  4CW9 A;  3J7Y k;  4PNF A;  1FAA A;  3R3E A;  1RK4 A;  1ON4 A;  1RQM A;  6GSU A;  1GTI A;  4KDX A;  3W6G A;  1TRU A;  2OBK A;  2E2G A;  5B8B A;  1GSE A;  4BPY A;  4HQS A;  1KEB A;  2H8L A;  5F05 A;  4JZQ A;  2PWJ A;  1PL1 A;  4HOJ A;  1ST9 A;  1DE2 A;  4POK A;  4X0X A;  2HFD A;  5G5F A;  2H6Y A;  4V2N A;  3LG6 A;  5IMD A;  2F8A A;  4D73 B;  2ZUP A;  2JSY A;  2ZCT A;  2PER A;  2C0F A;  3EWL A;  4NV2 A;  3IAS 2;  3GKM A;  2YJ7 A;  1GSF A;  4K7O A;  3OR5 A;  4TR1 A;  2A2S A;  2YV9 A;  4NAX A;  5DJL A;  1A0F A;  3SWL A;  1UN2 A;  13GS A;  4ZIJ A;  4BWQ A;  5IIZ A;  3K8N A;  4RQR A;  2M72 A;  2PU9 C;  2XBI A;  4N30 A;  4TOP A;  2O89 A;  2FWF A;  2L5L A;  2VCX A;  3ZZX A;  2RUF A;  5CRH A;  1PGT A;  4K6X A;  3N5O A;  1X5D A;  17GS A;  5B6N A;  1XW5 A;  1J08 A;  4JU5 A;  2L59 A;  1A2L A;  1ZGN A;  3DYR A;  4FQU A;  2H6X A;  4X43 A;  4XIH A;  2HI7 A;  4WEY A;  3H4K A;  3GIX A;  5HR0 A;  4TRX A;  4XRA A;  2H0G A;  5KN2 A;  1E6B A;  4F2I A;  1ACV A;  1F2E A;  4PX1 A;  2L6D A;  5FHI A;  18GS A;  2LRN A;  4K9Z A;  3VWV A;  1XZO A;  5ABR A;  5CO3 A;  4EO3 A;  1EOG A;  1QK8 A;  2K8V A;  2V2G A;  1AC1 A;  2FCH A;  4DSS A;  1Z6M A;  4HJ2 A;  1B48 A;  3S9F A;  1JFU A;  1X9W B;  4QL7 A;  3TOU A;  4MJA A;  3DVW A;  2CVD A;  4WF5 A;  1NM3 A;  4HU7 A;  2H66 A;  2IFQ A;  2VCQ A;  4ZBD A;  1TK0 B;  4TR4 A;  2IPA A;  1BX9 A;  3F6F A;  4MH3 A;  3M9K A;  2JL4 A;  3LYP A;  1LBK A;  3FHK A;  3QMX A;  5DQY A;  4NWY A;  1GH2 A;  1BQ7 A;  2HSM A;  2KUC A;  1K0D A;  4I8B A;  1S3A A;  2FNO A;  2EIQ A;  3EVI A;  5HFI A;  4V1A p;  4IS0 A;  1YKC A;  4ZB9 A;  3GH9 A;  2IWT A;  4TKY A;  2I81 A;  3ME7 A;  2X8G A;  2H74 A;  3TB2 A;  5EL8 A;  3CMI A;  1JZD A;  5GAN D;  2VCT A;  4ZL8 A;  3BJ5 A;  1EZK A;  2H1G A;  3F8U A;  4TW5 A;  1TU7 A;  2PBJ A;  3U6V A;  3GMF A;  5G30 A;  1M7T A;  3MSZ A;  3KCM A;  1EP7 A;  4QL9 A;  4Z7X A;  2I9H A;  2MMZ A;  4IP6 A;  3L9V A;  1WRY A;  4TR3 A;  4HZ4 A;  1T00 A;  3CSJ A;  2HRN A;  2YZU A;  4IJ3 A;  1WOU A;  2YP6 A;  1UA5 A;  3DVX A;  2GT5 A;  4MA9 A;  2DMM A;  1PN9 A;  1ABA A;  2PMT A;  2TRX A;  1UC7 A;  2ON7 A;  5IM9 A;  5G1K A;  5DAK A;  6GSS A;  3UAR A;  4PTS A;  4JRR A;  2NPB A;  3EMP A;  2HZF A;  4JR4 A;  2CV4 A;  2HYX A;  5JCW A;  4I97 A;  4WR5 A;  5AIX A;  2CAI A;  2WGR A;  1SYX A;  2DJJ A;  5D73 A;  2M80 A;  3TOT A;  1YDK A;  3J7Y b;  4KGI A;  2X8C A;  4NPB A;  1T4Z A;  4K7N A;  4HU9 A;  5GZZ B;  2A2R A;  1O81 A;  4L5L A;  2I4A A;  2VIM A;  3DXB A;  1USB A;  5EPF A;  2IMI A;  1K0C A;  1Q4J A;  5ELG A;  5CRW A;  4G10 A;  3GTU A;  5ECL B;  5CYY A;  2HSH A;  1R7H A;  4AJ8 A;  5F07 A;  5DVB A;  2IIY A;  1OVN A;  2PUK C;  5EY6 A;  1A24 A;  2LQO A;  1TOF A;  4V2L A;  2HZE A;  5E4W A;  1PA3 A;  1XW6 A;  5F06 A;  1T3B A;  1C72 A;  10GS A;  4F0C A;  3FW2 A;  4MPG A;  1WP0 A;  4FYU A;  3TJB A;  4AJ6 A;  3UEM A;  2K9F A;  2H75 A;  3KMO A;  4K1F A;  4XCS A;  1IYI A;  3L4N A;  1A23 A;  4E8E A;  2YWM A;  2XPE A;  3LOR A;  4MJB A;  3FR3 A;  5C04 A;  1HQO A;  3GA4 A;  14GS A;  1SD8 A;  4KB3 A;  4N10 A;  3RPP A;  1K0M A;  3CYN A;  3IC8 A;  2EIO A;  2L4C A;  2TRC P;  1SYR A;  2QKE A;  3D6I A;  2YPM A;  4BVX A;  1O6J A;  4WXT A;  2LNT A;  1G7E A;  4FYB A;  1X9S B;  2JSZ A;  2L6C A;  2X99 A;  2XPD A;  3QOU A;  1U3A A;  2FWE A;  4WF4 A;  2A4V A;  2DJ1 A;  4LMV A;  3BOA A;  1NHO A;  1EWX A;  2HNL A;  3MWH A;  5ID2 B;  2HT9 A;  3ZIT A;  2FUG 2;  4GQC A;  4ZB8 A;  1QMV A;  3LXT A;  1HD2 A;  3QDN A;  4XRD A;  1O7U A;  4ILF A;  4JED A;  3EIN A;  1DBY A;  3MDK A;  5B8A A;  4MZB A;  2R6K A;  4G19 A;  2DJ0 A;  2AYT A;  3G7Y A;  1XCC A;  2H1B A;  4OMV A;  3GUR A;  5D9T A;  3HDC A;  4FIW A;  3IA1 A;  1GSS A;  3IPZ A;  4J57 E;  2IMK A;  3R2Q A;  3UVH A;  2YV7 A;  1SU9 A;  3KZQ A;  4PQI A;  3QPM A;  5IO0 A;  1OE7 A;  3VPQ A;  2C4J A;  1JHB A;  1OC9 B;  1NHY A;  1JLW A;  2E2M A;  2HXK A;  2P0G A;  2PN8 A;  5IMC A;  1GTB A;  2RUE A;  2IMF A;  4N0Z A;  4KSO A;  3A2W A;  3BD2 A;  1KTE A;  5KN1 A;  1PRX A;  16GS A;  1W4V A;  2VM1 A;  3VLN A;  4XTS A;  1AQX A;  1J9B A;  1R26 A;  1K3O A;  3KTL A;  1PL2 A;  3PPU A;  12GS A;  1AAZ A;  2DBC A;  1PMT A;  3DWV A;  1OC8 A;  5ECM B;  1TI1 A;  3EU3 A;  2CAQ A;  5J41 A;  2VLV A;  5GST A;  1I5G A;  5HFG A;  1GTU A;  3EUR A;  4MJE A;  3KEB A;  3BCI A;  4GCI A;  4LMW A;  2FLS A;  3G7J A;  1MDJ A;  4GST A;  1R5A A;  1MTC A;  3I9V 2;  4LA1 A;  5ECI B;  1W89 A;  1AW9 A;  4OO4 A;  1B4Q A;  1F9M A;  5G2Z A;  3PR8 A;  3TRQ A;  2PVQ A;  2B3S A;  3HZ8 A;  4PXO A;  2P5R A;  4HS1 A;  3FZA A;  1H4O A;  4PGT A;  2MZC A;  2XBQ A;  2VCW A;  4I5Q A;  2H1D A;  4YQM A;  3LSZ A;  4TR1 B;  5ENU A;  4K0G A;  1XWC A;  5D9V A;  3Q19 A;  1DE1 A;  2MMA A;  3RHC A;  1K0O A;  1TRS A;  4PUR A;  