8GSSA

Human glutathione s-transferase p1-1, complex with glutathione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
publication title The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 8gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 8gssA01
2WCIA 4LA1A 4NV5A 1GUKA 3WYWA 2VL2A 4GRFA 1B9XC 2L57A 4GTUA 4G0LA 1FOVA 5F05A 4F0BA 1XBSA 3LEFA 4GSSA 5AGYA 5DAKA 1OC9B 1TDIA 1O8WA 3HA9A 3GUSA 1M2BA 4QQ7A 5DDLA 1R5PA 3A2VA 3WGDA 2ZCTA 3WGEA 2DJKA 2OE1A 1J0FA 5G31A 2AYTA 2H19A 3Q18A 2Z9SA 2B1LA 4TR4A 4AF2A 3CYNA 1AW9A 1FVJA 2TRCP 3EC3A 2AUVA 3BCKA 3IRAA 5C00A 5KN1A 5F07A 1F3BA 2I4AA 3DRNA 3LXZA 3C73A 3UAPA 3A3TA 3E3EA 2VM1A 4ECBA 1PQNA 2H0GA 3KH9A 1PSQA 1U6TA 4MPFA 4KH7A 3GRXA 1A24A 4MZBA 1OC3A 4TR0A 1FAAA 1THXA 3IAM2 2H1DA 2GLRA 3UBLA 1MDJA 3U6VA 4MZCA 4TKYA 2XBQA 2LQQA 1O7UA 4KSMA 5LCZA 3NZNA 5JCGA 3LYKA 4RQRA 3PR8A 3VFIA 1XXUA 3QFAC 4FYUA 4K7IA 19GSA 3GNJA 4QL9A 4G0IA 2M72A 2H6XA 2H0IA 4BWQA 4YAVA 2DSAA 2WGRA 5IMVA 4KSOA 4V1Ap 1X5CA 1ST9A 3F63A 1GSEA 2HSNB 5BMUA 2P31A 4ZBBA 4ECCA 3EU3A 3QAVA 3TJKA 1GP1A 2PPTA 1TI3A 3FHKA 1JLVA 4O32A 4FQUA 5ECLB 1KBNA 1VF2A 2FA4A 1TTZA 3TOUA 2YWNA 5J41A 2JACA 2HSYA 1Q4JA 3C1RA 3FR6A 1SL0B 2GT6A 5GSTA 1ML6A 2H76A 3KMNA 1EGOA 4TR3A 4K0NA 4HDEA 3GYKA 1HD2A 3UBKA 3SWLA 2LSTA 4Z7XA 1PKWA 2JSZA 4JBBA 1ACVA 18GSA 5ELGA 3LYPA 3CSIA 4JU5A 3VPTA 3KP9A 1TRUA 1G6YA 5B7CA 3F3RA 1R5AA 2YP6A 2ES7A 6GSUA 5IPHA 4WETA 1ABAA 2C3NA 1MD3A 3J7Yk 3VPQA 4PTSA 4I97A 3KEBA 3EU4A 5D9TA 5KN3A 1AQVA 4PQHA 3EINA 1GUMA 1YY7A 2NTOA 4TN8A 5CRDA 3TRQA 4GSNA 4KUNA 2GGTA 1GSYA 2JZTA 3LG6A 2YJ7A 3BD2A 5C04A 1M9BA 5ECRB 2O8VB 2C3QA 1VRSD 2CVKA 5ECMB 3D5JA 1USBA 5LD0A 5KN0A 5DALA 3M9KA 2HSHA 4NXIA 4OCFA 4MF7A 1LU4A 1M2DA 2KP2A 3RAZA 2OADA 1ERWA 2TIRA 4JE1A 5AIXA 4LL1B 5IM9A 1K0AA 4YQVA 1SKRB 2GQKA 4L5LA 4ECIA 3GL3A 2H1BA 3ISOA 1KTEA 1SYRA 3QAWA 2LEGA 3GKNA 2NPBA 4MH2A 1SYXA 3CRUA 1F3AA 3KD0A 1PA3A 3HDCA 2VCWA 4EDYA 2YCDA 2HZEB 4E8HA 1AUCA 3DIEA 2HRFA 2MYGA 2N5BA 1HNAA 2JL4A 3N9JA 1TI1A 3FZ4A 4I5QA 1GTBA 2CX4A 2OA7A 2R2JA 3DGQA 4NHWA 1BAYA 3HVXA 2JU5A 3IBHA 4G10A 3W8JA 2I1UA 2UZ8A 3HJPA 4BA7A 1KNGA 2LQOA 3IR4A 3LGCA 3IDVA 3CRTA 5CRWA 5G2ZA 4L5OA 1SJIA 1WE0A 4AJ8A 5HFIA 4WXTA 3APQA 3P2AA 4PNFA 11GSA 3GHAA 1B9YC 1TRSA 1T4YA 2F8FA 2VD0A 4GWRA 1Z6NA 1XCCA 1YKAA 3R3EA 1MTCA 2CA8A 3FK8A 2VL2C 2YN1A 2HSMA 2IJYA 2GTUA 2H1GA 2HQTA 4PQ1A 1BEDA 1G7EA 3P8WA 2E2MA 4TVEA 2KP1A 4JEDA 2V2GA 2FY6A 1QK8A 4OFTA 1A8LA 3BBYA 4MP4A 4OFNA 3F4RA 3D6IA 3VWXA 2MMNA 3ERFA 3MSZA 3QCPA 8GSSA 5J4UA 5KEJA 2HSMB 2H6YA 5B8BA 2B6MA 2N5AA 3PGTA 4L0UA 3HY2A 1CQGA 2JZRA 3RHBA 2IWTA 4XTSA 4WBJA 2H66A 16GSA 2X64A 2C80A 4KDUA 3TGZA 2IIYA 4FO5A 1VF1A 1ZMAA 2HRKA 3ZMKA 2PERA 2WRTA 4Q5NA 4RQXA 2NVLA 5CNWA 4L8EA 2H71A 2O87A 2H72A 3LSZA 1QFNA 5ELAA 4EVMA 2RUEA 3ZREA 4LMWA 2H8LA 2B5YA 1JHBA 4IS0A 3HVVA 4D73A 5ECQB 3E9JB 1QQ2A 5GZZB 1K0NA 2DC5A 3ZTLA 2GZZA 3TJFA 1ERVA 4PUFC 1Z3EA 1M2AA 1NSWA 2VLTA 1TRVA 2XHFA 2GZPA 5D93A 4D73B 5DCGA 2VCQA 1GTUA 3EWLA 4BPYA 1TK5B 4IKHA 1SU9A 3NOFA 5ID2B 1WMJA 3GSTA 5J3RA 1WPIA 5KN2A 1XWCA 3U5RE 6GSVA 1WJKA 4LMVA 2YWOA 2MBSA 2K8VA 3Q19A 5COHA 1PL2A 3JCML 2LNSA 3HZ8A 1A23A 4PGTA 2IFQA 2P0GA 4KDYA 3VWWA 1TOFA 2K9FA 4K9ZA 3QDNA 4OCEA 3L9SA 3MWHA 3WGXA 3O6TA 2MMAA 5B8AA 4NHZA 2ON5A 1U3AA 4WR5A 2R5GA 3QR6A 5CAXA 3BJ5A 1AQWA 3KTLA 4V1Ag 1YDKA 3TRPA 2B3SA 2M80A 3LWAA 2EIQA 1GRXA 3DEXA 3DVXA 4NPBA 2PWJA 5FT3A 5IIZA 3DMLA 3ZFBA 1FG4A 4MLYA 1LJRA 5AISA 5HQPA 4NV2A 1N2AA 4OFMA 1YJ6A 4N0ZA 1GSDA 4HU7A 1N8JA 5AN1A 5IPGA 4X0XA 6GSSA 2IMIA 1A8YA 1T8EB 5CYYA 5D9XA 1KEBA 2YV9A 5ECNB 2VOCA 1U88A 3LQ7A 4DVCA 3F9UA 2V6KA 2VCTA 4N30A 3FR3A 1WP0A 4MJBA 3EMXA 1OC9A 3GKMA 1BG5A 1T3BA 3IA1A 4G19A 4MJEA 4POMA 4O92A 3BOAA 2E7PA 3KTBA 3KM6A 3RHCA 4GCIA 1K0MA 3H1NA 4ZL8A 2WJUA 2HFDA 2YNXA 4K2DA 5D9VA 6GSWA 4XCSA 2CV4A 1EWXA 3KH7A 2L4QA 4EXJA 4IW9A 4KNDA 1FB6A 5EPFA 1GL8A 1TK0B 2FWEA 4F82A 4K6XA 1OKDA 4ZILA 3IHQA 2ZUPA 3UJ1A 1A0RP 1S3CA 1ZZYA 4IN0A 2OE3A 3HJMA 3G7YA 3GL5A 2H6ZA 1B4QA 3UARA 4WEYA 2B7JA 5CRHA 4ID0A 1TU8A 2IMFA 1YQ1A 2RLIA 3TJJA 1SKSB 3QAGA 2FWFA 2B5EA 3ZRDA 3O3TA 2F3MA 2A4VA 3TKRA 1T00A 5G30A 2I81A 4YH2A 1MD4A 4P3YB 2N5FA 4JR4A 2V6OA 4GF0A 2H70A 2PUKC 4USSA 3C8EA 5JCWA 4KGIA 2B1KA 2GQLA 4XRDA 3ZZXA 5DVBA 4F0CA 2IMDA 3IOSA 4RUVA 3US3A 3HYPA 1AQXA 4AJ6A 4MMMA 2P5RA 1GSQA 3FW2A 4XS4B 4XS6A 3EURA 3PINA 3ED3A 3KP8A 3L4NA 4XHMA 4PURA 2IPAA 1OE8A 1EEMA 2YJHA 1OE7A 2JZSA 4EDZA 1Q98A 3TKSE 4MJAA 1E2YA 5DQYA 3UOMA 1R4WA 3A2WA 22GSA 2G2QA 1GNWA 3UL3A 3TDGA 3FZ9A 2M46A 2MMOA 4MPGA 3GA4A 4DSSB 3H79A 2O85A 1OYJA 3ZITA 1C72A 2KUCA 3QD9A 2JSYA 1SKWB 2YZHA 1I5GA 4I2UA 4PUAA 1O8XA 4LLRA 5L71A 4XIHA 5IOWA 2XPDA 3VWVA 14GSA 1DE1A 2HLSA 3CXGA 3D0ZA 3GURA 2YPMA 2REMA 2WZ9A 4TXVA 3F4SA 2YZUA 4J57E 5IMDA 1ZL9A 1Y25A 2O89A 4F2IA 2ZNMA 1NW2A 4QL7A 2FWGA 1SENA 3VWUA 1V9WA 2DJ2A 4BWSA 5LNKe 1YEXA 3H8QA 5JWOB 5GSSA 1MDIA 3O76A 4Q5FA 2YWIA 1SD9A 1ZGNA 3EVIA 4EC0A 1JLWA 4K7NA 2WULA 2EIOA 1UC7A 1PX6A 1JZOA 4J56E 1GULA 4FIWA 4WBRD 3TJBA 2HI7A 3ZVJA 1TW9A 2YWMA 1NHOA 6GSXA 2HZEA 2NBSA 1IYIA 2WS2A 1WOUA 2WB9A 1SD8A 1EOGA 5IO2A 2QSIA 2LUSA 4HUAA 4KE3A 4MDCA 3A2XA 2VL3A 4F9ZA 1VF3A 1PN9A 1YEPA 2FHEA 1OKTA 1J08A 2OBIA 4N10A 2FGXA 1HQOA 1XWKA 1G7OA 4NAXA 3CTGA 2WDUA 1JFUA 2DJ3A 5A4VA 2VAFA 3FKFA 1HYUA 2HRAA 1TKDB 4ZXGA 4IJ3A 4XRAA 2DJJA 1AAZA 3VK9A 1K0CA 3HJOA 4ZIJA 2IMKA 5IOXA 5DJLA 2C4JA 1V58A 2RM6A 1PKZA 1XW6A 2L4CA 1GUHA 3DKSA 3OR5A 4DSRA 4KCAA 1JZRA 1U87A 4HJ2A 4XS1A 3F0IA 4L0WA 4GQFA 1TRWA 2LJAA 2VIMA 3D21A 1M9AA 1HNBA 3ERGA 1F2EA 3MDKA 1YZXA 3G7JA 3BCIA 3Q74A 1O6JA 3G7IA 3GH6A 4GQCA 2FNOA 3N5OA 3KXOA 5ECHB 3GTUB 1BQ7A 3SBCA 1XZOA 2L59A 4ILFA 2FA8A 4MJCA 4MF6A 2H73A 1FW1A 12GSA 2LJRA 2J9HA 2PBJA 2IN3A 3L9UA 3GX0A 2CZ2A 3DVWA 1X5EA 2LJKA 1O73A 4MZWA 3VURA 3J7Yb 1UVZA 4BVYB 2HZFA 5ECIB 3WT2A 5DQSA 2RM5A 4JR6A 3DYRA 3V1WA 4HI7A 1AIUA 2L5OA 1ERTA 3ZLPA 4MK3A 3K8NA 5CO3A 5D96A 1SK0A 1XW9A 3IV4A 3R2QA 4IHUA 5H5SA 5H5RA 4V2LA 3S9FA 3H93A 3D4TA 3LXTA 4HU9A 5A5KA 3IXRA 1Y6EA 5EL8A 3F6DA 2IL3A 4RI6A 1R7HA 1XFLA 2PN8A 4Q5RA 3F3QA 4IQAA 5ID2A 3WD6A 2VLVA 2LKUA 3ME7A 4KX4A 5JCUA 3KJYA 2G0FA 2H01A 3GMFA 4X1UA 5HR2A 1PRXA 1ZYQB 4ZBDA 1V40A 1XWBA 5HR0A 4K1FA 4OO5A 1ZCPA 3LORA 1UN2A 4ISDA 1K3LA 1QXHA 1BYEA 2VCZA 9GSSA 3TKPA 2BJXA 4F03A 2OKAA 2F51A 1WRYA 1Z6MA 1T4ZA 4N0VA 1K0OA 2PGTA 4O7HA 5HFKA 3QPMA 5FHIA 4O5RA 5E59A 2HXKA 1Z7RA 1B48A 3FZAA 5IMCA 3ZIJA 2E0QA 2R3XA 1GTAA 1PD21 5JWQB 6GSYA 2LRCA 1QGVA 2V32A 2GDRA 2KOKA 4DSQA 3APSA 3KMOA 1JZWA 1SK2A 3GKKA 5EY6A 1ZYEA 4JRRA 3DD3A 2C0EA 5EVOA 4IBPA 4N11A 1GSUA 4PNGA 1W4VA 1I9DA 5ECSA 3G9BA 3HXSA 3F6FA 2FCHA 2ON7A 4WF4A 1GNEA 2TRXA 2CVDA 3ZYWA 4HS1A 1K0BA 1EP7A 3FR9A 4HQSA 3CSHA 2KHPA 3L9VA 1G0TA 3IK9A 5DCHA 1W89A 2LRTA 1DE2A 3F4TA 1A0FA 4JZQA 2L6DA 4FYBA 2X99A 4I8BA 1TJDA 4X43A 3MNGA 2VCVA 5INYA 1M99A 2GVPA 5HR1A 3W6GA 3APOA 3CMIA 4LL4B 4Q5QA 3WT1A 4GXZA 5IQYA 2L5LA 4E8EA 3PH9A 3IE3A 3W8SA 2DMLA 4H86A 3M9JA 1XW5A 1AC1A 2X8CA 1F9MA 2AAWA 4TOPA 3GIXA 4TXOB 4KCEA 2EC4A 4EUYA 4KW6A 5B6NA 5ENUA 2OE0A 2E2GA 2MMZA 3ZMLA 2F9SA 2LV3A 3IC4A 4V2NA 4MA9A 5CP1A 2P5QA 3UVTA 4POBA 2X8HA 5ECOB 2DBCA 3DWVA 3EE2A 5B6MA 1S3AA 4ZL7A 1MEKA 1X9SB 3I43A 4CDOA 1K0DA 5DAKB 1NM3A 1PMTA 4J2FA 3TCOA 1A2JA 1GSSA 4RI7A 3HVSA 1WWJA 1PL1A 2CQ9A 3TB2A 2B7KA 2YANA 1O85A 3GFKA 4IELA 1RK4A 4BVXA 2R4VA 2X8GA 2BMXA 4XS4A 2GS3A 3QOUA 2YV7A 1WIKA 2F8AA 4K8MA 5HR3A 3ZFLA 1HNCA 1SL1B 3NIVA 1XWGA 1XIYA 3F8UA 5D8IA 4BVXB 1EOHA 1H4OA 2K8SA 3IK7A 3M3MA 1F37A 1PX7A 1XPVA 2KLXA 1XVQA 1A2MA 4K0GA 4DSSA 3EMPA 5E4WA 2J23A 1GH2A 5HFGA 4OD7A 1K3YA 4HQZA 3KIJA 1DSBA 5IMFA 4ZB9A 2CX3A 3M0FA 1TU7A 3QMXA 4EE0A 5J5NA 5IMZA 3ZL5A 3FYGA 1Z9HA 4DEJA 5G1KA 2VUPA 1GSFA 4NWYA 3Q6OA 4FH8A 1BX9A 1J9BA 4HOJA 2DJ1A 1FB0A 2GSQA 5D9WA 4AGSA 4OMVA 2XBIA 4ZBAA 1YF1A 2PVOC 1SJZA 3TOTA 2R37A 4TW5A 2C8UA 3GKXA 4AJ7A 2OJLA 2O7KA 2GSRA 3PPUA 4G9HA 4MH3A 2AV4A 2H1AA 1ZOFA 2D2ZA 4PXOA 2C1YA 3TKSA 3IC8A 4NMUA 4ZL9A 4IVFA 1R26A 2HT9A 2AHEA 3HD5A 3P7XA 5IO0A 1GLPA 1YF0A 3TJGA 2DJ0A 1QMVA 6GSTA 3VI7A 3RPNA 1PGTA 1IYHA 5AIVA 3VI5A 1CQHA 5JWRB 2GQMA 2I9HA 3HZ4A 2WFCA 4BL7A 3FEUA 4ECJA 2RIIA 1V2AA 3AY8A 2VD1A 2QGVA 5A4WA 3IPZA 2HE3A 1ERUA 3VLNA 1XWAA 4MF5A 2QC7A 4IGJA 4BL7B 3UEMA 4OO4A 3ZIVA 3RBTA 3FZ5A 1F6MC 5IMAA 1AXDA 3TKQA 1SL2B 4G0KA 5DALB 2FD3A 2HNLA 1XOBA 3KZQA 4I2TA 3C71A 4YQUA 4FYCA 2PMTA 1TP9A 3P90A 2PU9C 4CHSA 1G6WA 4KA0A 2QKEA 2V1MA 4EKZA 1YKCA 3D4MA 2C0FA 5ABRA 4ULXA 4HZ2A 1EP8A 2NDOA 4EL1A 1BJXA 5F06A 2H75A 1XOAA 2DIZA 1T1VA 4V2MA 1EZKA 1RW1A 2GZYA 1FO5A 2A2RA 4EF0A 2VLUA 3TRXA 2VL9A 3E0UA 3GTUA 2MZCA 4OWYA 4POKA 3ZVJD 1Z5YE 3I69A 1EV9A 5H5QA 2FLSA 3RPPA 4HJMA 7GSSA 3M1GA 1O81A 1M0UA 4TR1A 4HZ4A 3I6AA 2H0HA 4KF9A 2DLXA 1V57A 3A5WA 5ECKB 2I3YA 1GWCA 4EO3A 4KB3A 1NHYA 4BVYA 1ON4A 3MAKA 4HEA2 13GSA 2K6VA 3DXBA 2JADA 1S3DA 3EYTA 3IAS2 1THOA 2OBKA 4CW9A 4TR1B 3GX8A 4ML6A 5G1LA 4IJIA 5ECPB 2V41A 1TK8B 3GN3A 2OACA 4GLTA 1X9WB 4ZB6A 2CT6A 3QFBC 3HKRA 3HHVA 4IP6A 2HRNA 4G2EA 2GSSA 2H30A 3M8NA 1GLQA 3L78A 2C0GA 2LNTA 3GSSA 5D73A 4YAPA 1T7PB 3H4KA 1M7TA 4ZB8A 1EV4A 1VGLA 2CAQA 4POLA 1GTIA 3FRCA 1X5DA 1E6BA 2VM2A 2LRNA 1SJ6A 2K18A 3I9V2 3KGKA 1XVWA 5F0GA 5A4UA 2LS5A 5F8BA 3GV1A 2CAIA 1OVNA 1DBYA 3UMAA 3UVHA 1H75A 2B5XA 2HRKB 1OC8A 2XC2A 2H74A 3LJRA 1ILOA 3L0HA 4IQ1A 4PX1A 5FWGA 1LBKA 4WF5A 2R6KA 1DUGA 2VCXA 4MABA 5CRGA 1JZDA 10GSA 4YQMA 1EEJA 1X0RA 1V98A 4WKWA 2AB6A 4K7OA 2C0DA 3LFLA 4IP1A 17GSA 2MBTA 1TXXA 2A2SA 1U3IA 1RQMA 3D22A 4PQIA 3FY7A 3CSJA 2DMMA 1EGRA 1A2LA 2C3TA 3UIWA 4I6XA 1URMA 1X9MB 1K3OA 3C1SA 3HCZA 5GAPD 5DBQA 3RDWA 3ERWA 2CZ3A 4KAEA 2IMEA 5J9BA 3CBUA 1VF4A 1OAZA 4KDXA 5J9CA 2RUFA 5GAND 5DJMA 2IFQB 2DIYA 2FWHA 2PVQA 2ALBA 1SK1A 1QUWA 1FHEA 2L6CA 2LTKA 1UA5A 2BTOT 4WR4A 3TKSC 5G5FA 1FVKA 5G5EA 1Z7PA 3KCMA 1B8XA 2EIRA 2AJQB 2YOIA 3ME8A 2XPEA 4ACSA 4MCUA 3TUEA 2CVBA 1B4PA 4GSTA 5CREA 2GT5A 20GSA 4TXOA 4TRXA 2GSTA 3C7MA 2VO4A 1MDKA 4ML1A 2FUG2 3CTFA 3GH9A 2HYXA