4BL7 A;  4ECI A;  3ZMK A;  4HEA 2;  1GTA A;  1PKZ A;  2HRA A;  2DLX A;  3UBK A;  5J3R A;  1ZYQ B;  3KTB A;  3FYG A;  1ILO A;  1M2B A;  1OKD A;  3HY2 A;  3ZML A;  3H8Q A;  5D9W A;  3HVX A;  2WRT A;  4JE1 A;  3TRP A;  3CXG A;  1LU4 A;  4PUF C;  1B4P A;  3P7X A;  4O32 A;  4DSR A;  3LFL A;  3EMX A;  2NDO A;  1ZYE A;  1CQG A;  1QXH A;  3L9U A;  1MDK A;  4BVY A;  2VUP A;  1GUL A;  2WJU A;  2RM5 A;  1G6W A;  4O5R A;  2B7J A;  4DVC A;  1TK5 B;  9GSS A;  2CA8 A;  4WET A;  4WBR D;  2B6M A;  3ED3 A;  2JZS A;  3IC4 A;  2VL9 A;  3VWU A;  4TVE A;  1QQ2 A;  3VPT A;  5D93 A;  3LWA A;  4POM A;  4HDE A;  4PQ1 A;  4GSN A;  1SJZ A;  4IHU A;  3LQ7 A;  2P31 A;  3O3T A;  4DSS B;  5D96 A;  3ME8 A;  4G0I A;  3Q74 A;  5IPG A;  3D4M A;  4EUY A;  5B7C A;  2QSI A;  2IL3 A;  1GSD A;  2F8F A;  2VL3 A;  4K0N A;  1XWA A;  2IFQ B;  3GKN A;  3IK9 A;  4GXZ A;  1YKA A;  1WMJ A;  3G9B A;  4KW6 A;  1ERV A;  3CSI A;  1FB0 A;  2HSY A;  1MD3 A;  2C0E A;  1OAZ A;  3IBH A;  4XHM A;  1R5P A;  2KP1 A;  1M0U A;  1BYE A;  2UZ8 A;  2I3Y A;  5DDL A;  5CRE A;  4QQ7 A;  2H01 A;  4RI7 A;  2FWG A;  2VLU A;  2HSM B;  3CTG A;  2LST A;  1SK0 A;  2B5E A;  2G0F A;  3HXS A;  5CAX A;  4IEL A;  3HVS A;  2M46 A;  5ECK B;  3SBC A;  4J56 E;  5JWR B;  5IO2 A;  2LNS A;  1V40 A;  4CHS A;  2OJL A;  1VF1 A;  1BJX A;  2WCI A;  2JAD A;  4MMM A;  4EDY A;  2O7K A;  7GSS A;  4L8E A;  1K0N A;  1TTZ A;  1FOV A;  3C8E A;  1M99 A;  2V32 A;  4ECB A;  5LCZ A;  1A0R P;  2O8V B;  3RPN A;  5IOW A;  2GQK A;  4KDU A;  3UBL A;  2VM2 A;  4MK3 A;  4K8M A;  4XS4 A;  4JR6 A;  4K7I A;  5AN1 A;  5HR3 A;  4GLT A;  2FHE A;  4O7H A;  1S3D A;  5A4U A;  3QCP A;  1GP1 A;  3FR9 A;  2WB9 A;  3O76 A;  3IHQ A;  2FY6 A;  5DAK B;  3C1S A;  5AIV A;  3HJP A;  4KX4 A;  1THO A;  1TXX A;  1U88 A;  1HNB A;  4IQA A;  4V1A g;  4ZXG A;  1WJK A;  2DML A;  5B6M A;  2L57 A;  1VF2 A;  2PPT A;  1X5C A;  3TKQ A;  1EV9 A;  2AUV A;  3QAV A;  5JCG A;  1EV4 A;  3HHV A;  3A2V A;  4AF2 A;  1X9M B;  3DIE A;  4OO5 A;  2VL2 C;  3GX8 A;  4DSQ A;  1GUK A;  3FY7 A;  3N9J A;  1DUG A;  3ZVJ A;  5BMU A;  3GTU B;  2B1K A;  3GYK A;  4LL1 B;  4KCE A;  2R3X A;  19GS A;  5ECS A;  2GSS A;  2ZNM A;  4KUN A;  3GSS A;  4Q5Q A;  5IMA A;  3A2X A;  2HZE B;  5DBQ A;  2E7P A;  2AV4 A;  2IMD A;  3IRA A;  2WZ9 A;  3TKP A;  2LTK A;  3HJO A;  4AGS A;  1XWB A;  1XWG A;  3QR6 A;  3E3E A;  2JZT A;  3FZ5 A;  2GSQ A;  1GWC A;  6GST A;  2B5Y A;  4DEJ A;  4PUA A;  2GQL A; 
#chains in the Genus database with same CATH topology
 4EIQ A;  1GSU A;  2GZP A;  4MP4 A;  3C1R A;  4G9H A;  1WE0 A;  3WT2 A;  5DAL A;  4BVX B;  3VFI A;  5D8I A;  3IR4 A;  4F9Z A;  2C80 A;  4TXO A;  2WS2 A;  5A4W A;  3D5J A;  1SD9 A;  5AIS A;  3F0I A;  3NIV A;  4RI6 A;  1O73 A;  2KP2 A;  1PKW A;  1EEJ A;  2N5A A;  3M8N A;  1V9W A;  1V2A A;  1OC3 A;  4MZC A;  5A34 B;  5A5K A;  5J5N A;  3M9J A;  4YQV A;  3DML A;  4EF0 A;  4GF0 A;  3CWG A;  2YCD A;  2X49 A;  4EDZ A;  2OA7 A;  4N0V A;  4K5R A;  4O92 A;  2CX3 A;  2H70 A;  3FMW A;  4ZB6 A;  2K6V A;  4X1U A;  2H1L A;  2B1L A;  1T1V A;  2O87 A;  3VUR A;  4HI7 A;  4KND A;  3EPT A;  5FWG A;  1G6Y A;  3O6T A;  3L9S A;  4IP1 A;  4EIP A;  3ERF A;  1PQN A;  2LJA A;  3W8S A;  2QA2 A;  3HVN A;  2HRK A;  5DCG A;  2RM6 A;  5LD0 A;  1JLV A;  2MMO A;  20GS A;  1SJI A;  1G7O A;  1M2D A;  4KA0 A;  4KSM A;  3DGQ A;  1HYU A;  1GLP A;  1NSW A;  1HNC A;  2AB6 A;  5H5R A;  4PQH A;  1GL8 A;  4I6X A;  2REM A;  3WD6 A;  3CSH A;  1K0B A;  3D4T A;  2R37 A;  5GSS A;  4ECJ A;  1Y6E A;  1S3C A;  3TRX A;  2GGT A;  2WVY A;  5ECO B;  3GKX A;  3KH7 A;  4LL4 B;  1VGL A;  5CNW A;  3GKK A;  5HQP A;  2JZR A;  1YY7 A;  2LKU A;  4L5O A;  2P5Q A;  4G01 A;  2DKI A;  4YAP A;  2YJH A;  3W8J A;  3AY8 A;  2K18 A;  1SKR B;  2DJ2 A;  1BG1 A;  4O5U A;  2CVB A;  3ZRE A;  4KCA A;  1QUW A;  3GX0 A;  4POB A;  3IK7 A;  1WIK A;  3EC3 A;  3IXR A;  1Z5Y E;  2LJR A;  3LYK A;  4USS A;  4KAE A;  1TU8 A;  2OAD A;  3EE2 A;  3HA9 A;  1V57 A;  2GVP A;  3KMN A;  2DJ3 A;  3ISO A;  1FVK A;  1XW9 A;  2OE0 A;  2FA8 A;  5J47 A;  5ECH B;  1EEM A;  5EVO A;  4GQF A;  3ERG A;  2FA4 A;  4MLY A;  3TJK A;  2F3M A;  4YAV A;  2C3Q A;  2O5V A;  1GSY A;  3M0F A;  5E59 A;  2GST A;  1SJ6 A;  4ZL9 A;  2HLS A;  2HE3 A;  4KDY A;  2WZS A;  2H0H A;  4ZBA A;  2CQ9 A;  1XVQ A;  2WUL A;  3HVV A;  2H6Z A;  1RW1 A;  1Z7R A;  4BL7 B;  5IMZ A;  2DJK A;  2C0D A;  3HJM A;  5CRG A;  2XHF A;  2D2Z A;  2YOI A;  4YQU A;  3F9U A;  3D0Z A;  2GQM A;  2LJK A;  2CVK A;  1TI3 A;  4PI2 C;  3GRX A;  1VF3 A;  2KHP A;  1SEN A;  3DKS A;  4PNG A;  2WVX B;  2RII A;  3HZ4 A;  1ZMA A;  1U87 A;  3FZ4 A;  2KOK A;  1MEK A;  3UJ1 A;  2WW3 A;  3ZLP A;  1O8X A;  5CRD A;  4KE3 A;  1YEX A;  4BWS A;  1YQ1 A;  2OBI A;  4CDO A;  1EP8 A;  4BVY B;  3TU3 B;  2LS5 A;  4MF6 A;  2C3T A;  2B5X A;  3MAK A;  3M1G A;  4GTU A;  3C7M A;  2OE1 A;  3ZFB A;  5J9B A;  2B7K A;  2AHE A;  3WGE A;  5A4V A;  3QAW A;  4N11 A;  4L0W A;  1AQV A;  2C1Y A;  2DC5 A;  3F6D A;  4HJM A;  3WT1 A;  2H19 A;  1ERT A;  2WW2 A;  3C73 A;  1M9B A;  5ECQ B;  2MBS A;  3GV1 A;  2E0Q A;  2CZ3 A;  1EOH A;  5C00 A;  2ALB A;  2MBT A;  1TP9 A;  3F63 A;  2IN3 A;  3NZN A;  2CZ2 A;  3WGD A;  1FO5 A;  1BG5 A;  1YEW C;  3HKR A;  1XVW A;  3D21 A;  2C3N A;  4HUA A;  4I2U A;  1ZYN A;  2C8U A;  3I69 A;  4J2F A;  4XS1 A;  3A5W A;  3GL3 A;  1FOH A;  1KNG A;  1A8L A;  3P2A A;  3ZTL A;  2AAW A;  2YWO A;  2C0G A;  4GWR A;  3GH6 A;  4IN0 A;  5KEJ A;  3IAM 2;  2HSN B;  3A5I A;  1Z3E A;  3HD5 A;  3RHB A;  3UAP A;  2BJX A;  3UVT A;  4N3Z A;  1YJ6 A;  2MMN A;  3CTF A;  5IQY A;  4FYC A;  1F3B A;  4ML6 A;  1GNW A;  4Q5N A;  2F51 A;  1QFN A;  1SK1 A;  5CP1 A;  2FGX A;  2QA1 A;  4L0U A;  1O85 A;  3KJY A;  2Z9S A;  4ULX A;  5H5S A;  3Q6O A;  4KH7 A;  2YN1 A;  2DIY A;  4ZIL A;  3KM6 A;  3QFB C;  1XPV A;  4MCU A;  3IV4 A;  4TXV A;  4ZB7 A;  1Y25 A;  5KOW A;  1FG4 A;  3HCZ A;  4FH8 A;  3QD9 A;  1B8X A;  2IJY A;  4ISD A;  4POL A;  3IE3 A;  1JZO A;  4MF7 A;  5AGY A;  1FW1 A;  2GLR A;  3GL5 A;  3FKF A;  1EGO A;  1N2A A;  2NVL A;  2BMX A;  3L78 A;  2NBS A;  2G2Q A;  3GUS A;  1PX6 A;  3TKS C;  2J23 A;  1FB6 A;  2VLT A;  4NMU A;  4XS4 B;  1BED A;  3FR6 A;  2J9H A;  2R4V A;  5A5H B;  4IQ1 A;  1SKS B;  2VL2 A;  4D73 A;  2EIR A;  1Z9H A;  4MPF A;  3ZRD A;  5F0G A;  4AJ7 A;  1GUM A;  4I2T A;  1TK8 B;  3FEU A;  5D9X A;  2HQT A;  1LJR A;  4FXY P;  5DCH A;  1IYH A;  3F4T A;  1M9A A;  3G7I A;  4RQX A;  2YAN A;  1R4W A;  3GNJ A;  4Z2T A;  6GSW A;  1XWK A;  3ZVJ D;  1AQW A;  2FWH A;  3RDW A;  3TKS E;  1K3Y A;  4MJC A;  4G0K A;  1F6M C;  3GFK A;  1J0F A;  4EE0 A;  4WKW A;  2EFH A;  1MD4 A;  2EFD A;  2YWN A;  3MYD A;  4P3Y B;  1M2A A;  5BMU B;  1WPI A;  3UIW A;  4HQZ A;  1GSQ A;  1ZCP A;  4RUV A;  1ML6 A;  1Q98 A;  2BTO T;  3QAG A;  1OKT A;  2WDU A;  3TJJ A;  3H79 A;  5IMV A;  11GS A;  1TW9 A;  4MDC A;  1TRV A;  6GSX A;  1PFO A;  4ML1 A;  1AXD A;  3IOS A;  5L71 A;  1B9Y C;  3Q18 A;  4GDF A;  1G0T A;  3RBT A;  1O8W A;  4NXI A;  1WWJ A;  5COH A;  2VKZ G;  3CBU A;  3HYP A;  3TCO A;  4WR4 A;  2N5B A;  1ERW A;  4KF9 A;  8GSS A;  2GDR A;  3F3R A;  1YZX A;  4IVF A;  1NW2 A;  2H0I A;  2OE3 A;  2V6K A;  1ZL9 A;  4OFT A;  4NV5 A;  1AUC A;  1ZOF A;  3DD3 A;  4MZW A;  4ECC A;  6GSY A;  4IBP A;  1Z6N A;  5DAL B;  1EGR A;  3LEF A;  2F9S A;  1YEP A;  4TXO B;  2WFC A;  4Q5F A;  5KN3 A;  3TGZ A;  2EC4 A;  4YKG A;  4AKX B;  1F37 A;  5FT3 A;  2DSA A;  3APQ A;  3TDG A;  2AJQ B;  4V2M A;  2CT6 A;  3DRN A;  5DQS A;  3C71 A;  2EFC A;  3UOM A;  1HNA A;  3H1N A;  5HFK A;  3EU4 A;  2L4Q A;  1K3L A;  3I6A A;  4H86 A;  1JZR A;  2LUS A;  5JWO B;  2GZZ A;  3PIN A;  2H71 A;  5GAP D;  1PD2 1;  1JZW A;  2GTU A;  3TJF A;  4MNN A;  4OCE A;  2YWI A;  3KH9 A;  4O5Q A;  1A2J A;  5IMF A;  3FZ9 A;  3ZYW A;  1FHE A;  4NHZ A;  3RAZ A;  5J9C A;  3KP8 A;  3VK9 A;  2O36 A;  1Z7P A;  2HRK B;  1K0A A;  1BF5 A;  2CX4 A;  4ZL7 A;  1OE8 A;  5ECN B;  3KD0 A;  3E0U A;  1A2M A;  1THX A;  4ID0 A;  2H30 A;  5DJM A;  1MDI A;  2GT6 A;  3F4R A;  3NOF A;  4PHZ C;  2N5F A;  1SL0 B;  1SL1 B;  1UVZ A;  2X8H A;  2H72 A;  4TN8 A;  4YH2 A;  1CQH A;  5ECR B;  1GLQ A;  2LRT A;  4OCF A;  1TDI A;  4K2D A;  4K2X A;  2L5O A;  4OFN A;  3ZL5 A;  3ZFL A;  2V6O A;  2HRF A;  4EC0 A;  2LEG A;  4TR0 A;  2DIZ A;  1XFL A;  4IGJ A;  4WBJ A;  3PH9 A;  3GN3 A;  1PX7 A;  2OKA A;  1XOB A;  2R2J A;  1ZZY A;  2V1M A;  3F3Q A;  2IME A;  1TJD A;  1T4Y A;  4MF5 A;  3KIJ A;  2LRC A;  3US3 A;  2OAC A;  1M3I A;  1N8J A;  1PSQ A;  4Q5R A;  4G0L A;  3TJG A;  1V98 A;  4OD7 A;  1QGV A;  5JWQ B;  1XG8 A;  2GS3 A;  5JCU A;  5F8B A;  3APS A;  2GSR A;  4IW9 A;  2RLI A;  2QC7 A;  5KN0 A;  5LNK e;  3L0H A;  5INY A;  5G31 A;  3VWX A;  2PVO C;  5G5E A;  3ZIJ A;  1FVJ A;  3JCM L;  4ZBB A;  2JAC A;  5HR1 A;  2VD1 A;  4E8H A;  4ACS A;  3LW9 A;  1SVO A;  2VO4 A;  1GUH A;  2VD0 A;  4MAB A;  2VCV A;  3CRU A;  2PGT A;  3H93 A;  4NHW A;  3MNG A;  4EKZ A;  4K5S A;  1H75 A;  1XOA A;  5G1L A;  2V41 A;  3V1W A;  3GST A;  1T8E B;  2R5G A;  5A1N A;  1I9D A;  2TIR A;  4OFM A;  3GHA A;  5ECP B;  3P90 A;  2ES7 A;  3APO A;  3VI7 A;  4HZ2 A;  3KXO A;  4FO5 A;  5H5Q A;  3BCK A;  3PGT A;  4JBB A;  3KGK A;  3FRC A;  3P8W A;  2NTO A;  4EVM A;  3UMA A;  4EL1 A;  4GRF A;  3EYT A;  1YF0 A;  1YF1 A;  2GZY A;  6GSV A;  2R0G A;  2VOC A;  1ERU A;  5IOX A;  3D22 A;  2KLX A;  4IKH A;  4F03 A;  4G2E A;  2LQQ A;  1KBN A;  3F4S A;  22GS A;  4F82 A;  1VF4 A;  2H1A A;  1X5E A;  3LXZ A;  2MYG A;  2VCZ A;  1TKD B;  1TRW A;  3WGX A;  3CRT A;  