chains in the Genus database with same CATH superfamily
2WCIA 4LA1A 4NV5A 1GUKA 3WYWA 2VL2A 4GRFA 1B9XC 2L57A 4GTUA 4G0LA 1FOVA 5F05A 4F0BA 1XBSA 3LEFA 4GSSA 5AGYA 5DAKA 1OC9B 1TDIA 1O8WA 3HA9A 3GUSA 1M2BA 4QQ7A 5DDLA 1R5PA 3A2VA 3WGDA 2ZCTA 3WGEA 2DJKA 2OE1A 1J0FA 5G31A 2AYTA 2H19A 3Q18A 2Z9SA 2B1LA 4TR4A 4AF2A 3CYNA 1AW9A 1FVJA 2TRCP 3EC3A 2AUVA 3BCKA 3IRAA 5C00A 5KN1A 5F07A 1F3BA 2I4AA 3DRNA 3LXZA 3C73A 3UAPA 5BRTA 3A3TA 3E3EA 2VM1A 4ECBA 1PQNA 1ZYNA 5J4YA 2H0GA 3KH9A 1PSQA 1U6TA 4MPFA 4KH7A 3GRXA 1A24A 4MZBA 1OC3A 4TR0A 1FAAA 1THXA 2WVZA 3IAM2 2WW0A 2GLRA 2H1DA 3UBLA 1MDJA 3U6VA 4MZCA 1YEWC 4TKYA 2XBQA 2LQQA 1O7UA 4KSMA 5LCZA 3NZNA 5JCGA 3LYKA 4RQRA 3PR8A 2O3EA 3VFIA 1XXUA 3QFAC 4FYUA 4K7IA 2HSNA 19GSA 3GNJA 4YKGA 4QL9A 4G0IA 2M72A 2H6XA 2H0IA 4BWQA 4YAVA 2DSAA 2WGRA 4MNNA 1BF5A 2DKHA 5A5HB 5IMVA 3CQFA 4KSOA 4V1Ap 1X5CA 1ST9A 3F63A 1GSEA 2HSNB 5BMUA 2P31A 4ZBBA 4ECCA 3EU3A 3QAVA 3TJKA 1GP1A 2PPTA 1TI3A 3FMWA 3FHKA 1JLVA 4O32A 4FQUA 5ECLB 1KBNA 1VF2A 2FA4A 1TTZA 5A1NA 3TOUA 2YWNA 3RGBC 5J41A 2JACA 2HSYA 1Q4JA 5BMUB 3C1RA 4ICYA 3FR6A 3IHGA 1SL0B 2GT6A 5GSTA 1ML6A 1YVLA 2H76A 3KMNA 1EGOA 4TR3A 4K0NA 4HDEA 3GYKA 1HD2A 3UBKA 3SWLA 2LSTA 4Z7XA 1PKWA 2JSZA 4JBBA 5A1NB 1ACVA 18GSA 5ELGA 3LYPA 3CSIA 4JU5A 3VPTA 3KP9A 1TRUA 1G6YA 5B7CA 3F3RA 1R5AA 2YP6A 2ES7A 6GSUA 5IPHA 4WETA 3EPTA 1ABAA 2C3NA 1MD3A 3J7Yk 3VPQA 4PTSA 4I97A 3KEBA 3EU4A 5D9TA 5KN3A 1AQVA 4PQHA 3EINA 1GUMA 4K5RA 1YY7A 2NTOA 4TN8A 5CRDA 3TRQA 4GSNA 4KUNA 2GGTA 1GSYA 2JZTA 3LG6A 2YJ7A 3BD2A 5C04A 1M9BA 5ECRB 2O8VB 2C3QA 1M3IA 1VRSD 2CVKA 5ECMB 3D5JA 1USBA 5LD0A 5KN0A 5DALA 3M9KA 2HSHA 4NXIA 4OCFA 4MF7A 1LU4A 1M2DA 2KP2A 3RAZA 2OADA 1ERWA 2TIRA 4JE1A 4O5UA 5AIXA 4LL1B 5IM9A 1K0AA 4YQVA 1SKRB 2GQKA 4L5LA 4ECIA 3GL3A 2H1BA 3ISOA 1KTEA 1SYRA 3QAWA 2LEGA 3GKNA 2NPBA 4MH2A 5A34B 1SYXA 3CRUA 1F3AA 3KD0A 1PA3A 3HDCA 2VCWA 4EDYA 2YCDA 2HZEB 2QA1A 4E8HA 1AUCA 3DIEA 2HRFA 2MYGA 2N5BA 1HNAA 2JL4A 3N9JA 1TI1A 3FZ4A 4I5QA 1GTBA 2CX4A 4PI2C 2OA7A 2R2JA 3DGQA 4NHWA 1BAYA 3HVXA 2JU5A 3IBHA 4G10A 3W8JA 2I1UA 2UZ8A 4CY6A 3HJPA 4BA7A 1KNGA 2LQOA 3IR4A 3LGCA 4AKIA 3IDVA 3CRTA 5CRWA 5G2ZA 4L5OA 1SJIA 1WE0A 4ZB7A 4AJ8A 5HFIA 4WXTA 4AKHA 3APQA 3P2AA 4PNFA 11GSA 3GHAA 1B9YC 1TRSA 1T4YA 2F8FA 2VD0A 4GWRA 1Z6NA 1XCCA 1YKAA 3R3EA 4K2XA 1MTCA 2CA8A 3FK8A 2VL2C 2YN1A 2HSMA 2IJYA 2GTUA 2H1GA 2HQTA 4PQ1A 1BEDA 1G7EA 3P8WA 2E2MA 4TVEA 2KP1A 1FOHA 4JEDA 2V2GA 2FY6A 1QK8A 4OFTA 1A8LA 3BBYA 4MP4A 4OFNA 3F4RA 3D6IA 3VWXA 2MMNA 3ERFA 3MSZA 3QCPA 8GSSA 5J4UA 5KEJA 2HSMB 2H6YA 5B8BA 2B6MA 2N5AA 3PGTA 4L0UA 3HY2A 1CQGA 2JZRA 3RHBA 2IWTA 4XTSA 4WBJA 4EIPA 2H66A 16GSA 2X64A 2C80A 4KDUA 3TGZA 2IIYA 4FO5A 1VF1A 1ZMAA 2HRKA 3ZMKA 2PERA 2WRTA 4Q5NA 4RQXA 2NVLA 5CNWA 4L8EA 2H71A 2O87A 2H72A 3LSZA 1M3JA 1QFNA 5ELAA 4N3ZA 4EVMA 2RUEA 3ZREA 4LMWA 2H8LA 2B5YA 1JHBA 4IS0A 3HVVA 4D73A 5ECQB 3E9JB 1QQ2A 2O36A 5GZZB 1K0NA 2DC5A 3ZTLA 2GZZA 3TJFA 1ERVA 4PUFC 1Z3EA 1M2AA 1NSWA 2VLTA 1TRVA 2XHFA 2GZPA 5D93A 4D73B 5DCGA 2VCQA 1GTUA 3EWLA 4BPYA 1TK5B 4IKHA 1SU9A 3NOFA 5ID2B 1WMJA 3GSTA 5J3RA 1WPIA 5KN2A 1XWCA 3U5RE 2WW2A 6GSVA 1WJKA 4LMVA 2YWOA 2MBSA 2K8VA 2WZSA 3Q19A 5COHA 1PL2A 3JCML 2LNSA 3HZ8A 1A23A 4HSCX 4PGTA 2IFQA 2P0GA 1XG8A 4KDYA 3VWWA 1TOFA 2K9FA 4K9ZA 3QDNA 4OCEA 3L9SA 3MWHA 3WGXA 3O6TA 2A2PA 2MMAA 5B8AA 4NHZA 2ON5A 1U3AA 4WR5A 2R5GA 3QR6A 5CAXA 3BJ5A 1AQWA 3KTLA 4V1Ag 1YDKA 3TRPA 2B3SA 2M80A 3LWAA 2EIQA 1GRXA 3DEXA 3DVXA 4NPBA 2PWJA 5FT3A 5IIZA 3DMLA 3ZFBA 1FG4A 4MLYA 1LJRA 5AISA 5HQPA 4NV2A 1N2AA 4OFMA 1YJ6A 3CHXC 4N0ZA 1GSDA 4HU7A 1N8JA 5AN1A 5IPGA 4X0XA 6GSSA 2IMIA 1A8YA 1T8EB 5CYYA 5D9XA 1KEBA 2YV9A 5ECNB 2VOCA 1U88A 3LQ7A 4DVCA 3F9UA 4O5QA 2V6KA 2VCTA 4N30A 3FR3A 1WP0A 4MJBA 3EMXA 1OC9A 3GKMA 1BG5A 1T3BA 4CY8A 3IA1A 4G19A 4MJEA 4POMA 4O92A 3BOAA 2E7PA 2EFCA 3KTBA 3KM6A 3RHCA 4GCIA 1K0MA 3H1NA 4ZL8A 2WJUA 2HFDA 2YNXA 4K2DA 5D9VA 6GSWA 4XCSA 2CV4A 1EWXA 3KH7A 1BG1A 2L4QA 4EXJA 4IW9A 4A5PA 4KNDA 1FB6A 5EPFA 1GL8A 1TK0B 2FWEA 4F82A 4K6XA 1OKDA 4ZILA 3IHQA 2ZUPA 3UJ1A 1A0RP 1S3CA 1ZZYA 4IN0A 2OE3A 3HJMA 3G7YA 3GL5A 2H6ZA 1B4QA 1ZYPA 3UARA 4WEYA 2B7JA 5CRHA 4ID0A 1TU8A 2IMFA 1YQ1A 1PN0A 4YKFA 2RLIA 3TJJA 1SKSB 3QAGA 2FWFA 2B5EA 3ZRDA 3O3TA 2F3MA 2A4VA 3TKRA 1T00A 5G30A 2I81A 4YH2A 1MD4A 4P3YB 2N5FA 4JR4A 5A5HA 2V6OA 4GF0A 5J4VA 2H70A 2PUKC 4USSA 3C8EA 5JCWA 1I1IP 4KGIA 2B1KA 2GQLA 4XRDA 3ZZXA 5DVBA 4F0CA 2IMDA 3IOSA 4RUVA 3US3A 3HYPA 1AQXA 4AJ6A 1N25A 4MMMA 2P5RA 1GSQA 3FW2A 4XS4B 4XS6A 3EURA 3PINA 3ED3A 3KP8A 3L4NA 4XHMA 4PURA 2IPAA 1OE8A 1EEMA 2YJHA 1OE7A 2JZSA 4EDZA 1Q98A 3TKSE 4MJAA 1E2YA 5DQYA 3UOMA 1R4WA 3A2WA 22GSA 2G2QA 1GNWA 3UL3A 3TDGA 3FZ9A 2M46A 2MMOA 4MPGA 3GA4A 4DSSB 3H79A 2O85A 1OYJA 3ZITA 1C72A 2KUCA 3QD9A 2JSYA 4K5SA 1SKWB 2YZHA 1I5GA 4I2UA 4PUAA 1O8XA 2OT3A 4LLRA 5L71A 4XIHA 5IOWA 2XPDA 3VWVA 14GSA 1DE1A 2HLSA 3CXGA 3D0ZA 3GURA 2YPMA 2REMA 2WZ9A 4TXVA 3F4SA 2YZUA 4J57E 5IMDA 1ZL9A 1Y25A 2O89A 4F2IA 2ZNMA 1NW2A 4QL7A 2FWGA 1SENA 3VWUA 1V9WA 2DJ2A 3HMJG 4BWSA 5LNKe 1YEXA 3H8QA 5JWOB 5GSSA 1MDIA 3O76A 4Q5FA 2YWIA 1SD9A 1ZGNA 3EVIA 4EC0A 1JLWA 2UV8G 4K7NA 2WULA 2EIOA 5A34A 1UC7A 1PX6A 1JZOA 4J56E 1GULA 4FIWA 4WBRD 3TJBA 2HI7A 3ZVJA 1TW9A 2YWMA 2R0GA 1NHOA 6GSXA 2HZEA 2NBSA 1IYIA 2WS2A 1WOUA 2WB9A 1SD8A 1EOGA 5IO2A 2QSIA 2LUSA 4HUAA 4KE3A 4MDCA 3A2XA 2VL3A 4F9ZA 1VF3A 1PN9A 1YEPA 3HVNA 2FHEA 1OKTA 1J08A 2OBIA 4N10A 2FGXA 1HQOA 1XWKA 1G7OA 4NAXA 3CTGA 2WDUA 1JFUA 2DJ3A 5A4VA 2VAFA 3FKFA 1HYUA 2HRAA 1TKDB 4ZXGA 4IJ3A 4XRAA 2DJJA 1AAZA 3VK9A 1K0CA 3HJOA 4ZIJA 2IMKA 5IOXA 2WVXA 5DJLA 2C4JA 1V58A 2RM6A 1PKZA 1XW6A 2L4CA 1GUHA 3DKSA 3OR5A 4DSRA 4KCAA 1JZRA 1U87A 4HJ2A 4XS1A 3F0IA 4L0WA 4GQFA 4QMKA 1TRWA 2LJAA 2VIMA 3D21A 1M9AA 1HNBA 2WVXB 3ERGA 1F2EA 3MDKA 1YZXA 3G7JA 3BCIA 3Q74A 1O6JA 3G7IA 3GH6A 4GQCA 2FNOA 3N5OA 3KXOA 5ECHB 3GTUB 1BQ7A 3SBCA 1XZOA 2EFEA 2L59A 4ILFA 2FA8A 4MJCA 4MF6A 2H73A 1FW1A 12GSA 2LJRA 2J9HA 2PBJA 2IN3A 3L9UA 3GX0A 2CZ2A 3A5IA 3DVWA 2H1LA 1X5EA 2LJKA 1O73A 4MZWA 3VURA 3J7Yb 1UVZA 4BVYB 2HZFA 5ECIB 3WT2A 5DQSA 5KOXA 2RM5A 4JR6A 3DYRA 3V1WA 4HI7A 1AIUA 2L5OA 1ERTA 3ZLPA 4MK3A 3K8NA 5CO3A 5D96A 2R0PA 1SK0A 1XW9A 3IV4A 3R2QA 4IHUA 5H5SA 5H5RA 4V2LA 3S9FA 3H93A 3D4TA 3LXTA 4HU9A 5A5KA 3IXRA 1Y6EA 5EL8A 3F6DA 2IL3A 4RI6A 1R7HA 1XFLA 2PN8A 4Q5RA 3F3QA 4IQAA 5ID2A 3WD6A 2VLVA 2LKUA 4KX4A 5JCUA 3ME7A 3KJYA 2G0FA 2H01A 3GMFA 4Z2UA 4X1UA 5HR2A 1PRXA 1ZYQB 4ZBDA 1V40A 1XWBA 5HR0A 4GDFA 4K1FA 4OO5A 1ZCPA 3LORA 1UN2A 2A4HA 4ISDA 1K3LA 1SVOA 1BYEA 1QXHA 2X49A 2WW1A 2VCZA 9GSSA 3TKPA 2BJXA 4F03A 2OKAA 2F51A 1WRYA 1Z6MA 1T4ZA 4N0VA 2DKIA 4Z2RA 1K0OA 2PGTA 4O7HA 5HFKA 3QPMA 1SVMA 5FHIA 4O5RA 5E59A 2HXKA 1Z7RA 2R0CA 1B48A 3FZAA 5IMCA 3ZIJA 2E0QA 2R3XA 1GTAA 1PD21 5JWQB 6GSYA 2LRCA 1QGVA 2V32A 2GDRA 2KOKA 4DSQA 3APSA 3KMOA 1JZWA 1SK2A 3GKKA 5EY6A 2WW3A 1ZYEA 4JRRA 3DD3A 2C0EA 5EVOA 3TU3B 4IBPA 4N11A 1GSUA 4PNGA 1W4VA 1I9DA 5ECSA 3G9BA 3HXSA 3F6FA 2FCHA 2ON7A 4WF4A 1GNEA 2TRXA 2CVDA 3ZYWA 4HS1A 1K0BA 1EP7A 3FR9A 4HQSA 3CSHA 2KHPA 4E68A 3L9VA 1G0TA 3IK9A 5DCHA 1W89A 2LRTA 1DE2A 3F4TA 1A0FA 4JZQA 2L6DA 4FYBA 2X99A 4I8BA 1TJDA 4X43A 2QA2A 3MNGA 2VCVA 5INYA 1M99A 2GVPA 5HR1A 3W6GA 3APOA 3CMIA 4LL4B 4Q5QA 3WT1A 4GXZA 5IQYA 2L5LA 4E8EA 3PH9A 3IE3A 3W8SA 2DMLA 3M9JA 4H86A 1XW5A 1AC1A 2X8CA 1F9MA 2AAWA 4TOPA 3GIXA 4TXOB 4KCEA 2EC4A 4EUYA 4KW6A 5B6NA 5ENUA 2OE0A 2E2GA 2MMZA 1S3RA 3ZMLA 2F9SA 2LV3A 3IC4A 4V2NA 4MA9A 5CP1A 2P5QA 3UVTA 4POBA 2X8HA 3CWGA 5ECOB 2DBCA 3DWVA 3EE2A 5B6MA 1S3AA 4AKXB 4ZL7A 1MEKA 1X9SB 3I43A 4CDOA 1K0DA 5DAKB 1NM3A 1PMTA 2O5VA 4J2FA 3TCOA 1A2JA 1GSSA 4RI7A 3HVSA 1WWJA 1PL1A 2CQ9A 3TB2A 2B7KA 2YANA 1O85A 3GFKA 4IELA 5J47A 1RK4A 4BVXA 2R4VA 2X8GA 2BMXA 4XS4A 2GS3A 3QOUA 2YV7A 1WIKA 2F8AA 4K8MA 5HR3A 3ZFLA 1HNCA 1SL1B 4X4JA 3NIVA 1XWGA 1XIYA 3F8UA 5D8IA 4BVXB 1EOHA 1H4OA 2K8SA 3IK7A 3M3MA 1F37A 1PX7A 1XPVA 2KLXA 1XVQA 1A2MA 4K0GA 4DSSA 3EMPA 5E4WA 2J23A 1GH2A 5HFGA 4OD7A 2EFDA 1K3YA 4HQZA 3KIJA 1DSBA 5IMFA 4ZB9A 2CX3A 3M0FA 1TU7A 3QMXA 4EE0A 5J5NA 5IMZA 3ZL5A 3FYGA 1Z9HA 4DEJA 5G1KA 2VUPA 1GSFA 4NWYA 3Q6OA 4FH8A 1BX9A 1J9BA 4HOJA 2DJ1A 1FB0A 2GSQA 5D9WA 4AGSA 4OMVA 2XBIA 4ZBAA 1YF1A 4W66A 4AKGA 2PVOC 1SJZA 3TOTA 2R37A 4TW5A 2C8UA 3GKXA 4AJ7A 2OJLA 2O7KA 2GSRA 3PPUA 4G9HA 4MH3A 2AV4A 1PFOA 2H1AA 1ZOFA 2D2ZA 4PXOA 2C1YA 3TKSA 3IC8A 4NMUA 4ZL9A 4IVFA 1R26A 2HT9A 2AHEA 3HD5A 3P7XA 5IO0A 1GLPA 1YF0A 3TJGA 2DJ0A 1QMVA 6GSTA 3VI7A 3RPNA 1PGTA 2WVYA 1IYHA 5AIVA 3VI5A 1CQHA 5JWRB 2GQMA 2I9HA 3HZ4A 2WFCA 5KOWA 4BL7A 3FEUA 4ECJA 2RIIA 1V2AA 3AY8A 2VD1A 4PHZC 2QGVA 5A4WA 3IPZA 2HE3A 1ERUA 3VLNA 1XWAA 4MF5A 2QC7A 4IGJA 4BL7B 3UEMA 4OO4A 3ZIVA 3RBTA 3FZ5A 1F6MC 5IMAA 1AXDA 3TKQA 1SL2B 4G0KA 5DALB 2X4AA 2FD3A 2HNLA 1XOBA 3KZQA 4I2TA 3C71A 4YQUA 4FYCA 2PMTA 1TP9A 3P90A 2PU9C 4AI6A 4CHSA 4Z2TA 1G6WA 4KA0A 4EIQA 2QKEA 2V1MA 4EKZA 1YKCA 3D4MA 2C0FA 5ABRA 4ULXA 4HZ2A 1EP8A 2NDOA 4EL1A 1BJXA 5F06A 2H75A 1XOAA 2DIZA 1T1VA 4V2MA 1EZKA 1RW1A 2GZYA 1FO5A 2A2RA 4EF0A 2VLUA 3TRXA 2VL9A 3E0UA 3GTUA 2MZCA 4OWYA 4POKA 3ZVJD 1Z5YE 3I69A 1EV9A 4BIKA 5H5QA 2FLSA 3RPPA 4HJMA 7GSSA 3M1GA 1S4BP 1O81A 1M0UA 4TR1A 4HZ4A 3I6AA 2H0HA 4KF9A 2DLXA 1V57A 3A5WA 5ECKB 2I3YA 1GWCA 4EO3A 4KB3A 1NHYA 4BVYA 1ON4A 3MAKA 4HEA2 13GSA 2K6VA 3DXBA 2JADA 1S3DA 3EYTA 5J40A 3IAS2 1THOA 2OBKA 4CW9A 2VKZG 4TR1B 3GX8A 4ML6A 5G1LA 4IJIA 5ECPB 2V41A 1TK8B 3GN3A 2OACA 4GLTA 1X9WB 4ZB6A 2CT6A 3QFBC 3HKRA 3HHVA 4IP6A 2HRNA 4G2EA 2GSSA 2H30A 3M8NA 1GLQA 1TXUA 2EFHA 3L78A 2C0GA 2LNTA 3GSSA 5D73A 4YAPA 1T7PB 3H4KA 1M7TA 4ZB8A 1EV4A 1VGLA 2CAQA 1Y1UA 4POLA 1GTIA 3FRCA 1X5DA 1E6BA 2VM2A 2LRNA 1SJ6A 2K18A 3I9V2 3KGKA 1XVWA 5F0GA 5A4UA 2LS5A 5F8BA 3GV1A 2CAIA 3MYDA 1OVNA 1DBYA 3UMAA 3UVHA 1H75A 2B5XA 2HRKB 1OC8A 2XC2A 2H74A 3LJRA 1ILOA 3L0HA 4IQ1A 3LW9A 4PX1A 5FWGA 1LBKA 4WF5A 2R6KA 1DUGA 2VCXA 4MABA 5CRGA 1JZDA 10GSA 4YQMA 1EEJA 1X0RA 1V98A 4WKWA 2AB6A 4K7OA 2C0DA 3LFLA 4IP1A 17GSA 2MBTA 1TXXA 2A2SA 1U3IA 1RQMA 3D22A 4PQIA 4FXYP 3FY7A 3CSJA 2DMMA 1SVLA 4G01A 1EGRA 1A2LA 2C3TA 3UIWA 4I6XA 1URMA 1X9MB 1K3OA 3C1SA 3HCZA 5GAPD 5DBQA 3RDWA 3ERWA 2CZ3A 4KAEA 2IMEA 5J9BA 3CBUA 1VF4A 1OAZA 4KDXA 5J9CA 2RUFA 5GAND 5DJMA 2IFQB 2DIYA 2FWHA 2PVQA 2ALBA 1SK1A 1QUWA 1FHEA 2L6CA 2LTKA 1UA5A 2BTOT 4WR4A 3TKSC 5G5FA 1FVKA 5G5EA 1Z7PA 3KCMA 1B8XA 2EIRA 2AJQB 2YOIA 3ME8A 3RFRC 2XPEA 4ACSA 4MCUA 3TUEA 3MIXA 2CVBA 1B4PA 4GSTA 5CREA 2GT5A 20GSA 4TXOA 4TRXA 2GSTA 3C7MA 2VO4A 1MDKA 4ML1A 2FUG2 4PI0C 3CTFA 3GH9A 2HYXA