2QGV A;  2WW1 A;  3DEX A;  4GSS A;  1U3I A;  4QMK A;  2K8S A;  3QFA C;  3KP9 A;  5IPH A;  1ZYP A;  1XBS A;  1URM A;  3BBY A;  4LLR A;  5ID2 A;  2FD3 A;  3E9J B;  1T7P B;  1S4B P;  1XXU A;  3M3M A;  3WYW A;  2LV3 A;  3VWW A;  4MH2 A;  1SK2 A;  4XS6 A;  2H76 A;  3TKR A;  4F0B A;  3IDV A;  3LGC A;  4EXJ A;  3UL3 A;  2JU5 A;  1A8Y A;  1SKW B;  1V58 A;  2O85 A;  2H73 A;  1U6T A;  3LJR A;  3ZIV A;  3FK8 A;  1F3A A;  1GRX A;  4BA7 A;  2X64 A;  4AKG A;  2YZH A;  1XIY A;  1SL2 B;  3I43 A;  1X0R A;  1BAY A;  1GNE A;  1B9X C;  3VI5 A;  1OC9 A;  2I1U A;  2XC2 A;  4OWY A;  5J4U A;  3U5R E;  3ERW A;  2WVZ A;  3TKS A;  2A4H A;  2YNX A;  1OYJ A;  5ELA A;  1E2Y A;  5HR2 A;  3CQF A;  3TUE A;  1AIU A;  4IJI A;  2ON5 A;  2VAF A;  3A3T A;  1VRS D;  1DSB A;  4CW9 A;  3J7Y k;  4PNF A;  1FAA A;  3R3E A;  1RK4 A;  1ON4 A;  1RQM A;  4CY8 A;  6GSU A;  1GTI A;  4KDX A;  3W6G A;  1TRU A;  2OBK A;  2E2G A;  5B8B A;  1GSE A;  4BPY A;  4HQS A;  1KEB A;  4PI0 C;  2H8L A;  5F05 A;  4JZQ A;  2PWJ A;  1PL1 A;  4HOJ A;  1ST9 A;  1DE2 A;  4POK A;  4X0X A;  2HFD A;  5J4Y A;  5G5F A;  2H6Y A;  4V2N A;  3LG6 A;  5IMD A;  2F8A A;  4D73 B;  2ZUP A;  2JSY A;  2ZCT A;  2PER A;  2C0F A;  3EWL A;  4NV2 A;  3IAS 2;  3GKM A;  2YJ7 A;  1GSF A;  4K7O A;  3OR5 A;  4HSC X;  4TR1 A;  2A2S A;  2YV9 A;  4NAX A;  5KOX A;  5DJL A;  1A0F A;  3SWL A;  5J40 A;  1UN2 A;  13GS A;  4ZIJ A;  4BWQ A;  5IIZ A;  3K8N A;  4RQR A;  2M72 A;  2PU9 C;  3RGB C;  2XBI A;  4N30 A;  4TOP A;  2O89 A;  2FWF A;  2L5L A;  2OT3 A;  2VCX A;  3ZZX A;  2RUF A;  5CRH A;  1PGT A;  4K6X A;  3N5O A;  1X5D A;  17GS A;  5B6N A;  1XW5 A;  1J08 A;  4JU5 A;  3HMJ G;  2L59 A;  2R0P A;  1A2L A;  1ZGN A;  2DKH A;  3DYR A;  4FQU A;  2H6X A;  4X43 A;  4XIH A;  2HI7 A;  4WEY A;  3H4K A;  3GIX A;  5HR0 A;  4TRX A;  4XRA A;  2H0G A;  5KN2 A;  1E6B A;  4F2I A;  1ACV A;  1F2E A;  4PX1 A;  2L6D A;  5FHI A;  18GS A;  2LRN A;  4K9Z A;  3VWV A;  1XZO A;  5ABR A;  5CO3 A;  4EO3 A;  1EOG A;  1QK8 A;  4A5P A;  2K8V A;  2V2G A;  1AC1 A;  2FCH A;  4DSS A;  1Z6M A;  4HJ2 A;  1B48 A;  3S9F A;  1JFU A;  1X9W B;  4QL7 A;  3TOU A;  4MJA A;  3DVW A;  2CVD A;  4WF5 A;  1NM3 A;  4HU7 A;  2H66 A;  4ICY A;  2IFQ A;  2VCQ A;  4ZBD A;  1TK0 B;  4TR4 A;  2IPA A;  1BX9 A;  3F6F A;  4MH3 A;  3M9K A;  2JL4 A;  3LYP A;  1LBK A;  3FHK A;  3QMX A;  5DQY A;  4NWY A;  1GH2 A;  1BQ7 A;  2HSM A;  2KUC A;  1K0D A;  4I8B A;  1S3A A;  2FNO A;  2EIQ A;  1YVL A;  3EVI A;  5HFI A;  4V1A p;  4IS0 A;  1YKC A;  4ZB9 A;  3GH9 A;  2IWT A;  4TKY A;  2I81 A;  3ME7 A;  2X8G A;  2H74 A;  3TB2 A;  5EL8 A;  3CMI A;  1JZD A;  5GAN D;  2VCT A;  4ZL8 A;  3BJ5 A;  1EZK A;  2H1G A;  3F8U A;  4TW5 A;  1TU7 A;  1TXU A;  2PBJ A;  3U6V A;  3GMF A;  5G30 A;  1M7T A;  3KCM A;  3MSZ A;  1EP7 A;  4QL9 A;  4Z7X A;  2I9H A;  2MMZ A;  5J4V A;  4IP6 A;  3L9V A;  1WRY A;  4TR3 A;  4X4J A;  4HZ4 A;  1T00 A;  3CSJ A;  2HRN A;  2YZU A;  4IJ3 A;  1WOU A;  2YP6 A;  1UA5 A;  3DVX A;  2GT5 A;  4MA9 A;  2DMM A;  3RFR C;  1PN9 A;  1ABA A;  1SVM A;  2PMT A;  2TRX A;  1UC7 A;  2ON7 A;  5IM9 A;  5G1K A;  5DAK A;  6GSS A;  3UAR A;  4PTS A;  4JRR A;  2NPB A;  3EMP A;  2HZF A;  4JR4 A;  2CV4 A;  2HYX A;  5JCW A;  4I97 A;  4WR5 A;  5AIX A;  2CAI A;  2WGR A;  1SYX A;  2DJJ A;  5D73 A;  2M80 A;  3MIX A;  3TOT A;  1YDK A;  4CY6 A;  2X4A A;  3J7Y b;  4KGI A;  2X8C A;  4NPB A;  1T4Z A;  4K7N A;  4HU9 A;  5GZZ B;  2A2R A;  1O81 A;  4L5L A;  4W66 A;  2I4A A;  2VIM A;  3DXB A;  1USB A;  5EPF A;  2IMI A;  1K0C A;  1Q4J A;  5ELG A;  5CRW A;  4G10 A;  3GTU A;  5ECL B;  5CYY A;  2HSH A;  1R7H A;  4AJ8 A;  5F07 A;  5DVB A;  2IIY A;  1OVN A;  2PUK C;  5EY6 A;  1A24 A;  2LQO A;  1TOF A;  4V2L A;  2HZE A;  5E4W A;  1PA3 A;  1XW6 A;  5F06 A;  4Z2U A;  1T3B A;  1C72 A;  10GS A;  4F0C A;  3FW2 A;  4MPG A;  1WP0 A;  4FYU A;  5A1N B;  3TJB A;  4AJ6 A;  3UEM A;  2K9F A;  2H75 A;  3KMO A;  4K1F A;  2EFE A;  4XCS A;  1IYI A;  3L4N A;  1A23 A;  4E8E A;  2YWM A;  2XPE A;  3LOR A;  4MJB A;  3FR3 A;  5C04 A;  1HQO A;  3GA4 A;  14GS A;  1SD8 A;  4KB3 A;  4N10 A;  3RPP A;  1K0M A;  3CYN A;  3IC8 A;  2EIO A;  2L4C A;  2WW0 A;  2TRC P;  1SYR A;  2QKE A;  3D6I A;  2YPM A;  4BVX A;  1O6J A;  4WXT A;  2LNT A;  1G7E A;  4FYB A;  1X9S B;  2JSZ A;  2L6C A;  2X99 A;  2XPD A;  3QOU A;  1U3A A;  2FWE A;  4WF4 A;  2A4V A;  2DJ1 A;  4LMV A;  3BOA A;  1NHO A;  1EWX A;  2HNL A;  3MWH A;  5A34 A;  2A2P A;  5ID2 B;  2HT9 A;  3ZIT A;  2FUG 2;  4GQC A;  4ZB8 A;  1M3J A;  1QMV A;  3LXT A;  4BIK A;  1HD2 A;  3QDN A;  4XRD A;  1O7U A;  4ILF A;  4JED A;  3EIN A;  1DBY A;  3MDK A;  5B8A A;  4MZB A;  2R6K A;  4G19 A;  2DJ0 A;  2AYT A;  3G7Y A;  1XCC A;  2UV8 G;  2H1B A;  4OMV A;  3GUR A;  5D9T A;  3HDC A;  4FIW