chains in the Genus database with same CATH topology
2WCIA 4LA1A 4NV5A 1GUKA 3WYWA 2VL2A 4GRFA 1B9XC 2L57A 4GTUA 4G0LA 1FOVA 5F05A 4F0BA 1XBSA 3LEFA 4GSSA 5AGYA 5DAKA 1OC9B 1TDIA 1O8WA 3HA9A 3GUSA 1M2BA 4QQ7A 5DDLA 1R5PA 3A2VA 3WGDA 2ZCTA 3WGEA 2DJKA 2OE1A 1J0FA 5G31A 2AYTA 2H19A 3Q18A 2Z9SA 2B1LA 4TR4A 4AF2A 3CYNA 1AW9A 1FVJA 2TRCP 3EC3A 2AUVA 3BCKA 3IRAA 5C00A 5KN1A 5F07A 1F3BA 2I4AA 3DRNA 3LXZA 3C73A 3UAPA 5BRTA 3A3TA 3E3EA 2VM1A 4ECBA 1PQNA 1ZYNA 5J4YA 2H0GA 3KH9A 1PSQA 1U6TA 4MPFA 4KH7A 3GRXA 1A24A 4MZBA 1OC3A 4TR0A 1FAAA 1THXA 3IAM2 2H1DA 2GLRA 3UBLA 1MDJA 3U6VA 4MZCA 4TKYA 2XBQA 2LQQA 1O7UA 4KSMA 5LCZA 3NZNA 5JCGA 3LYKA 4RQRA 3PR8A 3VFIA 1XXUA 3QFAC 4FYUA 4K7IA 2HSNA 19GSA 3GNJA 4YKGA 4QL9A 4G0IA 2M72A 2H6XA 2H0IA 4BWQA 4YAVA 2DSAA 2WGRA 4MNNA 1BF5A 2DKHA 5A5HB 5IMVA 4KSOA 4V1Ap 1X5CA 1ST9A 3F63A 1GSEA 2HSNB 5BMUA 2P31A 4ZBBA 4ECCA 3EU3A 3QAVA 3TJKA 1GP1A 2PPTA 1TI3A 3FMWA 3FHKA 1JLVA 4O32A 4FQUA 5ECLB 1KBNA 1VF2A 2FA4A 1TTZA 5A1NA 3TOUA 2YWNA 5J41A 2JACA 2HSYA 1Q4JA 5BMUB 3C1RA 4ICYA 3FR6A 3IHGA 1SL0B 2GT6A 5GSTA 1ML6A 1YVLA 2H76A 3KMNA 1EGOA 4TR3A 4K0NA 4HDEA 3GYKA 1HD2A 3UBKA 3SWLA 2LSTA 4Z7XA 1PKWA 2JSZA 4JBBA 5A1NB 1ACVA 18GSA 5ELGA 3LYPA 3CSIA 4JU5A 3VPTA 3KP9A 1TRUA 1G6YA 5B7CA 3F3RA 1R5AA 2YP6A 2ES7A 6GSUA 5IPHA 4WETA 3EPTA 1ABAA 2C3NA 1MD3A 3J7Yk 3VPQA 4PTSA 4I97A 3KEBA 3EU4A 5D9TA 5KN3A 1AQVA 4PQHA 3EINA 1GUMA 4K5RA 1YY7A 2NTOA 4TN8A 5CRDA 3TRQA 4GSNA 4KUNA 2GGTA 1GSYA 2JZTA 3LG6A 2YJ7A 3BD2A 5C04A 1M9BA 5ECRB 2O8VB 2C3QA 1VRSD 2CVKA 5ECMB 3D5JA 1USBA 5LD0A 5KN0A 5DALA 3M9KA 2HSHA 4NXIA 4OCFA 4MF7A 1LU4A 1M2DA 2KP2A 3RAZA 2OADA 1ERWA 2TIRA 4JE1A 4O5UA 5AIXA 4LL1B 5IM9A 1K0AA 4YQVA 1SKRB 2GQKA 4L5LA 4ECIA 3GL3A 2H1BA 3ISOA 1KTEA 1SYRA 3QAWA 2LEGA 3GKNA 2NPBA 4MH2A 5A34B 1SYXA 3CRUA 1F3AA 3KD0A 1PA3A 3HDCA 2VCWA 4EDYA 2YCDA 2HZEB 2QA1A 4E8HA 1AUCA 3DIEA 2HRFA 2MYGA 2N5BA 1HNAA 2JL4A 3N9JA 1TI1A 3FZ4A 4I5QA 1GTBA 2CX4A 2OA7A 2R2JA 3DGQA 4NHWA 1BAYA 3HVXA 2JU5A 3IBHA 4G10A 3W8JA 2I1UA 2UZ8A 4CY6A 3HJPA 4BA7A 1KNGA 2LQOA 3IR4A 3LGCA 4AKIA 3IDVA 3CRTA 5CRWA 5G2ZA 4L5OA 1SJIA 1WE0A 4ZB7A 4AJ8A 5HFIA 4WXTA 4AKHA 3APQA 3P2AA 4PNFA 11GSA 3GHAA 1B9YC 1TRSA 1T4YA 2F8FA 2VD0A 4GWRA 1Z6NA 1XCCA 1YKAA 3R3EA 4K2XA 1MTCA 2CA8A 3FK8A 2VL2C 2YN1A 2HSMA 2IJYA 2GTUA 2H1GA 2HQTA 4PQ1A 1BEDA 1G7EA 3P8WA 2E2MA 4TVEA 2KP1A 1FOHA 4JEDA 2V2GA 2FY6A 1QK8A 4OFTA 1A8LA 3BBYA 4MP4A 4OFNA 3F4RA 3D6IA 3VWXA 2MMNA 3ERFA 3MSZA 3QCPA 8GSSA 5J4UA 5KEJA 2HSMB 2H6YA 5B8BA 2B6MA 2N5AA 3PGTA 4L0UA 3HY2A 1CQGA 2JZRA 3RHBA 2IWTA 4XTSA 4WBJA 4EIPA 2H66A 16GSA 2X64A 2C80A 4KDUA 3TGZA 2IIYA 4FO5A 1VF1A 1ZMAA 2HRKA 3ZMKA 2PERA 2WRTA 4Q5NA 4RQXA 2NVLA 5CNWA 4L8EA 2H71A 2O87A 2H72A 3LSZA 1QFNA 5ELAA 4N3ZA 4EVMA 2RUEA 3ZREA 4LMWA 2H8LA 2B5YA 1JHBA 4IS0A 3HVVA 4D73A 5ECQB 3E9JB 1QQ2A 5GZZB 1K0NA 2DC5A 3ZTLA 2GZZA 3TJFA 1ERVA 4PUFC 1Z3EA 1M2AA 1NSWA 2VLTA 1TRVA 2XHFA 2GZPA 5D93A 4D73B 5DCGA 2VCQA 1GTUA 3EWLA 4BPYA 1TK5B 4IKHA 1SU9A 3NOFA 5ID2B 1WMJA 3GSTA 5J3RA 1WPIA 5KN2A 1XWCA 3U5RE 6GSVA 1WJKA 4LMVA 2YWOA 2MBSA 2K8VA 3Q19A 5COHA 1PL2A 3JCML 2LNSA 3HZ8A 1A23A 4PGTA 2IFQA 2P0GA 4KDYA 3VWWA 1TOFA 2K9FA 4K9ZA 3QDNA 4OCEA 3L9SA 3MWHA 3WGXA 3O6TA 2A2PA 2MMAA 5B8AA 4NHZA 2ON5A 1U3AA 4WR5A 2R5GA 3QR6A 5CAXA 3BJ5A 1AQWA 3KTLA 4V1Ag 1YDKA 3TRPA 2B3SA 2M80A 3LWAA 2EIQA 1GRXA 3DEXA 3DVXA 4NPBA 2PWJA 5FT3A 5IIZA 3DMLA 3ZFBA 1FG4A 4MLYA 1LJRA 5AISA 5HQPA 4NV2A 1N2AA 4OFMA 1YJ6A 4N0ZA 1GSDA 4HU7A 1N8JA 5AN1A 5IPGA 4X0XA 6GSSA 2IMIA 1A8YA 1T8EB 5CYYA 5D9XA 1KEBA 2YV9A 5ECNB 2VOCA 1U88A 3LQ7A 4DVCA 3F9UA 4O5QA 2V6KA 2VCTA 4N30A 3FR3A 1WP0A 4MJBA 3EMXA 1OC9A 3GKMA 1BG5A 1T3BA 4CY8A 3IA1A 4G19A 4MJEA 4POMA 4O92A 3BOAA 2E7PA 2EFCA 3KTBA 3KM6A 3RHCA 4GCIA 1K0MA 3H1NA 4ZL8A 2WJUA 2HFDA 2YNXA 4K2DA 5D9VA 6GSWA 4XCSA 2CV4A 1EWXA 3KH7A 1BG1A 2L4QA 4EXJA 4IW9A 4A5PA 4KNDA 1FB6A 5EPFA 1GL8A 1TK0B 2FWEA 4F82A 4K6XA 1OKDA 4ZILA 3IHQA 2ZUPA 3UJ1A 1A0RP 1S3CA 1ZZYA 4IN0A 2OE3A 3HJMA 3G7YA 3GL5A 2H6ZA 1B4QA 1ZYPA 3UARA 4WEYA 2B7JA 5CRHA 4ID0A 1TU8A 2IMFA 1YQ1A 1PN0A 4YKFA 2RLIA 3TJJA 1SKSB 3QAGA 2FWFA 2B5EA 3ZRDA 3O3TA 2F3MA 2A4VA 3TKRA 1T00A 5G30A 2I81A 4YH2A 1MD4A 4P3YB 2N5FA 4JR4A 5A5HA 2V6OA 4GF0A 5J4VA 2H70A 2PUKC 4USSA 3C8EA 5JCWA 4KGIA 2B1KA 2GQLA 4XRDA 3ZZXA 5DVBA 4F0CA 2IMDA 3IOSA 4RUVA 3US3A 3HYPA 1AQXA 4AJ6A 1N25A 4MMMA 2P5RA 1GSQA 3FW2A 4XS4B 4XS6A 3EURA 3PINA 3ED3A 3KP8A 3L4NA 4XHMA 4PURA 2IPAA 1OE8A 1EEMA 2YJHA 1OE7A 2JZSA 4EDZA 1Q98A 3TKSE 4MJAA 1E2YA 5DQYA 3UOMA 1R4WA 3A2WA 22GSA 2G2QA 1GNWA 3UL3A 3TDGA 3FZ9A 2M46A 2MMOA 4MPGA 3GA4A 4DSSB 3H79A 2O85A 1OYJA 3ZITA 1C72A 2KUCA 3QD9A 2JSYA 4K5SA 1SKWB 2YZHA 1I5GA 4I2UA 4PUAA 1O8XA 2OT3A 4LLRA 5L71A 4XIHA 5IOWA 2XPDA 3VWVA 14GSA 1DE1A 2HLSA 3CXGA 3D0ZA 3GURA 2YPMA 2REMA 2WZ9A 4TXVA 3F4SA 2YZUA 4J57E 5IMDA 1ZL9A 1Y25A 2O89A 4F2IA 2ZNMA 1NW2A 4QL7A 2FWGA 1SENA 3VWUA 1V9WA 2DJ2A 3HMJG 4BWSA 5LNKe 1YEXA 3H8QA 5JWOB 5GSSA 1MDIA 3O76A 4Q5FA 2YWIA 1SD9A 1ZGNA 3EVIA 4EC0A 1JLWA 2UV8G 4K7NA 2WULA 2EIOA 5A34A 1UC7A 1PX6A 1JZOA 4J56E 1GULA 4FIWA 4WBRD 3TJBA 2HI7A 3ZVJA 1TW9A 2YWMA 2R0GA 1NHOA 6GSXA 2HZEA 2NBSA 1IYIA 2WS2A 1WOUA 2WB9A 1SD8A 1EOGA 5IO2A 2QSIA 2LUSA 4HUAA 4KE3A 4MDCA 3A2XA 2VL3A 4F9ZA 1VF3A 1PN9A 1YEPA 2FHEA 1OKTA 1J08A 2OBIA 4N10A 2FGXA 1HQOA 1XWKA 1G7OA 4NAXA 3CTGA 2WDUA 1JFUA 2DJ3A 5A4VA 2VAFA 3FKFA 1HYUA 2HRAA 1TKDB 4ZXGA 4IJ3A 4XRAA 2DJJA 1AAZA 3VK9A 1K0CA 3HJOA 4ZIJA 2IMKA 5IOXA 5DJLA 2C4JA 1V58A 2RM6A 1PKZA 1XW6A 2L4CA 1GUHA 3DKSA 3OR5A 4DSRA 4KCAA 1JZRA 1U87A 4HJ2A 4XS1A 3F0IA 4L0WA 4GQFA 4QMKA 1TRWA 2LJAA 2VIMA 3D21A 1M9AA 1HNBA 3ERGA 1F2EA 3MDKA 1YZXA 3G7JA 3BCIA 3Q74A 1O6JA 3G7IA 3GH6A 4GQCA 2FNOA 3N5OA 3KXOA 5ECHB 3GTUB 1BQ7A 3SBCA 1XZOA 2EFEA 2L59A 4ILFA 2FA8A 4MJCA 4MF6A 2H73A 1FW1A 12GSA 2LJRA 2J9HA 2PBJA 2IN3A 3L9UA 3GX0A 2CZ2A 3A5IA 3DVWA 2H1LA 1X5EA 2LJKA 1O73A 4MZWA 3VURA 3J7Yb 1UVZA 4BVYB 2HZFA 5ECIB 3WT2A 5DQSA 5KOXA 2RM5A 4JR6A 3DYRA 3V1WA 4HI7A 1AIUA 2L5OA 1ERTA 3ZLPA 4MK3A 3K8NA 5CO3A 5D96A 2R0PA 1SK0A 1XW9A 3IV4A 3R2QA 4IHUA 5H5SA 5H5RA 4V2LA 3S9FA 3H93A 3D4TA 3LXTA 4HU9A 5A5KA 3IXRA 1Y6EA 5EL8A 3F6DA 2IL3A 4RI6A 1R7HA 1XFLA 2PN8A 4Q5RA 3F3QA 4IQAA 5ID2A 3WD6A 2VLVA 2LKUA 3ME7A 4KX4A 5JCUA 3KJYA 2G0FA 2H01A 3GMFA 4Z2UA 4X1UA 5HR2A 1PRXA 1ZYQB 4ZBDA 1V40A 1XWBA 5HR0A 4GDFA 4K1FA 4OO5A 1ZCPA 3LORA 1UN2A 2A4HA 4ISDA 1K3LA 1SVOA 1BYEA 1QXHA 2X49A 2VCZA 9GSSA 3TKPA 2BJXA 4F03A 2OKAA 2F51A 1WRYA 1Z6MA 1T4ZA 4N0VA 2DKIA 4Z2RA 1K0OA 2PGTA 4O7HA 5HFKA 3QPMA 1SVMA 5FHIA 4O5RA 5E59A 2HXKA 1Z7RA 2R0CA 1B48A 3FZAA 5IMCA 3ZIJA 2E0QA 2R3XA 1GTAA 1PD21 5JWQB 6GSYA 2LRCA 1QGVA 2V32A 2GDRA 2KOKA 4DSQA 3APSA 3KMOA 1JZWA 1SK2A 3GKKA 5EY6A 1ZYEA 4JRRA 3DD3A 2C0EA 5EVOA 3TU3B 4IBPA 4N11A 1GSUA 4PNGA 1W4VA 1I9DA 5ECSA 3G9BA 3HXSA 3F6FA 2FCHA 2ON7A 4WF4A 1GNEA 2TRXA 2CVDA 3ZYWA 4HS1A 1K0BA 1EP7A 3FR9A 4HQSA 3CSHA 2KHPA 4E68A 3L9VA 1G0TA 3IK9A 5DCHA 1W89A 2LRTA 1DE2A 3F4TA 1A0FA 4JZQA 2L6DA 4FYBA 2X99A 4I8BA 1TJDA 4X43A 2QA2A 3MNGA 2VCVA 5INYA 1M99A 2GVPA 5HR1A 3W6GA 3APOA 3CMIA 4LL4B 4Q5QA 3WT1A 4GXZA 5IQYA 2L5LA 4E8EA 3PH9A 3IE3A 3W8SA 2DMLA 3M9JA 4H86A 1XW5A 1AC1A 2X8CA 1F9MA 2AAWA 4TOPA 3GIXA 4TXOB 4KCEA 2EC4A 4EUYA 4KW6A 5B6NA 5ENUA 2OE0A 2E2GA 2MMZA 3ZMLA 2F9SA 2LV3A 3IC4A 4V2NA 4MA9A 5CP1A 2P5QA 3UVTA 4POBA 2X8HA 3CWGA 5ECOB 2DBCA 3DWVA 3EE2A 5B6MA 1S3AA 4AKXB 4ZL7A 1MEKA 1X9SB 3I43A 4CDOA 1K0DA 5DAKB 1NM3A 1PMTA 2O5VA 4J2FA 3TCOA 1A2JA 1GSSA 4RI7A 3HVSA 1WWJA 1PL1A 2CQ9A 3TB2A 2B7KA 2YANA 1O85A 3GFKA 4IELA 5J47A 1RK4A 4BVXA 2R4VA 2X8GA 2BMXA 4XS4A 2GS3A 3QOUA 2YV7A 1WIKA 2F8AA 4K8MA 5HR3A 3ZFLA 1HNCA 1SL1B 4X4JA 3NIVA 1XWGA 1XIYA 3F8UA 5D8IA 4BVXB 1EOHA 1H4OA 2K8SA 3IK7A 3M3MA 1F37A 1PX7A 1XPVA 2KLXA 1XVQA 1A2MA 4K0GA 4DSSA 3EMPA 5E4WA 2J23A 1GH2A 5HFGA 4OD7A 2EFDA 1K3YA 4HQZA 3KIJA 1DSBA 5IMFA 4ZB9A 2CX3A 3M0FA 1TU7A 3QMXA 4EE0A 5J5NA 5IMZA 3ZL5A 3FYGA 1Z9HA 4DEJA 5G1KA 2VUPA 1GSFA 4NWYA 3Q6OA 4FH8A 1BX9A 1J9BA 4HOJA 2DJ1A 1FB0A 2GSQA 5D9WA 4AGSA 4OMVA 2XBIA 4ZBAA 1YF1A 4W66A 4AKGA 2PVOC 1SJZA 3TOTA 2R37A 4TW5A 2C8UA 3GKXA 4AJ7A 2OJLA 2O7KA 2GSRA 3PPUA 4G9HA 4MH3A 2AV4A 2H1AA 1ZOFA 2D2ZA 4PXOA 2C1YA 3TKSA 3IC8A 4NMUA 4ZL9A 4IVFA 1R26A 2HT9A 2AHEA 3HD5A 3P7XA 5IO0A 1GLPA 1YF0A 3TJGA 2DJ0A 1QMVA 6GSTA 3VI7A 3RPNA 1PGTA 1IYHA 5AIVA 3VI5A 1CQHA 5JWRB 2GQMA 2I9HA 3HZ4A 2WFCA 5KOWA 4BL7A 3FEUA 4ECJA 2RIIA 1V2AA 3AY8A 2VD1A 2QGVA 5A4WA 3IPZA 2HE3A 1ERUA 3VLNA 1XWAA 4MF5A 2QC7A 4IGJA 4BL7B 3UEMA 4OO4A 3ZIVA 3RBTA 3FZ5A 1F6MC 5IMAA 1AXDA 3TKQA 1SL2B 4G0KA 5DALB 2X4AA 2FD3A 2HNLA 1XOBA 3KZQA 4I2TA 3C71A 4YQUA 4FYCA 2PMTA 1TP9A 3P90A 2PU9C 4AI6A 4CHSA 4Z2TA 1G6WA 4KA0A 4EIQA 2QKEA 2V1MA 4EKZA 1YKCA 3D4MA 2C0FA 5ABRA 4ULXA 4HZ2A 1EP8A 2NDOA 4EL1A 1BJXA 5F06A 2H75A 1XOAA 2DIZA 1T1VA 4V2MA 1EZKA 1RW1A 2GZYA 1FO5A 2A2RA 4EF0A 2VLUA 3TRXA 2VL9A 3E0UA 3GTUA 2MZCA 4OWYA 4POKA 3ZVJD 1Z5YE 3I69A 1EV9A 5H5QA 2FLSA 3RPPA 4HJMA 7GSSA 3M1GA 1O81A 1M0UA 4TR1A 4HZ4A 3I6AA 2H0HA 4KF9A 2DLXA 1V57A 3A5WA 5ECKB 2I3YA 1GWCA 4EO3A 4KB3A 1NHYA 4BVYA 1ON4A 3MAKA 4HEA2 13GSA 2K6VA 3DXBA 2JADA 1S3DA 3EYTA 5J40A 3IAS2 1THOA 2OBKA 4CW9A 2VKZG 4TR1B 3GX8A 4ML6A 5G1LA 4IJIA 5ECPB 2V41A 1TK8B 3GN3A 2OACA 4GLTA 1X9WB 4ZB6A 2CT6A 3QFBC 3HKRA 3HHVA 4IP6A 2HRNA 4G2EA 2GSSA 2H30A 3M8NA 1GLQA 1TXUA 2EFHA 3L78A 2C0GA 2LNTA 3GSSA 5D73A 4YAPA 1T7PB 3H4KA 1M7TA 4ZB8A 1EV4A 1VGLA 2CAQA 1Y1UA 4POLA 1GTIA 3FRCA 1X5DA 1E6BA 2VM2A 2LRNA 1SJ6A 2K18A 3I9V2 3KGKA 1XVWA 5F0GA 5A4UA 2LS5A 5F8BA 3GV1A 2CAIA 3MYDA 1OVNA 1DBYA 3UMAA 3UVHA 1H75A 2B5XA 2HRKB 1OC8A 2XC2A 2H74A 3LJRA 1ILOA 3L0HA 4IQ1A 3LW9A 4PX1A 5FWGA 1LBKA 4WF5A 2R6KA 1DUGA 2VCXA 4MABA 5CRGA 1JZDA 10GSA 4YQMA 1EEJA 1X0RA 1V98A 4WKWA 2AB6A 4K7OA 2C0DA 3LFLA 4IP1A 17GSA 2MBTA 1TXXA 2A2SA 1U3IA 1RQMA 3D22A 4PQIA 3FY7A 3CSJA 2DMMA 1SVLA 4G01A 1EGRA 1A2LA 2C3TA 3UIWA 4I6XA 1URMA 1X9MB 1K3OA 3C1SA 3HCZA 5GAPD 5DBQA 3RDWA 3ERWA 2CZ3A 4KAEA 2IMEA 5J9BA 3CBUA 1VF4A 1OAZA 4KDXA 5J9CA 2RUFA 5GAND 5DJMA 2IFQB 2DIYA 2FWHA 2PVQA 2ALBA 1SK1A 1QUWA 1FHEA 2L6CA 2LTKA 1UA5A 2BTOT 4WR4A 3TKSC 5G5FA 1FVKA 5G5EA 1Z7PA 3KCMA 1B8XA 2EIRA 2AJQB 2YOIA 3ME8A 2XPEA 4ACSA 4MCUA 3TUEA 3MIXA 2CVBA 1B4PA 4GSTA 5CREA 2GT5A 20GSA 4TXOA 4TRXA 2GSTA 3C7MA 2VO4A 1MDKA 4ML1A 2FUG2 3CTFA 3GH9A 2HYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCI A;  4LA1 A;  4NV5 A;  1GUK A;  3WYW A;  2VL2 A;  4GRF A;  1B9X C;  2L57 A;  4GTU A;  4G0L A;  1FOV A;  5F05 A;  4F0B A;  1XBS A;  3LEF A;  4GSS A;  5AGY A;  5DAK A;  1OC9 B;  1TDI A;  1O8W A;  3HA9 A;  3GUS A;  1M2B A;  4QQ7 A;  5DDL A;  1R5P A;  3A2V A;  3WGD A;  2ZCT A;  3WGE A;  2DJK A;  2OE1 A;  1J0F A;  5G31 A;  2AYT A;  2H19 A;  3Q18 A;  2Z9S A;  2B1L A;  4TR4 A;  4AF2 A;  3CYN A;  1AW9 A;  1FVJ A;  2TRC P;  3EC3 A;  2AUV A;  3BCK A;  3IRA A;  5C00 A;  5KN1 A;  5F07 A;  1F3B A;  2I4A A;  3DRN A;  3LXZ A;  3C73 A;  3UAP A;  3A3T A;  3E3E A;  2VM1 A;  4ECB A;  1PQN A;  2H0G A;  3KH9 A;  1PSQ A;  1U6T A;  4MPF A;  4KH7 A;  3GRX A;  1A24 A;  4MZB A;  1OC3 A;  4TR0 A;  1FAA A;  1THX A;  3IAM 2;  2H1D A;  2GLR A;  3UBL A;  1MDJ A;  3U6V A;  4MZC A;  4TKY A;  2XBQ A;  2LQQ A;  1O7U A;  4KSM A;  5LCZ A;  3NZN A;  5JCG A;  3LYK A;  4RQR A;  3PR8 A;  3VFI A;  1XXU A;  3QFA C;  4FYU A;  4K7I A;  19GS A;  3GNJ A;  4QL9 A;  4G0I A;  2M72 A;  2H6X A;  2H0I A;  4BWQ A;  4YAV A;  2DSA A;  2WGR A;  5IMV A;  4KSO A;  4V1A p;  1X5C A;  1ST9 A;  3F63 A;  1GSE A;  2HSN B;  5BMU A;  2P31 A;  4ZBB A;  4ECC A;  3EU3 A;  3QAV A;  3TJK A;  1GP1 A;  2PPT A;  1TI3 A;  3FHK A;  1JLV A;  4O32 A;  4FQU A;  5ECL B;  1KBN A;  1VF2 A;  2FA4 A;  1TTZ A;  3TOU A;  2YWN A;  5J41 A;  2JAC A;  2HSY A;  1Q4J A;  3C1R A;  3FR6 A;  1SL0 B;  2GT6 A;  5GST A;  1ML6 A;  2H76 A;  3KMN A;  1EGO A;  4TR3 A;  4K0N A;  4HDE A;  3GYK A;  1HD2 A;  3UBK A;  3SWL A;  2LST A;  4Z7X A;  1PKW A;  2JSZ A;  4JBB A;  1ACV A;  18GS A;  5ELG A;  3LYP A;  3CSI A;  4JU5 A;  3VPT A;  3KP9 A;  1TRU A;  1G6Y A;  5B7C A;  3F3R A;  1R5A A;  2YP6 A;  2ES7 A;  6GSU A;  5IPH A;  4WET A;  1ABA A;  2C3N A;  1MD3 A;  3J7Y k;  3VPQ A;  4PTS A;  4I97 A;  3KEB A;  3EU4 A;  5D9T A;  5KN3 A;  1AQV A;  4PQH A;  3EIN A;  1GUM A;  1YY7 A;  2NTO A;  4TN8 A;  5CRD A;  3TRQ A;  4GSN A;  4KUN A;  2GGT A;  1GSY A;  2JZT A;  3LG6 A;  2YJ7 A;  3BD2 A;  5C04 A;  1M9B A;  5ECR B;  2O8V B;  2C3Q A;  1VRS D;  2CVK A;  5ECM B;  3D5J A;  1USB A;  5LD0 A;  5KN0 A;  5DAL A;  3M9K A;  2HSH A;  4NXI A;  4OCF A;  4MF7 A;  1LU4 A;  1M2D A;  2KP2 A;  3RAZ A;  2OAD A;  1ERW A;  2TIR A;  4JE1 A;  5AIX A;  4LL1 B;  5IM9 A;  1K0A A;  4YQV A;  1SKR B;  2GQK A;  4L5L A;  4ECI A;  3GL3 A;  2H1B A;  3ISO A;  1KTE A;  1SYR A;  3QAW A;  2LEG A;  3GKN A;  2NPB A;  4MH2 A;  1SYX A;  3CRU A;  1F3A A;  3KD0 A;  1PA3 A;  3HDC A;  2VCW A;  4EDY A;  2YCD A;  2HZE B;  4E8H A;  1AUC A;  3DIE A;  2HRF A;  2MYG A;  2N5B A;  1HNA A;  2JL4 A;  3N9J A;  1TI1 A;  3FZ4 A;  4I5Q A;  1GTB A;  2CX4 A;  2OA7 A;  2R2J A;  3DGQ A;  4NHW A;  1BAY A;  3HVX A;  2JU5 A;  3IBH A;  4G10 A;  3W8J A;  2I1U A;  2UZ8 A;  3HJP A;  4BA7 A;  1KNG A;  2LQO A;  3IR4 A;  3LGC A;  3IDV A;  3CRT A;  5CRW A;  5G2Z A;  4L5O A;  1SJI A;  1WE0 A;  4AJ8 A;  5HFI A;  4WXT A;  3APQ A;  3P2A A;  4PNF A;  11GS A;  3GHA A;  1B9Y C;  1TRS A;  1T4Y A;  2F8F A;  2VD0 A;  4GWR A;  1Z6N A;  1XCC A;  1YKA A;  3R3E A;  1MTC A;  2CA8 A;  3FK8 A;  2VL2 C;  2YN1 A;  2HSM A;  2IJY A;  2GTU A;  2H1G A;  2HQT A;  4PQ1 A;  1BED A;  1G7E A;  3P8W A;  2E2M A;  4TVE A;  2KP1 A;  4JED A;  2V2G A;  2FY6 A;  1QK8 A;  4OFT A;  1A8L A;  3BBY A;  4MP4 A;  4OFN A;  3F4R A;  3D6I A;  3VWX A;  2MMN A;  3ERF A;  3MSZ A;  3QCP A;  8GSS A;  5J4U A;  5KEJ A;  2HSM B;  2H6Y A;  5B8B A;  2B6M A;  2N5A A;  3PGT A;  4L0U A;  3HY2 A;  1CQG A;  2JZR A;  3RHB A;  2IWT A;  4XTS A;  4WBJ A;  2H66 A;  16GS A;  2X64 A;  2C80 A;  4KDU A;  3TGZ A;  2IIY A;  4FO5 A;  1VF1 A;  1ZMA A;  2HRK A;  3ZMK A;  2PER A;  2WRT A;  4Q5N A;  4RQX A;  2NVL A;  5CNW A;  4L8E A;  2H71 A;  2O87 A;  2H72 A;  3LSZ A;  1QFN A;  5ELA A;  4EVM A;  2RUE A;  3ZRE A;  4LMW A;  2H8L A;  2B5Y A;  1JHB A;  4IS0 A;  3HVV A;  4D73 A;  5ECQ B;  3E9J B;  1QQ2 A;  5GZZ B;  1K0N A;  2DC5 A;  3ZTL A;  2GZZ A;  3TJF A;  1ERV A;  4PUF C;  1Z3E A;  1M2A A;  1NSW A;  2VLT A;  1TRV A;  2XHF A;  2GZP A;  5D93 A;  4D73 B;  5DCG A;  2VCQ A;  1GTU A;  3EWL A;  4BPY A;  1TK5 B;  4IKH A;  1SU9 A;  3NOF A;  5ID2 B;  1WMJ A;  3GST A;  5J3R A;  1WPI A;  5KN2 A;  1XWC A;  3U5R E;  6GSV A;  1WJK A;  4LMV A;  2YWO A;  2MBS A;  2K8V A;  3Q19 A;  5COH A;  1PL2 A;  3JCM L;  2LNS A;  3HZ8 A;  1A23 A;  4PGT A;  2IFQ A;  2P0G A;  4KDY A;  3VWW A;  1TOF A;  2K9F A;  4K9Z A;  3QDN A;  4OCE A;  3L9S A;  3MWH A;  3WGX A;  3O6T A;  2MMA A;  5B8A A;  4NHZ A;  2ON5 A;  1U3A A;  4WR5 A;  2R5G A;  3QR6 A;  5CAX A;  3BJ5 A;  1AQW A;  3KTL A;  4V1A g;  1YDK A;  3TRP A;  2B3S A;  2M80 A;  3LWA A;  2EIQ A;  1GRX A;  3DEX A;  3DVX A;  4NPB A;  2PWJ A;  5FT3 A;  5IIZ A;  3DML A;  3ZFB A;  1FG4 A;  4MLY A;  1LJR A;  5AIS A;  5HQP A;  4NV2 A;  1N2A A;  4OFM A;  1YJ6 A;  4N0Z A;  1GSD A;  4HU7 A;  1N8J A;  5AN1 A;  5IPG A;  4X0X A;  6GSS A;  2IMI A;  1A8Y A;  1T8E B;  5CYY A;  5D9X A;  1KEB A;  2YV9 A;  5ECN B;  2VOC A;  1U88 A;  3LQ7 A;  4DVC A;  3F9U A;  2V6K A;  2VCT A;  4N30 A;  3FR3 A;  1WP0 A;  4MJB A;  3EMX A;  1OC9 A;  3GKM A;  1BG5 A;  1T3B A;  3IA1 A;  4G19 A;  4MJE A;  4POM A;  4O92 A;  3BOA A;  2E7P A;  3KTB A;  3KM6 A;  3RHC A;  4GCI A;  1K0M A;  3H1N A;  4ZL8 A;  2WJU A;  2HFD A;  2YNX A;  4K2D A;  5D9V A;  6GSW A;  4XCS A;  2CV4 A;  1EWX A;  3KH7 A;  2L4Q A;  4EXJ A;  4IW9 A;  4KND A;  1FB6 A;  5EPF A;  1GL8 A;  1TK0 B;  2FWE A;  4F82 A;  4K6X A;  1OKD A;  4ZIL A;  3IHQ A;  2ZUP A;  3UJ1 A;  1A0R P;  1S3C A;  1ZZY A;  4IN0 A;  2OE3 A;  3HJM A;  3G7Y A;  3GL5 A;  2H6Z A;  1B4Q A;  3UAR A;  4WEY A;  2B7J A;  5CRH A;  4ID0 A;  1TU8 A;  2IMF A;  1YQ1 A;  2RLI A;  3TJJ A;  1SKS B;  3QAG A;  2FWF A;  2B5E A;  3ZRD A;  3O3T A;  2F3M A;  2A4V A;  3TKR A;  1T00 A;  5G30 A;  2I81 A;  4YH2 A;  1MD4 A;  4P3Y B;  2N5F A;  4JR4 A;  2V6O A;  4GF0 A;  2H70 A;  2PUK C;  4USS A;  3C8E A;  5JCW A;  4KGI A;  2B1K A;  2GQL A;  4XRD A;  3ZZX A;  5DVB A;  4F0C A;  2IMD A;  3IOS A;  4RUV A;  3US3 A;  3HYP A;  1AQX A;  4AJ6 A;  4MMM A;  2P5R A;  1GSQ A;  3FW2 A;  4XS4 B;  4XS6 A;  3EUR A;  3PIN A;  3ED3 A;  3KP8 A;  3L4N A;  4XHM A;  4PUR A;  2IPA A;  1OE8 A;  1EEM A;  2YJH A;  1OE7 A;  2JZS A;  4EDZ A;  1Q98 A;  3TKS E;  4MJA A;  1E2Y A;  5DQY A;  3UOM A;  1R4W A;  3A2W A;  22GS A;  2G2Q A;  1GNW A;  3UL3 A;  3TDG A;  3FZ9 A;  2M46 A;  2MMO A;  4MPG A;  3GA4 A;  4DSS B;  3H79 A;  2O85 A;  1OYJ A;  3ZIT A;  1C72 A;  2KUC A;  3QD9 A;  2JSY A;  1SKW B;  2YZH A;  1I5G A;  4I2U A;  4PUA A;  1O8X A;  4LLR A;  5L71 A;  4XIH A;  5IOW A;  2XPD A;  3VWV A;  14GS A;  1DE1 A;  2HLS A;  3CXG A;  3D0Z A;  3GUR A;  2YPM A;  2REM A;  2WZ9 A;  4TXV A;  3F4S A;  2YZU A;  4J57 E;  5IMD A;  1ZL9 A;  1Y25 A;  2O89 A;  4F2I A;  2ZNM A;  1NW2 A;  4QL7 A;  2FWG A;  1SEN A;  3VWU A;  1V9W A;  2DJ2 A;  4BWS A;  5LNK e;  1YEX A;  3H8Q A;  5JWO B;  5GSS A;  1MDI A;  3O76 A;  4Q5F A;  2YWI A;  1SD9 A;  1ZGN A;  3EVI A;  4EC0 A;  1JLW A;  4K7N A;  2WUL A;  2EIO A;  1UC7 A;  1PX6 A;  1JZO A;  4J56 E;  1GUL A;  4FIW A;  4WBR D;  3TJB A;  2HI7 A;  3ZVJ A;  1TW9 A;  2YWM A;  1NHO A;  6GSX A;  2HZE A;  2NBS A;  1IYI A;  2WS2 A;  1WOU A;  2WB9 A;  1SD8 A;  1EOG A;  5IO2 A;  2QSI A;  2LUS A;  4HUA A;  4KE3 A;  4MDC A;  3A2X A;  2VL3 A;  4F9Z A;  1VF3 A;  1PN9 A;  1YEP A;  2FHE A;  1OKT A;  1J08 A;  2OBI A;  4N10 A;  2FGX A;  1HQO A;  1XWK A;  