A;  3IA1 A;  1GSS A;  3IPZ A;  4J57 E;  2IMK A;  3R2Q A;  3UVH A;  2YV7 A;  1SU9 A;  3KZQ A;  4PQI A;  3QPM A;  5IO0 A;  1OE7 A;  3VPQ A;  2C4J A;  1JHB A;  1OC9 B;  1NHY A;  3IHG A;  1JLW A;  2E2M A;  2HXK A;  2P0G A;  2PN8 A;  5IMC A;  1GTB A;  2RUE A;  2IMF A;  4N0Z A;  4KSO A;  3A2W A;  3BD2 A;  1KTE A;  5KN1 A;  1PRX A;  16GS A;  1W4V A;  2VM1 A;  3VLN A;  4XTS A;  1I1I P;  1AQX A;  1J9B A;  1R26 A;  1K3O A;  3KTL A;  1PN0 A;  1PL2 A;  3PPU A;  12GS A;  1AAZ A;  2DBC A;  1PMT A;  3DWV A;  1OC8 A;  5ECM B;  1TI1 A;  3EU3 A;  2CAQ A;  5J41 A;  2VLV A;  5GST A;  1I5G A;  5HFG A;  1GTU A;  3EUR A;  4MJE A;  3KEB A;  3BCI A;  4GCI A;  4AI6 A;  4LMW A;  2FLS A;  3G7J A;  1MDJ A;  4GST A;  1R5A A;  1MTC A;  3I9V 2;  4LA1 A;  5ECI B;  1W89 A;  1AW9 A;  4OO4 A;  1B4Q A;  1F9M A;  5G2Z A;  3PR8 A;  3TRQ A;  2PVQ A;  2B3S A;  3HZ8 A;  4PXO A;  2P5R A;  4HS1 A;  3FZA A;  1H4O A;  4PGT A;  2MZC A;  2XBQ A;  2VCW A;  4I5Q A;  2H1D A;  4YQM A;  3LSZ A;  4TR1 B;  5ENU A;  4K0G A;  1XWC A;  5D9V A;  3Q19 A;  1DE1 A;  2MMA A;  3RHC A;  1K0O A;  1TRS A;  4PUR A;  4BL7 A;  4ECI A;  3ZMK A;  4HEA 2;  1GTA A;  1PKZ A;  2HRA A;  2DLX A;  3UBK A;  5J3R A;  1ZYQ B;  3KTB A;  3FYG A;  1ILO A;  1SVL A;  1M2B A;  1OKD A;  3HY2 A;  3ZML A;  3H8Q A;  5D9W A;  3HVX A;  2WRT A;  4JE1 A;  3TRP A;  3CXG A;  1LU4 A;  4PUF C;  2WVX A;  1B4P A;  3P7X A;  4O32 A;  4DSR A;  3LFL A;  3EMX A;  2NDO A;  1ZYE A;  1CQG A;  1QXH A;  3L9U A;  1MDK A;  4BVY A;  2VUP A;  1GUL A;  2WJU A;  2RM5 A;  1G6W A;  4O5R A;  2B7J A;  4DVC A;  1TK5 B;  9GSS A;  2CA8 A;  4WET A;  4WBR D;  2B6M A;  3ED3 A;  2JZS A;  3IC4 A;  2VL9 A;  3VWU A;  4TVE A;  1QQ2 A;  3VPT A;  4AKI A;  5D93 A;  3LWA A;  4POM A;  4HDE A;  4PQ1 A;  4GSN A;  1SJZ A;  4IHU A;  3LQ7 A;  2P31 A;  3O3T A;  4DSS B;  2R0C A;  5D96 A;  3ME8 A;  4G0I A;  3Q74 A;  5IPG A;  3D4M A;  4EUY A;  5B7C A;  1Y1U A;  2QSI A;  2HSN A;  2IL3 A;  1GSD A;  2F8F A;  2VL3 A;  4K0N A;  1XWA A;  2IFQ B;  3GKN A;  3IK9 A;  4GXZ A;  1YKA A;  4Z2R A;  1WMJ A;  3G9B A;  4KW6 A;  1ERV A;  3CSI A;  1FB0 A;  2HSY A;  1MD3 A;  2C0E A;  1OAZ A;  3IBH A;  4XHM A;  1R5P A;  2KP1 A;  1M0U A;  1BYE A;  2UZ8 A;  2I3Y A;  5DDL A;  5CRE A;  4QQ7 A;  1N25 A;  2H01 A;  4RI7 A;  2FWG A;  2VLU A;  4YKF A;  2HSM B;  3CTG A;  2LST A;  1SK0 A;  2B5E A;  4E68 A;  2G0F A;  3HXS A;  5CAX A;  4IEL A;  3HVS A;  2M46 A;  5ECK B;  3SBC A;  4J56 E;  5JWR B;  5IO2 A;  1S3R A;  2LNS A;  1V40 A;  4CHS A;  2OJL A;  1VF1 A;  1BJX A;  2WCI A;  2JAD A;  4MMM A;  4EDY A;  2O7K A;  7GSS A;  4L8E A;  1K0N A;  1TTZ A;  1FOV A;  3C8E A;  1M99 A;  2V32 A;  4ECB A;  5LCZ A;  2O3E A;  1A0R P;  2O8V B;  3RPN A;  5IOW A;  2GQK A;  4KDU A;  3UBL A;  2VM2 A;  4MK3 A;  4K8M A;  4XS4 A;  4JR6 A;  4K7I A;  5AN1 A;  5A5H A;  5HR3 A;  4GLT A;  2FHE A;  4O7H A;  1S3D A;  5A4U A;  3QCP A;  1GP1 A;  3FR9 A;  2WB9 A;  3O76 A;  3IHQ A;  2FY6 A;  5BRT A;  5DAK B;  3C1S A;  5AIV A;  3HJP A;  4KX4 A;  1THO A;  1TXX A;  1U88 A;  1HNB A;  4IQA A;  4V1A g;  3CHX C;  4ZXG A;  1WJK A;  2DML A;  5B6M A;  2L57 A;  1VF2 A;  2PPT A;  1X5C A;  3TKQ A;  1EV9 A;  2AUV A;  3QAV A;  5JCG A;  1EV4 A;  3HHV A;  3A2V A;  4AF2 A;  1X9M B;  3DIE A;  4OO5 A;  2VL2 C;  3GX8 A;  4DSQ A;  1GUK A;  4AKH A;  3FY7 A;  3N9J A;  1DUG A;  3ZVJ A;  5BMU A;  3GTU B;  2B1K A;  3GYK A;  4LL1 B;  4KCE A;  2R3X A;  19GS A;  5ECS A;  2GSS A;  2ZNM A;  4KUN A;  3GSS A;  4Q5Q A;  5IMA A;  3A2X A;  2HZE B;  5DBQ A;  2E7P A;  2AV4 A;  2IMD A;  3IRA A;  2WZ9 A;  3TKP A;  2LTK A;  3HJO A;  4AGS A;  1XWB A;  1XWG A;  3QR6 A;  3E3E A;  2JZT A;  3FZ5 A;  2GSQ A;  1GWC A;  6GST A;  2B5Y A;  4DEJ A;  4PUA A;  2GQL A; 
#chains in the Genus database with same CATH homology
 4EIQ A;  1GSU A;  2GZP A;  4MP4 A;  3C1R A;  4G9H A;  1WE0 A;  3WT2 A;  5DAL A;  4BVX B;  3VFI A;  5D8I A;  3IR4 A;  4F9Z A;  2C80 A;  4TXO A;  2WS2 A;  5A4W A;  3D5J A;  1SD9 A;  5AIS A;  3F0I A;  3NIV A;  4RI6 A;  1O73 A;  2KP2 A;  1PKW A;  1EEJ A;  2N5A A;  3M8N A;  1V9W A;  1V2A A;  1OC3 A;  4MZC A;  5A34 B;  5A5K A;  5J5N A;  3M9J A;  4YQV A;  3DML A;  4EF0 A;  4GF0 A;  3CWG A;  2YCD A;  2X49 A;  4EDZ A;  2OA7 A;  4N0V A;  4K5R A;  4O92 A;  2CX3 A;  2H70 A;  3FMW A;  4ZB6 A;  2K6V A;  4X1U A;  2H1L A;  2B1L A;  1T1V A;  2O87 A;  3VUR A;  4HI7 A;  4KND A;  3EPT A;  5FWG A;  1G6Y A;  3O6T A;  3L9S A;  4IP1 A;  4EIP A;  3ERF A;  1PQN A;  2LJA A;  3W8S A;  2QA2 A;  2HRK A;  5DCG A;  2RM6 A;  5LD0 A;  1JLV A;  2MMO A;  20GS A;  1SJI A;  1G7O A;  1M2D A;  4KA0 A;  4KSM A;  3DGQ A;  1HYU A;  1GLP A;  1NSW A;  1HNC A;  2AB6 A;  5H5R A;  4PQH A;  1GL8 A;  4I6X A;  2REM A;  3WD6 A;  3CSH A;  1K0B A;  3D4T A;  2R37 A;  5GSS A;  