1G7O A;  4NAX A;  3CTG A;  2WDU A;  1JFU A;  2DJ3 A;  5A4V A;  2VAF A;  3FKF A;  1HYU A;  2HRA A;  1TKD B;  4ZXG A;  4IJ3 A;  4XRA A;  2DJJ A;  1AAZ A;  3VK9 A;  1K0C A;  3HJO A;  4ZIJ A;  2IMK A;  5IOX A;  5DJL A;  2C4J A;  1V58 A;  2RM6 A;  1PKZ A;  1XW6 A;  2L4C A;  1GUH A;  3DKS A;  3OR5 A;  4DSR A;  4KCA A;  1JZR A;  1U87 A;  4HJ2 A;  4XS1 A;  3F0I A;  4L0W A;  4GQF A;  1TRW A;  2LJA A;  2VIM A;  3D21 A;  1M9A A;  1HNB A;  3ERG A;  1F2E A;  3MDK A;  1YZX A;  3G7J A;  3BCI A;  3Q74 A;  1O6J A;  3G7I A;  3GH6 A;  4GQC A;  2FNO A;  3N5O A;  3KXO A;  5ECH B;  3GTU B;  1BQ7 A;  3SBC A;  1XZO A;  2L59 A;  4ILF A;  2FA8 A;  4MJC A;  4MF6 A;  2H73 A;  1FW1 A;  12GS A;  2LJR A;  2J9H A;  2PBJ A;  2IN3 A;  3L9U A;  3GX0 A;  2CZ2 A;  3DVW A;  1X5E A;  2LJK A;  1O73 A;  4MZW A;  3VUR A;  3J7Y b;  1UVZ A;  4BVY B;  2HZF A;  5ECI B;  3WT2 A;  5DQS A;  2RM5 A;  4JR6 A;  3DYR A;  3V1W A;  4HI7 A;  1AIU A;  2L5O A;  1ERT A;  3ZLP A;  4MK3 A;  3K8N A;  5CO3 A;  5D96 A;  1SK0 A;  1XW9 A;  3IV4 A;  3R2Q A;  4IHU A;  5H5S A;  5H5R A;  4V2L A;  3S9F A;  3H93 A;  3D4T A;  3LXT A;  4HU9 A;  5A5K A;  3IXR A;  1Y6E A;  5EL8 A;  3F6D A;  2IL3 A;  4RI6 A;  1R7H A;  1XFL A;  2PN8 A;  4Q5R A;  3F3Q A;  4IQA A;  5ID2 A;  3WD6 A;  2VLV A;  2LKU A;  3ME7 A;  4KX4 A;  5JCU A;  3KJY A;  2G0F A;  2H01 A;  3GMF A;  4X1U A;  5HR2 A;  1PRX A;  1ZYQ B;  4ZBD A;  1V40 A;  1XWB A;  5HR0 A;  4K1F A;  4OO5 A;  1ZCP A;  3LOR A;  1UN2 A;  4ISD A;  1K3L A;  1QXH A;  1BYE A;  2VCZ A;  9GSS A;  3TKP A;  2BJX A;  4F03 A;  2OKA A;  2F51 A;  1WRY A;  1Z6M A;  1T4Z A;  4N0V A;  1K0O A;  2PGT A;  4O7H A;  5HFK A;  3QPM A;  5FHI A;  4O5R A;  5E59 A;  2HXK A;  1Z7R A;  1B48 A;  3FZA A;  5IMC A;  3ZIJ A;  2E0Q A;  2R3X A;  1GTA A;  1PD2 1;  5JWQ B;  6GSY A;  2LRC A;  1QGV A;  2V32 A;  2GDR A;  2KOK A;  4DSQ A;  3APS A;  3KMO A;  1JZW A;  1SK2 A;  3GKK A;  5EY6 A;  1ZYE A;  4JRR A;  3DD3 A;  2C0E A;  5EVO A;  4IBP A;  4N11 A;  1GSU A;  4PNG A;  1W4V A;  1I9D A;  5ECS A;  3G9B A;  3HXS A;  3F6F A;  2FCH A;  2ON7 A;  4WF4 A;  1GNE A;  2TRX A;  2CVD A;  3ZYW A;  4HS1 A;  1K0B A;  1EP7 A;  3FR9 A;  4HQS A;  3CSH A;  2KHP A;  3L9V A;  1G0T A;  3IK9 A;  5DCH A;  1W89 A;  2LRT A;  1DE2 A;  3F4T A;  1A0F A;  4JZQ A;  2L6D A;  4FYB A;  2X99 A;  4I8B A;  1TJD A;  4X43 A;  3MNG A;  2VCV A;  5INY A;  1M99 A;  2GVP A;  5HR1 A;  3W6G A;  3APO A;  3CMI A;  4LL4 B;  4Q5Q A;  3WT1 A;  4GXZ A;  5IQY A;  2L5L A;  4E8E A;  3PH9 A;  3IE3 A;  3W8S A;  2DML A;  4H86 A;  3M9J A;  1XW5 A;  1AC1 A;  2X8C A;  1F9M A;  2AAW A;  4TOP A;  3GIX A;  4TXO B;  4KCE A;  2EC4 A;  4EUY A;  4KW6 A;  5B6N A;  5ENU A;  2OE0 A;  2E2G A;  2MMZ A;  3ZML A;  2F9S A;  2LV3 A;  3IC4 A;  4V2N A;  4MA9 A;  5CP1 A;  2P5Q A;  3UVT A;  4POB A;  2X8H A;  5ECO B;  2DBC A;  3DWV A;  3EE2 A;  5B6M A;  1S3A A;  4ZL7 A;  1MEK A;  1X9S B;  3I43 A;  4CDO A;  1K0D A;  5DAK B;  1NM3 A;  1PMT A;  4J2F A;  3TCO A;  1A2J A;  1GSS A;  4RI7 A;  3HVS A;  1WWJ A;  1PL1 A;  2CQ9 A;  3TB2 A;  2B7K A;  2YAN A;  1O85 A;  3GFK A;  4IEL A;  1RK4 A;  4BVX A;  2R4V A;  2X8G A;  2BMX A;  4XS4 A;  2GS3 A;  3QOU A;  2YV7 A;  1WIK A;  2F8A A;  4K8M A;  5HR3 A;  3ZFL A;  1HNC A;  1SL1 B;  3NIV A;  1XWG A;  1XIY A;  3F8U A;  5D8I A;  4BVX B;  1EOH A;  1H4O A;  2K8S A;  3IK7 A;  3M3M A;  1F37 A;  1PX7 A;  1XPV A;  2KLX A;  1XVQ A;  1A2M A;  4K0G A;  4DSS A;  3EMP A;  5E4W A;  2J23 A;  1GH2 A;  5HFG A;  4OD7 A;  1K3Y A;  4HQZ A;  3KIJ A;  1DSB A;  5IMF A;  4ZB9 A;  2CX3 A;  3M0F A;  1TU7 A;  3QMX A;  4EE0 A;  5J5N A;  5IMZ A;  3ZL5 A;  3FYG A;  1Z9H A;  4DEJ A;  5G1K A;  2VUP A;  1GSF A;  4NWY A;  3Q6O A;  4FH8 A;  1BX9 A;  1J9B A;  4HOJ A;  2DJ1 A;  1FB0 A;  2GSQ A;  5D9W A;  4AGS A;  4OMV A;  2XBI A;  4ZBA A;  1YF1 A;  2PVO C;  1SJZ A;  3TOT A;  2R37 A;  4TW5 A;  2C8U A;  3GKX A;  4AJ7 A;  2OJL A;  2O7K A;  2GSR A;  3PPU A;  4G9H A;  4MH3 A;  2AV4 A;  2H1A A;  1ZOF A;  2D2Z A;  4PXO A;  2C1Y A;  3TKS A;  3IC8 A;  4NMU A;  4ZL9 A;  4IVF A;  1R26 A;  2HT9 A;  2AHE A;  3HD5 A;  3P7X A;  5IO0 A;  1GLP A;  1YF0 A;  3TJG A;  2DJ0 A;  1QMV A;  6GST A;  3VI7 A;  3RPN A;  1PGT A;  1IYH A;  5AIV A;  3VI5 A;  1CQH A;  5JWR B;  2GQM A;  2I9H A;  3HZ4 A;  2WFC A;  4BL7 A;  3FEU A;  4ECJ A;  2RII A;  1V2A A;  3AY8 A;  2VD1 A;  2QGV A;  5A4W A;  3IPZ A;  2HE3 A;  1ERU A;  3VLN A;  1XWA A;  4MF5 A;  2QC7 A;  4IGJ A;  4BL7 B;  3UEM A;  4OO4 A;  3ZIV A;  3RBT A;  3FZ5 A;  1F6M C;  5IMA A;  1AXD A;  3TKQ A;  1SL2 B;  4G0K A;  5DAL B;  2FD3 A;  2HNL A;  1XOB A;  3KZQ A;  4I2T A;  3C71 A;  4YQU A;  4FYC A;  2PMT A;  1TP9 A;  3P90 A;  2PU9 C;  4CHS A;  1G6W A;  4KA0 A;  2QKE A;  2V1M A;  4EKZ A;  1YKC A;  3D4M A;  2C0F A;  5ABR A;  4ULX A;  4HZ2 A;  1EP8 A;  2NDO A;  4EL1 A;  1BJX A;  5F06 A;  2H75 A;  1XOA A;  2DIZ A;  1T1V A;  4V2M A;  1EZK A;  1RW1 A;  2GZY A;  1FO5 A;  2A2R A;  4EF0 A;  2VLU A;  3TRX A;  2VL9 A;  3E0U A;  3GTU A;  2MZC A;  4OWY A;  4POK A;  3ZVJ D;  1Z5Y E;  3I69 A;  1EV9 A;  5H5Q A;  2FLS A;  3RPP A;  4HJM A;  7GSS A;  3M1G A;  1O81 A;  1M0U A;  4TR1 A;  4HZ4 A;  3I6A A;  2H0H A;  4KF9 A;  2DLX A;  1V57 A;  3A5W A;  5ECK B;  2I3Y A;  1GWC A;  4EO3 A;  4KB3 A;  1NHY A;  4BVY A;  1ON4 A;  3MAK A;  4HEA 2;  13GS A;  2K6V A;  3DXB A;  2JAD A;  1S3D A;  3EYT A;  3IAS 2;  1THO A;  2OBK A;  4CW9 A;  4TR1 B;  3GX8 A;  4ML6 A;  5G1L A;  4IJI A;  5ECP B;  2V41 A;  1TK8 B;  3GN3 A;  2OAC A;  4GLT A;  1X9W B;  4ZB6 A;  2CT6 A;  3QFB C;  3HKR A;  3HHV A;  4IP6 A;  2HRN A;  4G2E A;  2GSS A;  2H30 A;  3M8N A;  1GLQ A;  3L78 A;  2C0G A;  2LNT A;  3GSS A;  5D73 A;  4YAP A;  1T7P B;  3H4K A;  1M7T A;  4ZB8 A;  1EV4 A;  1VGL A;  2CAQ A;  4POL A;  1GTI A;  3FRC A;  1X5D A;  1E6B A;  2VM2 A;  2LRN A;  1SJ6 A;  2K18 A;  3I9V 2;  3KGK A;  1XVW A;  5F0G A;  5A4U A;  2LS5 A;  5F8B A;  3GV1 A;  2CAI A;  1OVN A;  1DBY A;  3UMA A;  3UVH A;  1H75 A;  2B5X A;  2HRK B;  1OC8 A;  2XC2 A;  2H74 A;  3LJR A;  1ILO A;  3L0H A;  4IQ1 A;  4PX1 A;  5FWG A;  1LBK A;  4WF5 A;  2R6K A;  1DUG A;  2VCX A;  4MAB A;  5CRG A;  1JZD A;  10GS A;  4YQM A;  1EEJ A;  1X0R A;  1V98 A;  4WKW A;  2AB6 A;  4K7O A;  2C0D A;  3LFL A;  4IP1 A;  17GS A;  2MBT A;  1TXX A;  2A2S A;  1U3I A;  1RQM A;  3D22 A;  4PQI A;  3FY7 A;  3CSJ A;  2DMM A;  1EGR A;  1A2L A;  2C3T A;  3UIW A;  4I6X A;  1URM A;  1X9M B;  1K3O A;  3C1S A;  3HCZ A;  5GAP D;  5DBQ A;  3RDW A;  3ERW A;  2CZ3 A;  4KAE A;  2IME A;  5J9B A;  3CBU A;  1VF4 A;  1OAZ A;  4KDX A;  5J9C A;  2RUF A;  5GAN D;  5DJM A;  2IFQ B;  2DIY A;  2FWH A;  2PVQ A;  2ALB A;  1SK1 A;  1QUW A;  1FHE A;  2L6C A;  2LTK A;  1UA5 A;  2BTO T;  4WR4 A;  3TKS C;  5G5F A;  1FVK A;  5G5E A;  1Z7P A;  3KCM A;  1B8X A;  2EIR A;  2AJQ B;  2YOI A;  3ME8 A;  2XPE A;  4ACS A;  4MCU A;  3TUE A;  2CVB A;  1B4P A;  4GST A;  5CRE A;  2GT5 A;  20GS A;  4TXO A;  4TRX A;  2GST A;  3C7M A;  2VO4 A;  1MDK A;  4ML1 A;  2FUG 2;  3CTF A;  3GH9 A;  2HYX A; 
#chains in the Genus database with same CATH topology
 2WCI A;  4LA1 A;  4NV5 A;  1GUK A;  3WYW A;  2VL2 A;  4GRF A;  1B9X C;  2L57 A;  4GTU A;  4G0L A;  1FOV A;  5F05 A;  4F0B A;  1XBS A;  3LEF A;  4GSS A;  5AGY A;  5DAK A;  1OC9 B;  1TDI A;  1O8W A;  3HA9 A;  3GUS A;  1M2B A;  4QQ7 A;  5DDL A;  1R5P A;  3A2V A;  3WGD A;  2ZCT A;  3WGE A;  2DJK A;  2OE1 A;  1J0F A;  5G31 A;  2AYT A;  2H19 A;  3Q18 A;  2Z9S A;  2B1L A;  4TR4 A;  4AF2 A;  3CYN A;  1AW9 A;  1FVJ A;  2TRC P;  3EC3 A;  2AUV A;  3BCK A;  3IRA A;  5C00 A;  5KN1 A;  5F07 A;  1F3B A;  2I4A A;  3DRN A;  3LXZ A;  3C73 A;  3UAP A;  5BRT A;  3A3T A;  3E3E A;  2VM1 A;  4ECB A;  1PQN A;  1ZYN A;  5J4Y A;  2H0G A;  3KH9 A;  1PSQ A;  1U6T A;  4MPF A;  4KH7 A;  3GRX A;  1A24 A;  4MZB A;  1OC3 A;  4TR0 A;  1FAA A;  1THX A;  2WVZ A;  3IAM 2;  2WW0 A;  2GLR A;  2H1D A;  3UBL A;  1MDJ A;  3U6V A;  4MZC A;  1YEW C;  4TKY A;  2XBQ A;  2LQQ A;  1O7U A;  4KSM A;  5LCZ A;  3NZN A;  5JCG A;  3LYK A;  4RQR A;  3PR8 A;  2O3E A;  3VFI A;  1XXU A;  3QFA C;  4FYU A;  4K7I A;  2HSN A;  19GS A;  3GNJ A;  4YKG A;  4QL9 A;  4G0I A;  2M72 A;  2H6X A;  2H0I A;  4BWQ A;  4YAV A;  2DSA A;  2WGR A;  4MNN A;  1BF5 A;  2DKH A;  5A5H B;  5IMV A;  3CQF A;  4KSO A;  4V1A p;  1X5C A;  1ST9 A;  3F63 A;  1GSE A;  2HSN B;  5BMU A;  2P31 A;  4ZBB A;  4ECC A;  3EU3 A;  3QAV A;  3TJK A;  1GP1 A;  2PPT A;  1TI3 A;  3FMW A;  3FHK A;  1JLV A;  4O32 A;  4FQU A;  5ECL B;  1KBN A;  1VF2 A;  2FA4 A;  1TTZ A;  5A1N A;  3TOU A;  2YWN A;  3RGB C;  5J41 A;  2JAC A;  2HSY A;  1Q4J A;  5BMU B;  3C1R A;  4ICY A;  3FR6 A;  3IHG A;  1SL0 B;  2GT6 A;  5GST A;  1ML6 A;  1YVL A;  2H76 A;  3KMN A;  1EGO A;  4TR3 A;  4K0N A;  4HDE A;  3GYK A;  1HD2 A;  3UBK A;  3SWL A;  2LST A;  4Z7X A;  1PKW A;  2JSZ A;  4JBB A;  5A1N B;  1ACV A;  18GS A;  5ELG A;  3LYP A;  3CSI A;  4JU5 A;  3VPT A;  3KP9 A;  1TRU A;  1G6Y A;  5B7C A;  3F3R A;  1R5A A;  2YP6 A;  2ES7 A;  6GSU A;  5IPH A;  4WET A;  3EPT A;  1ABA A;  2C3N A;  1MD3 A;  3J7Y k;  3VPQ A;  4PTS A;  4I97 A;  3KEB A;  3EU4 A;  5D9T A;  5KN3 A;  1AQV A;  4PQH A;  3EIN A;  1GUM A;  4K5R A;  1YY7 A;  2NTO A;  4TN8 A;  5CRD A;  3TRQ A;  4GSN A;  4KUN A;  2GGT A;  1GSY A;  2JZT A;  3LG6 A;  2YJ7 A;  3BD2 A;  5C04 A;  1M9B A;  5ECR B;  2O8V B;  2C3Q A;  1M3I A;  1VRS D;  2CVK A;  5ECM B;  3D5J A;  1USB A;  5LD0 A;  5KN0 A;  5DAL A;  3M9K A;  2HSH A;  4NXI A;  4OCF A;  4MF7 A;  1LU4 A;  1M2D A;  2KP2 A;  3RAZ A;  2OAD A;  1ERW A;  2TIR A;  4JE1 A;  4O5U A;  5AIX A;  4LL1 B;  5IM9 A;  1K0A A;  4YQV A;  1SKR B;  2GQK A;  4L5L A;  4ECI A;  3GL3 A;  2H1B A;  3ISO A;  1KTE A;  1SYR A;  3QAW A;  2LEG A;  3GKN A;  2NPB A;  4MH2 A;  5A34 B;  1SYX A;  3CRU A;  1F3A A;  3KD0 A;  1PA3 A;  3HDC A;  2VCW A;  4EDY A;  2YCD A;  2HZE B;  2QA1 A;  4E8H A;  1AUC A;  3DIE A;  2HRF A;  2MYG A;  2N5B A;  1HNA A;  2JL4 A;  3N9J A;  1TI1 A;  3FZ4 A;  4I5Q A;  1GTB A;  2CX4 A;  4PI2 C;  2OA7 A;  2R2J A;  3DGQ A;  4NHW A;  1BAY A;  3HVX A;  2JU5 A;  3IBH A;  4G10 A;  3W8J A;  2I1U A;  2UZ8 A;  4CY6 A;  3HJP A;  4BA7 A;  1KNG A;  2LQO A;  3IR4 A;  3LGC A;  4AKI A;  3IDV A;  3CRT A;  5CRW A;  5G2Z A;  4L5O A;  1SJI A;  1WE0 A;  4ZB7 A;  4AJ8 A;  5HFI A;  4WXT A;  4AKH A;  3APQ A;  3P2A A;  4PNF A;  11GS A;  3GHA A;  1B9Y C;  1TRS A;  1T4Y A;  2F8F A;  2VD0 A;  4GWR A;  1Z6N A;  1XCC A;  1YKA A;  3R3E A;  4K2X A;  1MTC A;  2CA8 A;  3FK8 A;  2VL2 C;  2YN1 A;  2HSM A;  2IJY A;  2GTU A;  2H1G A;  2HQT A;  4PQ1 A;  1BED A;  1G7E A;  3P8W A;  2E2M A;  4TVE A;  2KP1 A;  1FOH A;  4JED A;  2V2G A;  2FY6 A;  1QK8 A;  4OFT A;  1A8L A;  3BBY A;  4MP4 A;  4OFN A;  3F4R A;  3D6I A;  3VWX A;  2MMN A;  3ERF A;  3MSZ A;  3QCP A;  8GSS A;  5J4U A;  5KEJ A;  2HSM B;  2H6Y A;  5B8B A;  2B6M A;  2N5A A;  3PGT A;  4L0U A;  3HY2 A;  1CQG A;  2JZR A;  3RHB A;  2IWT A;  4XTS A;  4WBJ A;  4EIP A;  2H66 A;  16GS A;  2X64 A;  2C80 A;  4KDU A;  3TGZ A;  2IIY A;  4FO5 A;  1VF1 A;  1ZMA A;  2HRK A;  3ZMK A;  2PER A;  2WRT A;  4Q5N A;  4RQX A;  2NVL A;  5CNW A;  4L8E A;  2H71 A;  2O87 A;  2H72 A;  3LSZ A;  1M3J A;  1QFN A;  5ELA A;  4N3Z A;  4EVM A;  2RUE A;  3ZRE A;  4LMW A;  2H8L A;  2B5Y A;  1JHB A;  4IS0 A;  3HVV A;  4D73 A;  5ECQ B;  3E9J B;  1QQ2 A;  2O36 A;  5GZZ B;  1K0N A;  2DC5 A;  3ZTL A;  2GZZ A;  3TJF A;  1ERV A;  4PUF C;  1Z3E A;  1M2A A;  1NSW A;  2VLT A;  1TRV A;  2XHF A;  2GZP A;  5D93 A;  4D73 B;  5DCG A;  2VCQ A;  1GTU A;  3EWL A;  4BPY A;  1TK5 B;  4IKH A;  1SU9 A;  3NOF A;  5ID2 B;  1WMJ A;  3GST A;  5J3R A;  1WPI A;  5KN2 A;  1XWC A;  3U5R E;  2WW2 A;  6GSV A;  1WJK A;  4LMV A;  2YWO A;  2MBS A;  2K8V A;  2WZS A;  3Q19 A;  5COH A;  1PL2 A;  3JCM L;  2LNS A;  3HZ8 A;  1A23 A;  4HSC X;  4PGT A;  2IFQ A;  2P0G A;  1XG8 A;  4KDY A;  3VWW A;  1TOF A;  2K9F A;  4K9Z A;  3QDN A;  4OCE A;  3L9S A;  3MWH A;  3WGX A;  3O6T A;  2A2P A;  2MMA A;  5B8A A;  4NHZ A;  2ON5 A;  1U3A A;  4WR5 A;  2R5G A;  3QR6 A;  5CAX A;  3BJ5 A;  1AQW A;  3KTL A;  4V1A g;  1YDK A;  3TRP A;  2B3S A;  2M80 A;  3LWA A;  2EIQ A;  1GRX A;  3DEX A;  3DVX A;  4NPB A;  2PWJ A;  5FT3 A;  5IIZ A;  3DML A;  3ZFB A;  1FG4 A;  4MLY A;  1LJR A;  5AIS A;  5HQP A;  4NV2 A;  1N2A A;  4OFM A;  1YJ6 A;  3CHX C;  4N0Z A;  1GSD A;  4HU7 A;  1N8J A;  5AN1 A;  5IPG A;  4X0X A;  6GSS A;  2IMI A;  1A8Y A;  1T8E B;  5CYY A;  5D9X A;  1KEB A;  2YV9 A;  5ECN B;  2VOC A;  1U88 A;  3LQ7 A;  4DVC A;  3F9U A;  4O5Q A;  2V6K A;  2VCT A;  4N30 A;  3FR3 A;  1WP0 A;  4MJB A;  3EMX A;  1OC9 A;  3GKM A;  1BG5 A;  1T3B A;  4CY8 A;  3IA1 A;  4G19 A;  4MJE A;  4POM A;  4O92 A;  3BOA A;  2E7P A;  2EFC A;  3KTB A;  3KM6 A;  3RHC A;  4GCI A;  1K0M A;  3H1N A;  4ZL8 A;  2WJU A;  2HFD A;  2YNX A;  4K2D A;  5D9V A;  6GSW A;  4XCS A;  2CV4 A;  1EWX A;  3KH7 A;  1BG1 A;  2L4Q A;  4EXJ A;  4IW9 A;  4A5P A;  4KND A;  1FB6 A;  5EPF A;  1GL8 A;  1TK0 B;  2FWE A;  4F82 A;  4K6X A;  1OKD A;  4ZIL A;  3IHQ A;  2ZUP A;  3UJ1 A;  1A0R P;  1S3C A;  1ZZY A;  4IN0 A;  2OE3 A;  3HJM A;  3G7Y A;  3GL5 A;  2H6Z A;  1B4Q A;  1ZYP A;  3UAR A;  4WEY A;  2B7J A;  5CRH A;  4ID0 A;  1TU8 A;  2IMF A;  1YQ1 A;  1PN0 A;  4YKF A;  2RLI A;  3TJJ A;  1SKS B;  3QAG A;  2FWF A;  2B5E A;  3ZRD A;  3O3T A;  2F3M A;  2A4V A;  3TKR A;  1T00 A;  5G30 A;  2I81 A;  4YH2 A;  1MD4 A;  4P3Y B;  2N5F A;  4JR4 A;  5A5H A;  2V6O A;  4GF0 A;  5J4V A;  2H70 A;  2PUK C;  4USS A;  3C8E A;  5JCW A;  1I1I P;  4KGI A;  2B1K A;  2GQL A;  4XRD A;  3ZZX A;  5DVB A;  4F0C A;  2IMD A;  3IOS A;  4RUV A;  3US3 A;  3HYP A;  1AQX A;  4AJ6 A;  1N25 A;  4MMM A;  2P5R A;  1GSQ A;  3FW2 A;  4XS4 B;  4XS6 A;  3EUR A;  3PIN A;  3ED3 A;  3KP8 A;  3L4N A;  4XHM A;  4PUR A;  2IPA A;  1OE8 A;  1EEM A;  2YJH A;  1OE7 A;  2JZS A;  4EDZ A;  1Q98 A;  3TKS E;  4MJA A;  1E2Y A;  5DQY A;  3UOM A;  1R4W A;  3A2W A;  22GS A;  2G2Q A;  1GNW A;  3UL3 A;  3TDG A;  3FZ9 A;  2M46 A;  2MMO A;  4MPG A;  3GA4 A;  4DSS B;  3H79 A;  2O85 A;  1OYJ A;  3ZIT A;  1C72 A;  2KUC A;  3QD9 A;  2JSY A;  4K5S A;  1SKW B;  2YZH A;  1I5G A;  4I2U A;  4PUA A;  1O8X A;  2OT3 A;  4LLR A;  5L71 A;  4XIH A;  5IOW A;  2XPD A;  3VWV A;  14GS A;  1DE1 A;  2HLS A;  3CXG A;  3D0Z A;  3GUR A;  2YPM A;  2REM A;  2WZ9 A;  4TXV A;  3F4S A;  2YZU A;  4J57 E;  5IMD A;  1ZL9 A;  1Y25 A;  2O89 A;  4F2I A;  2ZNM A;  1NW2 A;  4QL7 A;  2FWG A;  1SEN A;  3VWU A;  1V9W A;  2DJ2 A;  3HMJ G;  4BWS A;  5LNK e;  1YEX A;  3H8Q A;  5JWO B;  5GSS A;  1MDI A;  3O76 A;  4Q5F A;  2YWI A;  1SD9 A;  1ZGN A;  3EVI A;  4EC0 A;  1JLW A;  2UV8 G;  4K7N A;  2WUL A;  2EIO A;  5A34 A;  1UC7 A;  1PX6 A;  1JZO A;  4J56 E;  1GUL A;  4FIW A;  4WBR D;  3TJB A;  2HI7 A;  3ZVJ A;  1TW9 A;  2YWM A;  2R0G A;  1NHO A;  6GSX A;  2HZE A;  2NBS A;  1IYI A;  2WS2 A;  1WOU A;  2WB9 A;  1SD8 A;  1EOG A;  5IO2 A;  2QSI A;  2LUS A;  4HUA A;  4KE3 A;  4MDC A;  3A2X A;  2VL3 A;  4F9Z A;  1VF3 A;  1PN9 A;  1YEP A;  3HVN A;  2FHE A;  1OKT A;  1J08 A;  2OBI A;  4N10 A;  2FGX A;  1HQO A;  1XWK A;  1G7O A;  4NAX A;  3CTG A;  2WDU A;  1JFU A;  2DJ3 A;  5A4V A;  2VAF A;  3FKF A;  1HYU A;  2HRA A;  1TKD B;  4ZXG A;  4IJ3 A;  4XRA A;  2DJJ A;  1AAZ A;  3VK9 A;  1K0C A;  3HJO A;  4ZIJ A;  2IMK A;  5IOX A;  2WVX A;  5DJL A;  2C4J A;  1V58 A;  2RM6 A;  1PKZ A;  1XW6 A;  2L4C A;  1GUH A;  3DKS A;  3OR5 A;  4DSR A;  4KCA A;  1JZR A;  1U87 A;  4HJ2 A;  4XS1 A;  3F0I A;  4L0W A;  4GQF A;  4QMK A;  1TRW A;  2LJA A;  2VIM A;  3D21 A;  1M9A A;  1HNB A;  2WVX B;  3ERG A;  1F2E A;  3MDK A;  1YZX A;  3G7J A;  3BCI A;  3Q74 A;  1O6J A;  3G7I A;  3GH6 A;  4GQC A;  2FNO A;  3N5O A;  3KXO A;  5ECH B;  3GTU B;  1BQ7 A;  3SBC A;  1XZO A;  2EFE A;  2L59 A;  4ILF A;  2FA8 A;  4MJC A;  4MF6 A;  2H73 A;  1FW1 A;  12GS A;  2LJR A;  2J9H A;  2PBJ A;  2IN3 A;  3L9U A;  3GX0 A;  2CZ2 A;  3A5I A;  3DVW A;  2H1L A;  1X5E A;  2LJK A;  1O73 A;  4MZW A;  3VUR A;  3J7Y b;  1UVZ A;  4BVY B;  2HZF A;  5ECI B;  3WT2 A;  5DQS A;  5KOX A;  2RM5 A;  4JR6 A;  3DYR A;  3V1W A;  4HI7 A;  1AIU A;  2L5O A;  1ERT A;  3ZLP A;  4MK3 A;  3K8N A;  5CO3 A;  5D96 A;  2R0P A;  1SK0 A;  1XW9 A;  3IV4 A;  3R2Q A;  4IHU A;  5H5S A;  5H5R A;  4V2L A;  3S9F A;  3H93 A;  3D4T A;  3LXT A;  4HU9 A;  5A5K A;  3IXR A;  1Y6E A;  5EL8 A;  3F6D A;  2IL3 A;  4RI6 A;  1R7H A;  1XFL A;  2PN8 A;  4Q5R A;  3F3Q A;  4IQA A;  5ID2 A;  3WD6 A;  2VLV A;  2LKU A;  4KX4 A;  5JCU A;  3ME7 A;  3KJY A;  2G0F A;  2H01 A;  3GMF A;  4Z2U A;  4X1U A;  5HR2 A;  1PRX A;  1ZYQ B;  4ZBD A;  1V40 A;  1XWB A;  5HR0 A;  4GDF A;  4K1F A;  4OO5 A;  1ZCP A;  3LOR A;  1UN2 A;  2A4H A;  4ISD A;  1K3L A;  1SVO A;  1BYE A;  1QXH A;  2X49 A;  2WW1 A;  2VCZ A;  9GSS A;  3TKP A;  2BJX A;  4F03 A;  2OKA A;  2F51 A;  1WRY A;  1Z6M A;  1T4Z A;  4N0V A;  2DKI A;  4Z2R A;  1K0O A;  2PGT A;  4O7H A;  5HFK A;  3QPM A;  1SVM A;  5FHI A;  4O5R A;  5E59 A;  2HXK A;  1Z7R A;  2R0C A;  1B48 A;  3FZA A;  5IMC A;  3ZIJ A;  2E0Q A;  2R3X A;  1GTA A;  1PD2 1;  5JWQ B;  6GSY A;  2LRC A;  1QGV A;  2V32 A;  2GDR A;  2KOK A;  4DSQ A;  3APS A;  3KMO A;  1JZW A;  1SK2 A;  3GKK A;  5EY6 A;  2WW3 A;  1ZYE A;  4JRR A;  3DD3 A;  2C0E A;  5EVO A;  3TU3 B;  4IBP A;  4N11 A;  1GSU A;  4PNG A;  1W4V A;  1I9D A;  5ECS A;  3G9B A;  3HXS A;  3F6F A;  2FCH A;  2ON7 A;  4WF4 A;  1GNE A;  2TRX A;  2CVD A;  3ZYW A;  4HS1 A;  1K0B A;  1EP7 A;  3FR9 A;  4HQS A;  3CSH A;  2KHP A;  4E68 A;  3L9V A;  1G0T A;  3IK9 A;  5DCH A;  1W89 A;  2LRT A;  1DE2 A;  3F4T A;  1A0F A;  4JZQ A;  2L6D A;  4FYB A;  2X99 A;  4I8B A;  1TJD A;  4X43 A;  2QA2 A;  3MNG A;  2VCV A;  5INY A;  1M99 A;  2GVP A;  5HR1 A;  3W6G A;  3APO A;  3CMI A;  4LL4 B;  4Q5Q A;  3WT1 A;  4GXZ A;  5IQY A;  2L5L A;  4E8E A;  3PH9 A;  3IE3 A;  3W8S A;  2DML A;  3M9J A;  4H86 A;  1XW5 A;  1AC1 A;  2X8C A;  1F9M A;  2AAW A;  4TOP A;  3GIX A;  4TXO B;  4KCE A;  2EC4 A;  4EUY A;  4KW6 A;  5B6N A;  5ENU A;  2OE0 A;  2E2G A;  2MMZ A;  1S3R A;  3ZML A;  2F9S A;  2LV3 A;  3IC4 A;  4V2N A;  4MA9 A;  5CP1 A;  2P5Q A;  3UVT A;  4POB A;  2X8H A;  3CWG A;  5ECO B;  2DBC A;  3DWV A;  3EE2 A;  5B6M A;  1S3A A;  4AKX B;  4ZL7 A;  1MEK A;  1X9S B;  3I43 A;  4CDO A;  1K0D A;  5DAK B;  1NM3 A;  1PMT A;  2O5V A;  4J2F A;  3TCO A;  1A2J A;  1GSS A;  4RI7 A;  3HVS A;  1WWJ A;  1PL1 A;  2CQ9 A;  3TB2 A;  2B7K A;  2YAN A;  1O85 A;  3GFK A;  4IEL A;  5J47 A;  1RK4 A;  4BVX A;  2R4V A;  2X8G A;  2BMX A;  4XS4 A;  2GS3 A;  3QOU A;  2YV7 A;  1WIK A;  2F8A A;  4K8M A;  5HR3 A;  3ZFL A;  1HNC A;  1SL1 B;  4X4J A;  3NIV A;  1XWG A;  1XIY A;  3F8U A;  5D8I A;  4BVX B;  1EOH A;  1H4O A;  2K8S A;  3IK7 A;  3M3M A;  1F37 A;  1PX7 A;  1XPV A;  2KLX A;  1XVQ A;  1A2M A;  4K0G A;  4DSS A;  3EMP A;  5E4W A;  2J23 A;  1GH2 A;  5HFG A;  4OD7 A;  2EFD A;  1K3Y A;  4HQZ A;  3KIJ A;  1DSB A;  5IMF A;  4ZB9 A;  2CX3 A;  3M0F A;  1TU7 A;  3QMX A;  4EE0 A;  5J5N A;  5IMZ A;  3ZL5 A;  