4ECJ A;  1Y6E A;  1S3C A;  3TRX A;  2GGT A;  5ECO B;  3GKX A;  3KH7 A;  4LL4 B;  1VGL A;  5CNW A;  3GKK A;  5HQP A;  2JZR A;  1YY7 A;  2LKU A;  4L5O A;  2P5Q A;  4G01 A;  2DKI A;  4YAP A;  2YJH A;  3W8J A;  3AY8 A;  2K18 A;  1SKR B;  2DJ2 A;  1BG1 A;  4O5U A;  2CVB A;  3ZRE A;  4KCA A;  1QUW A;  3GX0 A;  4POB A;  3IK7 A;  1WIK A;  3EC3 A;  3IXR A;  1Z5Y E;  2LJR A;  3LYK A;  4USS A;  4KAE A;  1TU8 A;  2OAD A;  3EE2 A;  3HA9 A;  1V57 A;  2GVP A;  3KMN A;  2DJ3 A;  3ISO A;  1FVK A;  1XW9 A;  2OE0 A;  2FA8 A;  5J47 A;  5ECH B;  1EEM A;  5EVO A;  4GQF A;  3ERG A;  2FA4 A;  4MLY A;  3TJK A;  2F3M A;  4YAV A;  2C3Q A;  2O5V A;  1GSY A;  3M0F A;  5E59 A;  2GST A;  1SJ6 A;  4ZL9 A;  2HLS A;  2HE3 A;  4KDY A;  2H0H A;  4ZBA A;  2CQ9 A;  1XVQ A;  2WUL A;  3HVV A;  2H6Z A;  1RW1 A;  1Z7R A;  4BL7 B;  5IMZ A;  2DJK A;  2C0D A;  3HJM A;  5CRG A;  2XHF A;  2D2Z A;  2YOI A;  4YQU A;  3F9U A;  3D0Z A;  2GQM A;  2LJK A;  2CVK A;  1TI3 A;  3GRX A;  1VF3 A;  2KHP A;  1SEN A;  3DKS A;  4PNG A;  2RII A;  3HZ4 A;  1ZMA A;  1U87 A;  3FZ4 A;  2KOK A;  1MEK A;  3UJ1 A;  3ZLP A;  1O8X A;  5CRD A;  4KE3 A;  1YEX A;  4BWS A;  1YQ1 A;  2OBI A;  4CDO A;  1EP8 A;  4BVY B;  3TU3 B;  2LS5 A;  4MF6 A;  2C3T A;  2B5X A;  3MAK A;  3M1G A;  4GTU A;  3C7M A;  2OE1 A;  3ZFB A;  5J9B A;  2B7K A;  2AHE A;  3WGE A;  5A4V A;  3QAW A;  4N11 A;  4L0W A;  1AQV A;  2C1Y A;  2DC5 A;  3F6D A;  4HJM A;  3WT1 A;  2H19 A;  1ERT A;  3C73 A;  1M9B A;  5ECQ B;  2MBS A;  3GV1 A;  2E0Q A;  2CZ3 A;  1EOH A;  5C00 A;  2ALB A;  2MBT A;  1TP9 A;  3F63 A;  2IN3 A;  3NZN A;  2CZ2 A;  3WGD A;  1FO5 A;  1BG5 A;  3HKR A;  1XVW A;  3D21 A;  2C3N A;  4HUA A;  4I2U A;  1ZYN A;  2C8U A;  3I69 A;  4J2F A;  4XS1 A;  3A5W A;  3GL3 A;  1FOH A;  1KNG A;  1A8L A;  3P2A A;  3ZTL A;  2AAW A;  2YWO A;  2C0G A;  4GWR A;  3GH6 A;  4IN0 A;  5KEJ A;  3IAM 2;  2HSN B;  3A5I A;  1Z3E A;  3HD5 A;  3RHB A;  3UAP A;  2BJX A;  3UVT A;  4N3Z A;  1YJ6 A;  2MMN A;  3CTF A;  5IQY A;  4FYC A;  1F3B A;  4ML6 A;  1GNW A;  4Q5N A;  2F51 A;  1QFN A;  1SK1 A;  5CP1 A;  2FGX A;  2QA1 A;  4L0U A;  1O85 A;  3KJY A;  2Z9S A;  4ULX A;  5H5S A;  3Q6O A;  4KH7 A;  2YN1 A;  2DIY A;  4ZIL A;  3KM6 A;  3QFB C;  1XPV A;  4MCU A;  3IV4 A;  4TXV A;  4ZB7 A;  1Y25 A;  5KOW A;  1FG4 A;  3HCZ A;  4FH8 A;  3QD9 A;  1B8X A;  2IJY A;  4ISD A;  4POL A;  3IE3 A;  1JZO A;  4MF7 A;  5AGY A;  1FW1 A;  2GLR A;  3GL5 A;  3FKF A;  1EGO A;  1N2A A;  2NVL A;  2BMX A;  3L78 A;  2NBS A;  2G2Q A;  3GUS A;  1PX6 A;  3TKS C;  2J23 A;  1FB6 A;  2VLT A;  4NMU A;  4XS4 B;  1BED A;  3FR6 A;  2J9H A;  2R4V A;  5A5H B;  4IQ1 A;  1SKS B;  2VL2 A;  4D73 A;  2EIR A;  1Z9H A;  4MPF A;  3ZRD A;  5F0G A;  4AJ7 A;  1GUM A;  4I2T A;  1TK8 B;  3FEU A;  5D9X A;  2HQT A;  1LJR A;  5DCH A;  1IYH A;  3F4T A;  1M9A A;  3G7I A;  4RQX A;  2YAN A;  1R4W A;  3GNJ A;  4Z2T A;  6GSW A;  1XWK A;  3ZVJ D;  1AQW A;  2FWH A;  3RDW A;  3TKS E;  1K3Y A;  4MJC A;  4G0K A;  1F6M C;  3GFK A;  1J0F A;  4EE0 A;  4WKW A;  2EFH A;  1MD4 A;  2EFD A;  2YWN A;  3MYD A;  4P3Y B;  1M2A A;  5BMU B;  1WPI A;  3UIW A;  4HQZ A;  1GSQ A;  1ZCP A;  4RUV A;  1ML6 A;  1Q98 A;  2BTO T;  3QAG A;  1OKT A;  2WDU A;  3TJJ A;  3H79 A;  5IMV A;  11GS A;  1TW9 A;  4MDC A;  1TRV A;  6GSX A;  4ML1 A;  1AXD A;  3IOS A;  5L71 A;  1B9Y C;  3Q18 A;  4GDF A;  1G0T A;  3RBT A;  1O8W A;  4NXI A;  1WWJ A;  5COH A;  2VKZ G;  3CBU A;  3HYP A;  3TCO A;  4WR4 A;  2N5B A;  1ERW A;  4KF9 A;  8GSS A;  2GDR A;  3F3R A;  1YZX A;  4IVF A;  1NW2 A;  2H0I A;  2OE3 A;  2V6K A;  1ZL9 A;  4OFT A;  4NV5 A;  1AUC A;  1ZOF A;  3DD3 A;  4MZW A;  4ECC A;  6GSY A;  4IBP A;  1Z6N A;  5DAL B;  1EGR A;  3LEF A;  2F9S A;  1YEP A;  4TXO B;  2WFC A;  4Q5F A;  5KN3 A;  3TGZ A;  2EC4 A;  4YKG A;  4AKX B;  1F37 A;  5FT3 A;  2DSA A;  3APQ A;  3TDG A;  2AJQ B;  4V2M A;  2CT6 A;  3DRN A;  5DQS A;  3C71 A;  2EFC A;  3UOM A;  1HNA A;  3H1N A;  5HFK A;  3EU4 A;  2L4Q A;  1K3L A;  3I6A A;  4H86 A;  1JZR A;  2LUS A;  5JWO B;  2GZZ A;  3PIN A;  2H71 A;  5GAP D;  1PD2 1;  1JZW A;  2GTU A;  3TJF A;  4MNN A;  4OCE A;  2YWI A;  3KH9 A;  4O5Q A;  1A2J A;  5IMF A;  3FZ9 A;  3ZYW A;  1FHE A;  4NHZ A;  3RAZ A;  5J9C A;  3KP8 A;  3VK9 A;  1Z7P A;  2HRK B;  1K0A A;  1BF5 A;  2CX4 A;  4ZL7 A;  1OE8 A;  5ECN B;  3KD0 A;  3E0U A;  1A2M A;  1THX A;  4ID0 A;  2H30 A;  5DJM A;  1MDI A;  2GT6 A;  3F4R A;  3NOF A;  2N5F A;  1SL0 B;  1SL1 B;  1UVZ A;  2X8H A;  2H72 A;  4TN8 A;  4YH2 A;  1CQH A;  5ECR B;  1GLQ A;  2LRT A;  4OCF A;  1TDI A;  4K2D A;  4K2X A;  2L5O A;  4OFN A;  3ZL5 A;  3ZFL A;  2V6O A;  2HRF A;  4EC0 A;  2LEG A;  4TR0 A;  2DIZ A;  1XFL A;  4IGJ A;  4WBJ A;  3PH9 A;  3GN3 A;  1PX7 A;  2OKA A;  1XOB A;  2R2J A;  1ZZY A;  2V1M A;  3F3Q A;  2IME A;  1TJD A;  1T4Y A;  4MF5 A;  3KIJ A;  2LRC A;  3US3 A;  2OAC A;  1N8J A;  1PSQ A;  4Q5R A;  4G0L A;  3TJG A;  1V98 A;  4OD7 A;  1QGV A;  5JWQ B;  2GS3 A;  5JCU A;  5F8B A;  3APS A;  2GSR A;  4IW9 A;  2RLI A;  2QC7 A;  5KN0 A;  5LNK e;  3L0H A;  5INY A;  5G31 A;  3VWX A;  2PVO C;  5G5E A;  3ZIJ A;  1FVJ A;  3JCM L;  4ZBB A;  2JAC A;  5HR1 A;  2VD1 A;  4E8H A;  4ACS A;  3LW9 A;  1SVO A;  2VO4 A;  1GUH A;  2VD0 A;  4MAB A;  2VCV A;  3CRU A;  2PGT A;  3H93 A;  4NHW A;  3MNG A;  4EKZ A;  4K5S A;  1H75 A;  1XOA A;  5G1L A;  2V41 A;  3V1W A;  3GST A;  1T8E B;  2R5G A;  5A1N A;  1I9D A;  2TIR A;  4OFM A;  3GHA A;  5ECP B;  3P90 A;  2ES7 A;  3APO A;  3VI7 A;  4HZ2 A;  3KXO A;  4FO5 A;  5H5Q A;  3BCK A;  3PGT A;  4JBB A;  3KGK A;  3FRC A;  3P8W A;  2NTO A;  4EVM A;  3UMA A;  4EL1 A;  4GRF A;  3EYT A;  1YF0 A;  1YF1 A;  2GZY A;  6GSV A;  2R0G A;  2VOC A;  1ERU A;  5IOX A;  3D22 A;  2KLX A;  4IKH A;  4F03 A;  4G2E A;  2LQQ A;  1KBN A;  3F4S A;  22GS A;  4F82 A;  1VF4 A;  2H1A A;  1X5E A;  3LXZ A;  2MYG A;  2VCZ A;  1TKD B;  1TRW A;  3WGX A;  3CRT A;  2QGV A;  3DEX A;  4GSS A;  1U3I A;  4QMK A;  2K8S A;  3QFA C;  3KP9 A;  5IPH A;  1ZYP A;  1XBS A;  1URM A;  3BBY A;  4LLR A;  5ID2 A;  2FD3 A;  3E9J B;  1T7P B;  1XXU A;  3M3M A;  3WYW A;  2LV3 A;  3VWW A;  4MH2 A;  1SK2 A;  4XS6 A;  2H76 A;  3TKR A;  4F0B A;  3IDV A;  3LGC A;  4EXJ A;  3UL3 A;  2JU5 A;  1A8Y A;  1SKW B;  1V58 A;  2O85 A;  2H73 A;  1U6T A;  3LJR A;  3ZIV A;  3FK8 A;  1F3A A;  1GRX A;  4BA7 A;  2X64 A;  4AKG A;  2YZH A;  1XIY A;  1SL2 B;  3I43 A;  1X0R A;  1BAY A;  1GNE A;  1B9X C;  3VI5 A;  1OC9 A;  2I1U A;  2XC2 A;  4OWY A;  5J4U A;  3U5R E;  3ERW A;  3TKS A;  2A4H A;  2YNX A;  1OYJ A;  5ELA A;  1E2Y A;  5HR2 A;  3TUE A;  1AIU A;  4IJI A;  2ON5 A;  2VAF A;  3A3T A;  1VRS D;  1DSB A;  4CW9 A;  3J7Y k;  4PNF A;  1FAA A;  3R3E A;  1RK4 A;  1ON4 A;  1RQM A;  4CY8 A;  6GSU A;  1GTI A;  4KDX A;  3W6G A;  1TRU A;  2OBK A;  2E2G A;  5B8B A;  1GSE A;  4BPY A;  4HQS A;  1KEB A;  2H8L A;  5F05 A;  4JZQ A;  2PWJ A;  1PL1 A;  4HOJ A;  1ST9 A;  1DE2 A;  4POK A;  4X0X A;  2HFD A;  5J4Y A;  5G5F A;  2H6Y A;  4V2N A;  3LG6 A;  5IMD A;  2F8A A;  4D73 B;  2ZUP A;  2JSY A;  2ZCT A;  2PER A;  2C0F A;  3EWL A;  4NV2 A;  3IAS 2;  3GKM A;  2YJ7 A;  1GSF A;  4K7O A;  3OR5 A;  4TR1 A;  2A2S A;  2YV9 A;  4NAX A;  5KOX A;  5DJL A;  1A0F A;  3SWL A;  5J40 A;  1UN2 A;  13GS A;  4ZIJ A;  4BWQ A;  5IIZ A;  3K8N A;  4RQR A;  2M72 A;  2PU9 C;  2XBI A;  4N30 A;  4TOP A;  2O89 A;  2FWF A;  2L5L A;  2OT3 A;  2VCX A;  3ZZX A;  2RUF A;  5CRH A;  1PGT A;  4K6X A;  3N5O A;  1X5D A;  17GS A;  5B6N A;  1XW5 A;  1J08 A;  4JU5 A;  3HMJ G;  2L59 A;  2R0P A;  1A2L A;  1ZGN A;  2DKH A;  3DYR A;  4FQU A;  2H6X A;  4X43 A;  4XIH A;  2HI7 A;  4WEY A;  3H4K A;  3GIX A;  5HR0 A;  4TRX A;  4XRA A;  2H0G A;  5KN2 A;  1E6B A;  4F2I A;  1ACV A;  1F2E A;  4PX1 A;  2L6D A;  5FHI A;  18GS A;  2LRN A;  4K9Z A;  3VWV A;  1XZO A;  5ABR A;  5CO3 A;  4EO3 A;  1EOG A;  1QK8 A;  4A5P A;  2K8V A;  2V2G A;  1AC1 A;  2FCH A;  4DSS A;  1Z6M A;  4HJ2 A;  1B48 A;  3S9F A;  1JFU A;  1X9W B;  4QL7 A;  3TOU A;  4MJA A;  3DVW A;  2CVD A;  4WF5 A;  1NM3 A;  4HU7 A;  2H66 A;  4ICY A;  2IFQ A;  2VCQ A;  4ZBD A;  1TK0 B;  4TR4 A;  2IPA A;  1BX9 A;  3F6F A;  4MH3 A;  3M9K A;  2JL4 A;  3LYP A;  1LBK A;  3FHK A;  3QMX A;  5DQY A;  4NWY A;  1GH2 A;  1BQ7 A;  2HSM A;  2KUC A;  1K0D A;  4I8B A;  1S3A A;  2FNO A;  2EIQ A;  1YVL A;  3EVI A;  5HFI A;  4V1A p;  4IS0 A;  1YKC A;  4ZB9 A;  3GH9 A;  2IWT A;  4TKY A;  2I81 A;  3ME7 A;  2X8G A;  2H74 A;  3TB2 A;  5EL8 A;  3CMI A;  1JZD A;  5GAN D;  2VCT A;  4ZL8 A;  3BJ5 A;  1EZK A;  2H1G A;  3F8U A;  4TW5 A;  1TU7 A;  1TXU A;  2PBJ A;  3U6V A;  3GMF A;  5G30 A;  1M7T A;  3MSZ A;  3KCM A;  1EP7 A;  4QL9 A;  4Z7X A;  2I9H A;  2MMZ A;  5J4V A;  4IP6 A;  3L9V A;  1WRY A;  4TR3 A;  4X4J A;  4HZ4 A;  1T00 A;  3CSJ A;  2HRN A;  2YZU A;  4IJ3 A;  1WOU A;  2YP6 A;  1UA5 A;  3DVX A;  2GT5 A;  4MA9 A;  2DMM A;  1PN9 A;  1ABA A;  1SVM A;  2PMT A;  2TRX A;  1UC7 A;  2ON7 A;  5IM9 A;  5G1K A;  5DAK A;  6GSS A;  3UAR A;  4PTS A;  4JRR A;  2NPB A;  3EMP A;  2HZF A;  4JR4 A;  2CV4 A;  2HYX A;  5JCW A;  4I97 A;  4WR5 A;  5AIX A;  2CAI A;  2WGR A;  1SYX A;  2DJJ A;  5D73 A;  2M80 A;  3MIX A;  3TOT A;  1YDK A;  4CY6 A;  2X4A A;  3J7Y b;  4KGI A;  2X8C A;  4NPB A;  1T4Z A;  4K7N A;  4HU9 A;  5GZZ B;  2A2R A;  1O81 A;  4L5L A;  4W66 A;  2I4A A;  2VIM A;  3DXB A;  1USB A;  5EPF A;  2IMI A;  1K0C A;  1Q4J A;  5ELG A;  5CRW A;  4G10 A;  3GTU A;  5ECL B;  5CYY A;  2HSH A;  1R7H A;  4AJ8 A;  5F07 A;  5DVB A;  2IIY A;  1OVN A;  2PUK C;  5EY6 A;  1A24 A;  2LQO A;  