3FYG A;  1Z9H A;  4DEJ A;  5G1K A;  2VUP A;  1GSF A;  4NWY A;  3Q6O A;  4FH8 A;  1BX9 A;  1J9B A;  4HOJ A;  2DJ1 A;  1FB0 A;  2GSQ A;  5D9W A;  4AGS A;  4OMV A;  2XBI A;  4ZBA A;  1YF1 A;  4W66 A;  4AKG A;  2PVO C;  1SJZ A;  3TOT A;  2R37 A;  4TW5 A;  2C8U A;  3GKX A;  4AJ7 A;  2OJL A;  2O7K A;  2GSR A;  3PPU A;  4G9H A;  4MH3 A;  2AV4 A;  1PFO A;  2H1A A;  1ZOF A;  2D2Z A;  4PXO A;  2C1Y A;  3TKS A;  3IC8 A;  4NMU A;  4ZL9 A;  4IVF A;  1R26 A;  2HT9 A;  2AHE A;  3HD5 A;  3P7X A;  5IO0 A;  1GLP A;  1YF0 A;  3TJG A;  2DJ0 A;  1QMV A;  6GST A;  3VI7 A;  3RPN A;  1PGT A;  2WVY A;  1IYH A;  5AIV A;  3VI5 A;  1CQH A;  5JWR B;  2GQM A;  2I9H A;  3HZ4 A;  2WFC A;  5KOW A;  4BL7 A;  3FEU A;  4ECJ A;  2RII A;  1V2A A;  3AY8 A;  2VD1 A;  4PHZ C;  2QGV A;  5A4W A;  3IPZ A;  2HE3 A;  1ERU A;  3VLN A;  1XWA A;  4MF5 A;  2QC7 A;  4IGJ A;  4BL7 B;  3UEM A;  4OO4 A;  3ZIV A;  3RBT A;  3FZ5 A;  1F6M C;  5IMA A;  1AXD A;  3TKQ A;  1SL2 B;  4G0K A;  5DAL B;  2X4A A;  2FD3 A;  2HNL A;  1XOB A;  3KZQ A;  4I2T A;  3C71 A;  4YQU A;  4FYC A;  2PMT A;  1TP9 A;  3P90 A;  2PU9 C;  4AI6 A;  4CHS A;  4Z2T A;  1G6W A;  4KA0 A;  4EIQ A;  2QKE A;  2V1M A;  4EKZ A;  1YKC A;  3D4M A;  2C0F A;  5ABR A;  4ULX A;  4HZ2 A;  1EP8 A;  2NDO A;  4EL1 A;  1BJX A;  5F06 A;  2H75 A;  1XOA A;  2DIZ A;  1T1V A;  4V2M A;  1EZK A;  1RW1 A;  2GZY A;  1FO5 A;  2A2R A;  4EF0 A;  2VLU A;  3TRX A;  2VL9 A;  3E0U A;  3GTU A;  2MZC A;  4OWY A;  4POK A;  3ZVJ D;  1Z5Y E;  3I69 A;  1EV9 A;  4BIK A;  5H5Q A;  2FLS A;  3RPP A;  4HJM A;  7GSS A;  3M1G A;  1S4B P;  1O81 A;  1M0U A;  4TR1 A;  4HZ4 A;  3I6A A;  2H0H A;  4KF9 A;  2DLX A;  1V57 A;  3A5W A;  5ECK B;  2I3Y A;  1GWC A;  4EO3 A;  4KB3 A;  1NHY A;  4BVY A;  1ON4 A;  3MAK A;  4HEA 2;  13GS A;  2K6V A;  3DXB A;  2JAD A;  1S3D A;  3EYT A;  5J40 A;  3IAS 2;  1THO A;  2OBK A;  4CW9 A;  2VKZ G;  4TR1 B;  3GX8 A;  4ML6 A;  5G1L A;  4IJI A;  5ECP B;  2V41 A;  1TK8 B;  3GN3 A;  2OAC A;  4GLT A;  1X9W B;  4ZB6 A;  2CT6 A;  3QFB C;  3HKR A;  3HHV A;  4IP6 A;  2HRN A;  4G2E A;  2GSS A;  2H30 A;  3M8N A;  1GLQ A;  1TXU A;  2EFH A;  3L78 A;  2C0G A;  2LNT A;  3GSS A;  5D73 A;  4YAP A;  1T7P B;  3H4K A;  1M7T A;  4ZB8 A;  1EV4 A;  1VGL A;  2CAQ A;  1Y1U A;  4POL A;  1GTI A;  3FRC A;  1X5D A;  1E6B A;  2VM2 A;  2LRN A;  1SJ6 A;  2K18 A;  3I9V 2;  3KGK A;  1XVW A;  5F0G A;  5A4U A;  2LS5 A;  5F8B A;  3GV1 A;  2CAI A;  3MYD A;  1OVN A;  1DBY A;  3UMA A;  3UVH A;  1H75 A;  2B5X A;  2HRK B;  1OC8 A;  2XC2 A;  2H74 A;  3LJR A;  1ILO A;  3L0H A;  4IQ1 A;  3LW9 A;  4PX1 A;  5FWG A;  1LBK A;  4WF5 A;  2R6K A;  1DUG A;  2VCX A;  4MAB A;  5CRG A;  1JZD A;  10GS A;  4YQM A;  1EEJ A;  1X0R A;  1V98 A;  4WKW A;  2AB6 A;  4K7O A;  2C0D A;  3LFL A;  4IP1 A;  17GS A;  2MBT A;  1TXX A;  2A2S A;  1U3I A;  1RQM A;  3D22 A;  4PQI A;  4FXY P;  3FY7 A;  3CSJ A;  2DMM A;  1SVL A;  4G01 A;  1EGR A;  1A2L A;  2C3T A;  3UIW A;  4I6X A;  1URM A;  1X9M B;  1K3O A;  3C1S A;  3HCZ A;  5GAP D;  5DBQ A;  3RDW A;  3ERW A;  2CZ3 A;  4KAE A;  2IME A;  5J9B A;  3CBU A;  1VF4 A;  1OAZ A;  4KDX A;  5J9C A;  2RUF A;  5GAN D;  5DJM A;  2IFQ B;  2DIY A;  2FWH A;  2PVQ A;  2ALB A;  1SK1 A;  1QUW A;  1FHE A;  2L6C A;  2LTK A;  1UA5 A;  2BTO T;  4WR4 A;  3TKS C;  5G5F A;  1FVK A;  5G5E A;  1Z7P A;  3KCM A;  1B8X A;  2EIR A;  2AJQ B;  2YOI A;  3ME8 A;  3RFR C;  2XPE A;  4ACS A;  4MCU A;  3TUE A;  3MIX A;  2CVB A;  1B4P A;  4GST A;  5CRE A;  2GT5 A;  20GS A;  4TXO A;  4TRX A;  2GST A;  3C7M A;  2VO4 A;  1MDK A;  4ML1 A;  2FUG 2;  4PI0 C;  3CTF A;  3GH9 A;  2HYX A; 
#chains in the Genus database with same CATH homology
 2WCI A;  4LA1 A;  4NV5 A;  1GUK A;  3WYW A;  2VL2 A;  4GRF A;  1B9X C;  2L57 A;  4GTU A;  4G0L A;  1FOV A;  5F05 A;  4F0B A;  1XBS A;  3LEF A;  4GSS A;  5AGY A;  5DAK A;  1OC9 B;  1TDI A;  1O8W A;  3HA9 A;  3GUS A;  1M2B A;  4QQ7 A;  5DDL A;  1R5P A;  3A2V A;  3WGD A;  2ZCT A;  3WGE A;  2DJK A;  2OE1 A;  1J0F A;  5G31 A;  2AYT A;  2H19 A;  3Q18 A;  2Z9S A;  2B1L A;  4TR4 A;  4AF2 A;  3CYN A;  1AW9 A;  1FVJ A;  2TRC P;  3EC3 A;  2AUV A;  3BCK A;  3IRA A;  5C00 A;  5KN1 A;  5F07 A;  1F3B A;  2I4A A;  3DRN A;  3LXZ A;  3C73 A;  3UAP A;  5BRT A;  3A3T A;  3E3E A;  2VM1 A;  4ECB A;  1PQN A;  1ZYN A;  5J4Y A;  2H0G A;  3KH9 A;  1PSQ A;  1U6T A;  4MPF A;  4KH7 A;  3GRX A;  1A24 A;  4MZB A;  1OC3 A;  4TR0 A;  1FAA A;  1THX A;  3IAM 2;  2H1D A;  2GLR A;  3UBL A;  1MDJ A;  3U6V A;  4MZC A;  4TKY A;  2XBQ A;  2LQQ A;  1O7U A;  4KSM A;  5LCZ A;  3NZN A;  5JCG A;  3LYK A;  4RQR A;  3PR8 A;  3VFI A;  1XXU A;  3QFA C;  4FYU A;  4K7I A;  2HSN A;  19GS A;  3GNJ A;  4YKG A;  4QL9 A;  4G0I A;  2M72 A;  2H6X A;  2H0I A;  4BWQ A;  4YAV A;  2DSA A;  2WGR A;  4MNN A;  1BF5 A;  2DKH A;  5A5H B;  5IMV A;  4KSO A;  4V1A p;  1X5C A;  1ST9 A;  3F63 A;  1GSE A;  2HSN B;  5BMU A;  2P31 A;  4ZBB A;  4ECC A;  3EU3 A;  3QAV A;  3TJK A;  1GP1 A;  2PPT A;  1TI3 A;  3FMW A;  3FHK A;  1JLV A;  4O32 A;  4FQU A;  5ECL B;  1KBN A;  1VF2 A;  2FA4 A;  1TTZ A;  5A1N A;  3TOU A;  2YWN A;  5J41 A;  2JAC A;  2HSY A;  1Q4J A;  5BMU B;  3C1R A;  4ICY A;  3FR6 A;  3IHG A;  1SL0 B;  2GT6 A;  5GST A;  1ML6 A;  1YVL A;  2H76 A;  3KMN A;  1EGO A;  4TR3 A;  4K0N A;  4HDE A;  3GYK A;  1HD2 A;  3UBK A;  3SWL A;  2LST A;  4Z7X A;  1PKW A;  2JSZ A;  4JBB A;  5A1N B;  1ACV A;  18GS A;  5ELG A;  3LYP A;  3CSI A;  4JU5 A;  3VPT A;  3KP9 A;  1TRU A;  1G6Y A;  5B7C A;  3F3R A;  1R5A A;  2YP6 A;  2ES7 A;  6GSU A;  5IPH A;  4WET A;  3EPT A;  1ABA A;  2C3N A;  1MD3 A;  3J7Y k;  3VPQ A;  4PTS A;  4I97 A;  3KEB A;  3EU4 A;  5D9T A;  5KN3 A;  1AQV A;  4PQH A;  3EIN A;  1GUM A;  4K5R A;  1YY7 A;  2NTO A;  4TN8 A;  5CRD A;  3TRQ A;  4GSN A;  4KUN A;  2GGT A;  1GSY A;  2JZT A;  3LG6 A;  2YJ7 A;  3BD2 A;  5C04 A;  1M9B A;  5ECR B;  2O8V B;  2C3Q A;  1VRS D;  2CVK A;  5ECM B;  3D5J A;  1USB A;  5LD0 A;  5KN0 A;  5DAL A;  3M9K A;  2HSH A;  4NXI A;  4OCF A;  4MF7 A;  1LU4 A;  1M2D A;  2KP2 A;  3RAZ A;  2OAD A;  1ERW A;  2TIR A;  4JE1 A;  4O5U A;  5AIX A;  4LL1 B;  5IM9 A;  1K0A A;  4YQV A;  1SKR B;  2GQK A;  4L5L A;  4ECI A;  3GL3 A;  2H1B A;  3ISO A;  1KTE A;  1SYR A;  3QAW A;  2LEG A;  3GKN A;  2NPB A;  4MH2 A;  5A34 B;  1SYX A;  3CRU A;  1F3A A;  3KD0 A;  1PA3 A;  3HDC A;  2VCW A;  4EDY A;  2YCD A;  2HZE B;  2QA1 A;  4E8H A;  1AUC A;  3DIE A;  2HRF A;  2MYG A;  2N5B A;  1HNA A;  2JL4 A;  3N9J A;  1TI1 A;  3FZ4 A;  4I5Q A;  1GTB A;  2CX4 A;  2OA7 A;  2R2J A;  3DGQ A;  4NHW A;  1BAY A;  3HVX A;  2JU5 A;  3IBH A;  4G10 A;  3W8J A;  2I1U A;  2UZ8 A;  4CY6 A;  3HJP A;  4BA7 A;  1KNG A;  2LQO A;  3IR4 A;  3LGC A;  4AKI A;  3IDV A;  3CRT A;  5CRW A;  5G2Z A;  4L5O A;  1SJI A;  1WE0 A;  4ZB7 A;  4AJ8 A;  5HFI A;  4WXT A;  4AKH A;  3APQ A;  3P2A A;  4PNF A;  11GS A;  3GHA A;  1B9Y C;  1TRS A;  1T4Y A;  2F8F A;  2VD0 A;  4GWR A;  1Z6N A;  1XCC A;  1YKA A;  3R3E A;  4K2X A;  1MTC A;  2CA8 A;  3FK8 A;  2VL2 C;  2YN1 A;  2HSM A;  2IJY A;  2GTU A;  2H1G A;  2HQT A;  4PQ1 A;  1BED A;  1G7E A;  3P8W A;  2E2M A;  4TVE A;  2KP1 A;  1FOH A;  4JED A;  2V2G A;  2FY6 A;  1QK8 A;  4OFT A;  1A8L A;  3BBY A;  4MP4 A;  4OFN A;  3F4R A;  3D6I A;  3VWX A;  2MMN A;  3ERF A;  3MSZ A;  3QCP A;  8GSS A;  5J4U A;  5KEJ A;  2HSM B;  2H6Y A;  5B8B A;  2B6M A;  2N5A A;  3PGT A;  4L0U A;  3HY2 A;  1CQG A;  2JZR A;  3RHB A;  2IWT A;  4XTS A;  4WBJ A;  4EIP A;  2H66 A;  16GS A;  2X64 A;  2C80 A;  4KDU A;  3TGZ A;  2IIY A;  4FO5 A;  1VF1 A;  1ZMA A;  2HRK A;  3ZMK A;  2PER A;  2WRT A;  4Q5N A;  4RQX A;  2NVL A;  5CNW A;  4L8E A;  2H71 A;  2O87 A;  2H72 A;  3LSZ A;  1QFN A;  5ELA A;  4N3Z A;  4EVM A;  2RUE A;  3ZRE A;  4LMW A;  2H8L A;  2B5Y A;  1JHB A;  4IS0 A;  3HVV A;  4D73 A;  5ECQ B;  3E9J B;  1QQ2 A;  5GZZ B;  1K0N A;  2DC5 A;  3ZTL A;  2GZZ A;  3TJF A;  1ERV A;  4PUF C;  1Z3E A;  1M2A A;  1NSW A;  2VLT A;  1TRV A;  2XHF A;  2GZP A;  5D93 A;  4D73 B;  5DCG A;  2VCQ A;  1GTU A;  3EWL A;  4BPY A;  1TK5 B;  4IKH A;  1SU9 A;  3NOF A;  5ID2 B;  1WMJ A;  3GST A;  5J3R A;  1WPI A;  5KN2 A;  1XWC A;  3U5R E;  6GSV A;  1WJK A;  4LMV A;  2YWO A;  2MBS A;  2K8V A;  3Q19 A;  5COH A;  1PL2 A;  3JCM L;  2LNS A;  3HZ8 A;  1A23 A;  4PGT A;  2IFQ A;  2P0G A;  4KDY A;  3VWW A;  1TOF A;  2K9F A;  4K9Z A;  3QDN A;  4OCE A;  3L9S A;  3MWH A;  3WGX A;  3O6T A;  2A2P A;  2MMA A;  5B8A A;  4NHZ A;  2ON5 A;  1U3A A;  4WR5 A;  2R5G A;  3QR6 A;  5CAX A;  3BJ5 A;  1AQW A;  3KTL A;  4V1A g;  1YDK A;  3TRP A;  2B3S A;  2M80 A;  3LWA A;  2EIQ A;  1GRX A;  3DEX A;  3DVX A;  4NPB A;  2PWJ A;  5FT3 A;  5IIZ A;  3DML A;  3ZFB A;  1FG4 A;  4MLY A;  1LJR A;  5AIS A;  5HQP A;  4NV2 A;  1N2A A;  4OFM A;  1YJ6 A;  4N0Z A;  1GSD A;  4HU7 A;  1N8J A;  5AN1 A;  5IPG A;  4X0X A;  6GSS A;  2IMI A;  1A8Y A;  1T8E B;  5CYY A;  5D9X A;  1KEB A;  2YV9 A;  5ECN B;  2VOC A;  1U88 A;  3LQ7 A;  4DVC A;  3F9U A;  4O5Q A;  2V6K A;  2VCT A;  4N30 A;  3FR3 A;  1WP0 A;  4MJB A;  3EMX A;  1OC9 A;  3GKM A;  1BG5 A;  1T3B A;  4CY8 A;  3IA1 A;  4G19 A;  4MJE A;  4POM A;  4O92 A;  3BOA A;  2E7P A;  2EFC A;  3KTB A;  3KM6 A;  3RHC A;  4GCI A;  1K0M A;  3H1N A;  4ZL8 A;  2WJU A;  2HFD A;  2YNX A;  4K2D A;  5D9V A;  6GSW A;  4XCS A;  2CV4 A;  1EWX A;  3KH7 A;  1BG1 A;  2L4Q A;  4EXJ A;  4IW9 A;  4A5P A;  4KND A;  1FB6 A;  5EPF A;  1GL8 A;  1TK0 B;  2FWE A;  4F82 A;  4K6X A;  1OKD A;  4ZIL A;  3IHQ A;  2ZUP A;  3UJ1 A;  1A0R P;  1S3C A;  1ZZY A;  4IN0 A;  2OE3 A;  3HJM A;  3G7Y A;  3GL5 A;  2H6Z A;  1B4Q A;  1ZYP A;  3UAR A;  4WEY A;  2B7J A;  5CRH A;  4ID0 A;  1TU8 A;  2IMF A;  1YQ1 A;  1PN0 A;  4YKF A;  2RLI A;  3TJJ A;  1SKS B;  3QAG A;  2FWF A;  2B5E A;  3ZRD A;  3O3T A;  2F3M A;  2A4V A;  3TKR A;  1T00 A;  5G30 A;  2I81 A;  4YH2 A;  1MD4 A;  4P3Y B;  2N5F A;  4JR4 A;  5A5H A;  2V6O A;  4GF0 A;  5J4V A;  2H70 A;  2PUK C;  4USS A;  3C8E A;  5JCW A;  4KGI A;  2B1K A;  2GQL A;  4XRD A;  3ZZX A;  5DVB A;  4F0C A;  2IMD A;  3IOS A;  4RUV A;  3US3 A;  3HYP A;  1AQX A;  4AJ6 A;  1N25 A;  4MMM A;  2P5R A;  1GSQ A;  3FW2 A;  4XS4 B;  4XS6 A;  3EUR A;  3PIN A;  3ED3 A;  3KP8 A;  3L4N A;  4XHM A;  4PUR A;  2IPA A;  1OE8 A;  1EEM A;  2YJH A;  1OE7 A;  2JZS A;  4EDZ A;  1Q98 A;  3TKS E;  4MJA A;  1E2Y A;  5DQY A;  3UOM A;  1R4W A;  3A2W A;  22GS A;  2G2Q A;  1GNW A;  3UL3 A;  3TDG A;  3FZ9 A;  2M46 A;  2MMO A;  4MPG A;  3GA4 A;  4DSS B;  3H79 A;  2O85 A;  1OYJ A;  3ZIT A;  1C72 A;  2KUC A;  3QD9 A;  2JSY A;  4K5S A;  1SKW B;  2YZH A;  1I5G A;  4I2U A;  4PUA A;  1O8X A;  2OT3 A;  4LLR A;  5L71 A;  4XIH A;  5IOW A;  2XPD A;  3VWV A;  14GS A;  1DE1 A;  2HLS A;  3CXG A;  3D0Z A;  3GUR A;  2YPM A;  2REM A;  2WZ9 A;  4TXV A;  3F4S A;  2YZU A;  4J57 E;  5IMD A;  1ZL9 A;  1Y25 A;  2O89 A;  4F2I A;  2ZNM A;  1NW2 A;  4QL7 A;  2FWG A;  1SEN A;  3VWU A;  1V9W A;  2DJ2 A;  3HMJ G;  4BWS A;  5LNK e;  1YEX A;  3H8Q A;  5JWO B;  5GSS A;  1MDI A;  3O76 A;  4Q5F A;  2YWI A;  1SD9 A;  1ZGN A;  3EVI A;  4EC0 A;  1JLW A;  2UV8 G;  4K7N A;  2WUL A;  2EIO A;  5A34 A;  1UC7 A;  1PX6 A;  1JZO A;  4J56 E;  1GUL A;  4FIW A;  4WBR D;  3TJB A;  2HI7 A;  3ZVJ A;  1TW9 A;  2YWM A;  2R0G A;  1NHO A;  6GSX A;  2HZE A;  2NBS A;  1IYI A;  2WS2 A;  1WOU A;  2WB9 A;  1SD8 A;  1EOG A;  5IO2 A;  2QSI A;  2LUS A;  4HUA A;  4KE3 A;  4MDC A;  3A2X A;  2VL3 A;  4F9Z A;  1VF3 A;  1PN9 A;  1YEP A;  2FHE A;  1OKT A;  1J08 A;  2OBI A;  4N10 A;  2FGX A;  1HQO A;  1XWK A;  1G7O A;  4NAX A;  3CTG A;  2WDU A;  1JFU A;  2DJ3 A;  5A4V A;  2VAF A;  3FKF A;  1HYU A;  2HRA A;  1TKD B;  4ZXG A;  4IJ3 A;  4XRA A;  2DJJ A;  1AAZ A;  3VK9 A;  1K0C A;  3HJO A;  4ZIJ A;  2IMK A;  5IOX A;  5DJL A;  2C4J A;  1V58 A;  2RM6 A;  1PKZ A;  1XW6 A;  2L4C A;  1GUH A;  3DKS A;  3OR5 A;  4DSR A;  4KCA A;  1JZR A;  1U87 A;  4HJ2 A;  4XS1 A;  3F0I A;  4L0W A;  4GQF A;  4QMK A;  1TRW A;  2LJA A;  2VIM A;  3D21 A;  1M9A A;  1HNB A;  3ERG A;  1F2E A;  3MDK A;  1YZX A;  3G7J A;  3BCI A;  3Q74 A;  1O6J A;  3G7I A;  3GH6 A;  4GQC A;  2FNO A;  3N5O A;  3KXO A;  5ECH B;  3GTU B;  1BQ7 A;  3SBC A;  1XZO A;  2EFE A;  2L59 A;  4ILF A;  2FA8 A;  4MJC A;  4MF6 A;  2H73 A;  1FW1 A;  12GS A;  2LJR A;  2J9H A;  2PBJ A;  2IN3 A;  3L9U A;  3GX0 A;  2CZ2 A;  3A5I A;  3DVW A;  2H1L A;  1X5E A;  2LJK A;  1O73 A;  4MZW A;  3VUR A;  3J7Y b;  1UVZ A;  4BVY B;  2HZF A;  5ECI B;  3WT2 A;  5DQS A;  5KOX A;  2RM5 A;  4JR6 A;  3DYR A;  3V1W A;  4HI7 A;  1AIU A;  2L5O A;  1ERT A;  3ZLP A;  4MK3 A;  3K8N A;  5CO3 A;  5D96 A;  2R0P A;  1SK0 A;  1XW9 A;  3IV4 A;  3R2Q A;  4IHU A;  5H5S A;  5H5R A;  4V2L A;  3S9F A;  3H93 A;  3D4T A;  3LXT A;  4HU9 A;  5A5K A;  3IXR A;  1Y6E A;  5EL8 A;  3F6D A;  2IL3 A;  4RI6 A;  1R7H A;  1XFL A;  2PN8 A;  4Q5R A;  3F3Q A;  4IQA A;  5ID2 A;  3WD6 A;  2VLV A;  2LKU A;  3ME7 A;  4KX4 A;  5JCU A;  3KJY A;  2G0F A;  2H01 A;  3GMF A;  4Z2U A;  4X1U A;  5HR2 A;  1PRX A;  1ZYQ B;  4ZBD A;  1V40 A;  1XWB A;  5HR0 A;  4GDF A;  4K1F A;  4OO5 A;  1ZCP A;  3LOR A;  1UN2 A;  2A4H A;  4ISD A;  1K3L A;  1SVO A;  1BYE A;  1QXH A;  2X49 A;  2VCZ A;  9GSS A;  3TKP A;  2BJX A;  4F03 A;  2OKA A;  2F51 A;  1WRY A;  1Z6M A;  1T4Z A;  4N0V A;  2DKI A;  4Z2R A;  1K0O A;  2PGT A;  4O7H A;  5HFK A;  3QPM A;  1SVM A;  5FHI A;  4O5R A;  5E59 A;  2HXK A;  1Z7R A;  2R0C A;  1B48 A;  3FZA A;  5IMC A;  3ZIJ A;  2E0Q A;  2R3X A;  1GTA A;  1PD2 1;  5JWQ B;  6GSY A;  2LRC A;  1QGV A;  2V32 A;  2GDR A;  2KOK A;  4DSQ A;  3APS A;  3KMO A;  1JZW A;  1SK2 A;  3GKK A;  5EY6 A;  1ZYE A;  4JRR A;  3DD3 A;  2C0E A;  5EVO A;  3TU3 B;  4IBP A;  4N11 A;  1GSU A;  4PNG A;  1W4V A;  1I9D A;  5ECS A;  3G9B A;  3HXS A;  3F6F A;  2FCH A;  2ON7 A;  4WF4 A;  1GNE A;  2TRX A;  2CVD A;  3ZYW A;  4HS1 A;  1K0B A;  1EP7 A;  3FR9 A;  4HQS A;  3CSH A;  2KHP A;  4E68 A;  3L9V A;  1G0T A;  3IK9 A;  5DCH A;  1W89 A;  2LRT A;  1DE2 A;  3F4T A;  1A0F A;  4JZQ A;  2L6D A;  4FYB A;  2X99 A;  4I8B A;  1TJD A;  4X43 A;  2QA2 A;  3MNG A;  2VCV A;  5INY A;  1M99 A;  2GVP A;  5HR1 A;  3W6G A;  3APO A;  3CMI A;  4LL4 B;  4Q5Q A;  3WT1 A;  4GXZ A;  5IQY A;  2L5L A;  4E8E A;  3PH9 A;  3IE3 A;  3W8S A;  2DML A;  3M9J A;  4H86 A;  1XW5 A;  1AC1 A;  2X8C A;  1F9M A;  2AAW A;  4TOP A;  3GIX A;  4TXO B;  4KCE A;  2EC4 A;  4EUY A;  4KW6 A;  5B6N A;  5ENU A;  2OE0 A;  2E2G A;  2MMZ A;  3ZML A;  2F9S A;  2LV3 A;  3IC4 A;  4V2N A;  4MA9 A;  5CP1 A;  2P5Q A;  3UVT A;  4POB A;  2X8H A;  3CWG A;  5ECO B;  2DBC A;  3DWV A;  3EE2 A;  5B6M A;  1S3A A;  4AKX B;  4ZL7 A;  1MEK A;  1X9S B;  3I43 A;  4CDO A;  1K0D A;  5DAK B;  1NM3 A;  1PMT A;  2O5V A;  4J2F A;  3TCO A;  1A2J A;  1GSS A;  4RI7 A;  3HVS A;  1WWJ A;  1PL1 A;  2CQ9 A;  3TB2 A;  2B7K A;  2YAN A;  1O85 A;  3GFK A;  4IEL A;  5J47 A;  1RK4 A;  4BVX A;  2R4V A;  2X8G A;  2BMX A;  4XS4 A;  2GS3 A;  3QOU A;  2YV7 A;  1WIK A;  2F8A A;  4K8M A;  5HR3 A;  3ZFL A;  1HNC A;  1SL1 B;  4X4J A;  3NIV A;  1XWG A;  1XIY A;  3F8U A;  5D8I A;  4BVX B;  1EOH A;  1H4O A;  2K8S A;  3IK7 A;  3M3M A;  1F37 A;  1PX7 A;  1XPV A;  2KLX A;  1XVQ A;  1A2M A;  4K0G A;  4DSS A;  3EMP A;  5E4W A;  2J23 A;  1GH2 A;  5HFG A;  4OD7 A;  2EFD A;  1K3Y A;  4HQZ A;  3KIJ A;  1DSB A;  5IMF A;  4ZB9 A;  2CX3 A;  3M0F A;  1TU7 A;  3QMX A;  4EE0 A;  5J5N A;  5IMZ A;  3ZL5 A;  3FYG A;  1Z9H A;  4DEJ A;  5G1K A;  2VUP A;  1GSF A;  4NWY A;  3Q6O A;  4FH8 A;  1BX9 A;  1J9B A;  4HOJ A;  2DJ1 A;  1FB0 A;  2GSQ A;  5D9W A;  4AGS A;  4OMV A;  2XBI A;  4ZBA A;  1YF1 A;  4W66 A;  4AKG A;  2PVO C;  1SJZ A;  3TOT A;  2R37 A;  4TW5 A;  2C8U A;  3GKX A;  4AJ7 A;  2OJL A;  2O7K A;  2GSR A;  3PPU A;  4G9H A;  4MH3 A;  2AV4 A;  2H1A A;  1ZOF A;  2D2Z A;  4PXO A;  2C1Y A;  3TKS A;  3IC8 A;  4NMU A;  4ZL9 A;  4IVF A;  1R26 A;  2HT9 A;  2AHE A;  3HD5 A;  3P7X A;  5IO0 A;  1GLP A;  1YF0 A;  3TJG A;  2DJ0 A;  1QMV A;  6GST A;  3VI7 A;  3RPN A;  1PGT A;  1IYH A;  5AIV A;  3VI5 A;  1CQH A;  5JWR B;  2GQM A;  2I9H A;  3HZ4 A;  2WFC A;  5KOW A;  4BL7 A;  3FEU A;  4ECJ A;  2RII A;  1V2A A;  3AY8 A;  2VD1 A;  2QGV A;  5A4W A;  3IPZ A;  2HE3 A;  1ERU A;  3VLN A;  1XWA A;  4MF5 A;  2QC7 A;  4IGJ A;  4BL7 B;  3UEM A;  4OO4 A;  3ZIV A;  3RBT A;  3FZ5 A;  1F6M C;  5IMA A;  1AXD A;  3TKQ A;  1SL2 B;  4G0K A;  5DAL B;  2X4A A;  2FD3 A;  2HNL A;  1XOB A;  3KZQ A;  4I2T A;  3C71 A;  4YQU A;  4FYC A;  2PMT A;  1TP9 A;  3P90 A;  2PU9 C;  4AI6 A;  4CHS A;  4Z2T A;  1G6W A;  4KA0 A;  4EIQ A;  2QKE A;  2V1M A;  4EKZ A;  1YKC A;  3D4M A;  2C0F A;  5ABR A;  4ULX A;  4HZ2 A;  1EP8 A;  2NDO A;  4EL1 A;  1BJX A;  5F06 A;  2H75 A;  1XOA A;  2DIZ A;  1T1V A;  4V2M A;  1EZK A;  1RW1 A;  2GZY A;  1FO5 A;  2A2R A;  4EF0 A;  2VLU A;  3TRX A;  2VL9 A;  3E0U A;  3GTU A;  2MZC A;  4OWY A;  4POK A;  3ZVJ D;  1Z5Y E;  3I69 A;  1EV9 A;  5H5Q A;  2FLS A;  3RPP A;  4HJM A;  7GSS A;  3M1G A;  1O81 A;  1M0U A;  4TR1 A;  4HZ4 A;  3I6A A;  2H0H A;  4KF9 A;  2DLX A;  1V57 A;  3A5W A;  5ECK B;  2I3Y A;  1GWC A;  4EO3 A;  4KB3 A;  1NHY A;  4BVY A;  1ON4 A;  3MAK A;  4HEA 2;  13GS A;  2K6V A;  3DXB A;  2JAD A;  1S3D A;  3EYT A;  5J40 A;  3IAS 2;  1THO A;  2OBK A;  4CW9 A;  2VKZ G;  4TR1 B;  3GX8 A;  4ML6 A;  5G1L A;  4IJI A;  5ECP B;  2V41 A;  1TK8 B;  3GN3 A;  2OAC A;  4GLT A;  1X9W B;  4ZB6 A;  2CT6 A;  3QFB C;  3HKR A;  3HHV A;  4IP6 A;  2HRN A;  4G2E A;  2GSS A;  2H30 A;  3M8N A;  1GLQ A;  1TXU A;  2EFH A;  3L78 A;  2C0G A;  2LNT A;  3GSS A;  5D73 A;  4YAP A;  1T7P B;  3H4K A;  1M7T A;  4ZB8 A;  1EV4 A;  1VGL A;  2CAQ A;  1Y1U A;  4POL A;  1GTI A;  3FRC A;  1X5D A;  1E6B A;  2VM2 A;  2LRN A;  1SJ6 A;  2K18 A;  3I9V 2;  3KGK A;  1XVW A;  5F0G A;  5A4U A;  2LS5 A;  5F8B A;  3GV1 A;  2CAI A;  3MYD A;  1OVN A;  1DBY A;  3UMA A;  3UVH A;  1H75 A;  2B5X A;  2HRK B;  1OC8 A;  2XC2 A;  2H74 A;  3LJR A;  1ILO A;  3L0H A;  4IQ1 A;  3LW9 A;  4PX1 A;  5FWG A;  1LBK A;  4WF5 A;  2R6K A;  1DUG A;  2VCX A;  4MAB A;  5CRG A;  1JZD A;  10GS A;  4YQM A;  1EEJ A;  1X0R A;  1V98 A;  4WKW A;  2AB6 A;  4K7O A;  2C0D A;  3LFL A;  4IP1 A;  17GS A;  2MBT A;  1TXX A;  2A2S A;  1U3I A;  1RQM A;  3D22 A;  4PQI A;  3FY7 A;  3CSJ A;  2DMM A;  1SVL A;  4G01 A;  1EGR A;  1A2L A;  2C3T A;  3UIW A;  4I6X A;  1URM A;  1X9M B;  1K3O A;  3C1S A;  3HCZ A;  5GAP D;  5DBQ A;  3RDW A;  3ERW A;  2CZ3 A;  4KAE A;  2IME A;  5J9B A;  3CBU A;  1VF4 A;  1OAZ A;  4KDX A;  5J9C A;  2RUF A;  5GAN D;  5DJM A;  2IFQ B;  2DIY A;  2FWH A;  2PVQ A;  2ALB A;  1SK1 A;  1QUW A;  1FHE A;  2L6C A;  2LTK A;  1UA5 A;  2BTO T;  4WR4 A;  3TKS C;  5G5F A;  1FVK A;  5G5E A;  1Z7P A;  3KCM A;  1B8X A;  2EIR A;  2AJQ B;  2YOI A;  3ME8 A;  2XPE A;  4ACS A;  4MCU A;  3TUE A;  3MIX A;  2CVB A;  1B4P A;  4GST A;  5CRE A;  2GT5 A;  20GS A;  4TXO A;  4TRX A;  2GST A;  3C7M A;  2VO4 A;  1MDK A;  4ML1 A;  2FUG 2;  3CTF A;  3GH9 A;  2HYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...