1TOF A;  4V2L A;  2HZE A;  5E4W A;  1PA3 A;  1XW6 A;  5F06 A;  4Z2U A;  1T3B A;  1C72 A;  10GS A;  4F0C A;  3FW2 A;  4MPG A;  1WP0 A;  4FYU A;  5A1N B;  3TJB A;  4AJ6 A;  3UEM A;  2K9F A;  2H75 A;  3KMO A;  4K1F A;  2EFE A;  4XCS A;  1IYI A;  3L4N A;  1A23 A;  4E8E A;  2YWM A;  2XPE A;  3LOR A;  4MJB A;  3FR3 A;  5C04 A;  1HQO A;  3GA4 A;  14GS A;  1SD8 A;  4KB3 A;  4N10 A;  3RPP A;  1K0M A;  3CYN A;  3IC8 A;  2EIO A;  2L4C A;  2TRC P;  1SYR A;  2QKE A;  3D6I A;  2YPM A;  4BVX A;  1O6J A;  4WXT A;  2LNT A;  1G7E A;  4FYB A;  1X9S B;  2JSZ A;  2L6C A;  2X99 A;  2XPD A;  3QOU A;  1U3A A;  2FWE A;  4WF4 A;  2A4V A;  2DJ1 A;  4LMV A;  3BOA A;  1NHO A;  1EWX A;  2HNL A;  3MWH A;  5A34 A;  2A2P A;  5ID2 B;  2HT9 A;  3ZIT A;  2FUG 2;  4GQC A;  4ZB8 A;  1QMV A;  3LXT A;  1HD2 A;  3QDN A;  4XRD A;  1O7U A;  4ILF A;  4JED A;  3EIN A;  1DBY A;  3MDK A;  5B8A A;  4MZB A;  2R6K A;  4G19 A;  2DJ0 A;  2AYT A;  3G7Y A;  1XCC A;  2UV8 G;  2H1B A;  4OMV A;  3GUR A;  5D9T A;  3HDC A;  4FIW A;  3IA1 A;  1GSS A;  3IPZ A;  4J57 E;  2IMK A;  3R2Q A;  3UVH A;  2YV7 A;  1SU9 A;  3KZQ A;  4PQI A;  3QPM A;  5IO0 A;  1OE7 A;  3VPQ A;  2C4J A;  1JHB A;  1OC9 B;  1NHY A;  3IHG A;  1JLW A;  2E2M A;  2HXK A;  2P0G A;  2PN8 A;  5IMC A;  1GTB A;  2RUE A;  2IMF A;  4N0Z A;  4KSO A;  3A2W A;  3BD2 A;  1KTE A;  5KN1 A;  1PRX A;  16GS A;  1W4V A;  2VM1 A;  3VLN A;  4XTS A;  1AQX A;  1J9B A;  1R26 A;  1K3O A;  3KTL A;  1PN0 A;  1PL2 A;  3PPU A;  12GS A;  1AAZ A;  2DBC A;  1PMT A;  3DWV A;  1OC8 A;  5ECM B;  1TI1 A;  3EU3 A;  2CAQ A;  5J41 A;  2VLV A;  5GST A;  1I5G A;  5HFG A;  1GTU A;  3EUR A;  4MJE A;  3KEB A;  3BCI A;  4GCI A;  4AI6 A;  4LMW A;  2FLS A;  3G7J A;  1MDJ A;  4GST A;  1R5A A;  1MTC A;  3I9V 2;  4LA1 A;  5ECI B;  1W89 A;  1AW9 A;  4OO4 A;  1B4Q A;  1F9M A;  5G2Z A;  3PR8 A;  3TRQ A;  2PVQ A;  2B3S A;  3HZ8 A;  4PXO A;  2P5R A;  4HS1 A;  3FZA A;  1H4O A;  4PGT A;  2MZC A;  2XBQ A;  2VCW A;  4I5Q A;  2H1D A;  4YQM A;  3LSZ A;  4TR1 B;  5ENU A;  4K0G A;  1XWC A;  5D9V A;  3Q19 A;  1DE1 A;  2MMA A;  3RHC A;  1K0O A;  1TRS A;  4PUR A;  4BL7 A;  4ECI A;  3ZMK A;  4HEA 2;  1GTA A;  1PKZ A;  2HRA A;  2DLX A;  3UBK A;  5J3R A;  1ZYQ B;  3KTB A;  3FYG A;  1ILO A;  1SVL A;  1M2B A;  1OKD A;  3HY2 A;  3ZML A;  3H8Q A;  5D9W A;  3HVX A;  2WRT A;  4JE1 A;  3TRP A;  3CXG A;  1LU4 A;  4PUF C;  1B4P A;  3P7X A;  4O32 A;  4DSR A;  3LFL A;  3EMX A;  2NDO A;  1ZYE A;  1CQG A;  1QXH A;  3L9U A;  1MDK A;  4BVY A;  2VUP A;  1GUL A;  2WJU A;  2RM5 A;  1G6W A;  4O5R A;  2B7J A;  4DVC A;  1TK5 B;  9GSS A;  2CA8 A;  4WET A;  4WBR D;  2B6M A;  3ED3 A;  2JZS A;  3IC4 A;  2VL9 A;  3VWU A;  4TVE A;  1QQ2 A;  3VPT A;  4AKI A;  5D93 A;  3LWA A;  4POM A;  4HDE A;  4PQ1 A;  4GSN A;  1SJZ A;  4IHU A;  3LQ7 A;  2P31 A;  3O3T A;  4DSS B;  2R0C A;  5D96 A;  3ME8 A;  4G0I A;  3Q74 A;  5IPG A;  3D4M A;  4EUY A;  5B7C A;  1Y1U A;  2QSI A;  2HSN A;  2IL3 A;  1GSD A;  2F8F A;  2VL3 A;  4K0N A;  1XWA A;  2IFQ B;  3GKN A;  3IK9 A;  4GXZ A;  1YKA A;  4Z2R A;  1WMJ A;  3G9B A;  4KW6 A;  1ERV A;  3CSI A;  1FB0 A;  2HSY A;  1MD3 A;  2C0E A;  1OAZ A;  3IBH A;  4XHM A;  1R5P A;  2KP1 A;  1M0U A;  1BYE A;  2UZ8 A;  2I3Y A;  5DDL A;  5CRE A;  4QQ7 A;  1N25 A;  2H01 A;  4RI7 A;  2FWG A;  2VLU A;  4YKF A;  2HSM B;  3CTG A;  2LST A;  1SK0 A;  2B5E A;  4E68 A;  2G0F A;  3HXS A;  5CAX A;  4IEL A;  3HVS A;  2M46 A;  5ECK B;  3SBC A;  4J56 E;  5JWR B;  5IO2 A;  2LNS A;  1V40 A;  4CHS A;  2OJL A;  1VF1 A;  1BJX A;  2WCI A;  2JAD A;  4MMM A;  4EDY A;  2O7K A;  7GSS A;  4L8E A;  1K0N A;  1TTZ A;  1FOV A;  3C8E A;  1M99 A;  2V32 A;  4ECB A;  5LCZ A;  1A0R P;  2O8V B;  3RPN A;  5IOW A;  2GQK A;  4KDU A;  3UBL A;  2VM2 A;  4MK3 A;  4K8M A;  4XS4 A;  4JR6 A;  4K7I A;  5AN1 A;  5A5H A;  5HR3 A;  4GLT A;  2FHE A;  4O7H A;  1S3D A;  5A4U A;  3QCP A;  1GP1 A;  3FR9 A;  2WB9 A;  3O76 A;  3IHQ A;  2FY6 A;  5BRT A;  5DAK B;  3C1S A;  5AIV A;  3HJP A;  4KX4 A;  1THO A;  1TXX A;  1U88 A;  1HNB A;  4IQA A;  4V1A g;  4ZXG A;  1WJK A;  2DML A;  5B6M A;  2L57 A;  1VF2 A;  2PPT A;  1X5C A;  3TKQ A;  1EV9 A;  2AUV A;  3QAV A;  5JCG A;  1EV4 A;  3HHV A;  3A2V A;  4AF2 A;  1X9M B;  3DIE A;  4OO5 A;  2VL2 C;  3GX8 A;  4DSQ A;  1GUK A;  4AKH A;  3FY7 A;  3N9J A;  1DUG A;  3ZVJ A;  5BMU A;  3GTU B;  2B1K A;  3GYK A;  4LL1 B;  4KCE A;  2R3X A;  19GS A;  5ECS A;  2GSS A;  2ZNM A;  4KUN A;  3GSS A;  4Q5Q A;  5IMA A;  3A2X A;  2HZE B;  5DBQ A;  2E7P A;  2AV4 A;  2IMD A;  3IRA A;  2WZ9 A;  3TKP A;  2LTK A;  3HJO A;  4AGS A;  1XWB A;  1XWG A;  3QR6 A;  3E3E A;  2JZT A;  3FZ5 A;  2GSQ A;  1GWC A;  6GST A;  2B5Y A;  4DEJ A;  4PUA A;  2GQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...