8GSSA

Human glutathione s-transferase p1-1, complex with glutathione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.
pubmed doi rcsb
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
molecule tags Transferase
source organism Homo sapiens
total genus 82
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 8gssA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 8gssA01
2KP1A 2H76A 2VCZA 2HZEA 4OFNA 3GSSA 4MJAA 3I9V2 4PUFC 2G0FA 3P7XA 2JZSA 5L71A 1X5CA 5ECMB 1ST9A 3VI7A 1C72A 4KF9A 4G0KA 2MMOA 2VLUA 5IMCA 3ZMLA 3EMXA 5AIVA 1BYEA 2JADA 4MPFA 3K8NA 5JWOB 4XIHA 1SK0A 2A4VA 3RHCA 1R4WA 1S3CA 3DIEA 5D73A 4ZBAA 3ZLPA 1T8EB 2IPAA 1X5DA 5EY6A 5IMZA 3VK9A 2K8SA 4WR5A 3HDCA 1EP7A 2H1DA 2AAWA 2CAIA 3GURA 1OC9B 2XBQA 4IQ1A 3LWAA 3KH9A 2H1BA 4WR4A 4EXJA 2YWNA 5EL8A 2LSTA 4F03A 4ISDA 1JZWA 3UARA 2H6XA 1OE7A 2LNTA 3L78A 3FZ9A 4MH3A 1YY7A 2CX4A 4O5RA 2DBCA 2PN8A 2CQ9A 3DEXA 3WGXA 1WOUA 2QC7A 2HZFA 5ID2A 1X9MB 3HA9A 1ZCPA 3HJMA 3LQ7A 4FYBA 3KP9A 2FA8A 5DJLA 1XZOA 2MZCA 3KM6A 5FT3A 3NZNA 1F3BA 3WYWA 2VCTA 2O7KA 2F9SA 4GQFA 1AQXA 3GL5A 3BD2A 2GS3A 4MH2A 4MZCA 3FKFA 1VF2A 2O85A 1GLQA 3IC8A 1JLVA 2HRNA 2IWTA 3DGQA 4I6XA 3ERGA 4ZB6A 3M1GA 2OADA 5HFIA 2F8AA 3GIXA 1GLPA 2O87A 1KNGA 2DJ3A 2DIYA 4HU7A 1BG5A 3U6VA 2GZZA 1X5EA 1BJXA 4V2NA 2DIZA 4P3YB 4D73A 2PVOC 2GQKA 4DSSA 2GQMA 2H1GA 1LBKA 1PKWA 3DVXA 3APQA 2YN1A 1O6JA 4V2MA 4BVYA 4DEJA 5IMVA 2CZ3A 2ZCTA 2OJLA 2C8UA 3IHQA 4NXIA 2V2GA 1ZYQB 2PERA 4IKHA 1M0UA 4TR1B 1PGTA 2LTKA 2GZPA 3EMPA 4IN0A 2HNLA 4HOJA 1QQ2A 2DJ1A 1EZKA 4GSNA 3KMOA 4JEDA 3GFKA 3VLNA 3R3EA 2NVLA 1TK0B 3GNJA 1EV4A 5ECNB 2YWIA 1ABAA 3C1RA 4PURA 1XWAA 5KN1A 1AXDA 2H71A 3CSJA 1GH2A 2GT5A 4I2UA 3H8QA 3FZ4A 3WGDA 3KIJA 2X8GA 3ZL5A 1XCCA 1AAZA 3QFBC 2CVKA 4MMMA 2C0FA 1WWJA 1PX7A 4EF0A 2E7PA 3S9FA 4OWYA 2OKAA 4OFMA 4LMWA 2WZ9A 1XBSA 4EUYA 16GSA 3TKPA 3D0ZA 4NPBA 4NV2A 4YH2A 2C0GA 3E9JB 3TB2A 2HLSA 1J9BA 2VLTA 3APSA 3D4TA 1KEBA 5B6NA 4ZBBA 1GSUA 1SL2B 4Q5RA 1XOBA 4I2TA 3GH6A 3P90A 1PMTA 2I3YA 3ZRDA 4OO5A 2VO4A 4O7HA 4KNDA 3WT1A 4LL1B 4L0WA 3TJJA 4TXVA 2FWEA 2HRKA 2L5OA 1OKTA 2PPTA 5DJMA 5G1LA 2DMLA 5D96A 3D5JA 1Z7PA 1PSQA 3US3A 1Z5YE 1A8LA 5HFGA 2K18A 4XCSA 3TKSA 2E2MA 1ZOFA 3ZYWA 1QGVA 3KXOA 3EU4A 3ED3A 2HZEB 1ZGNA 2MBTA 4GXZA 5B7CA 1K0NA 2FGXA 2ES7A 1TK5B 1Z9HA 4K7OA 2L6CA 2LNSA 2M80A 1V40A 3W6GA 2XPEA 1M9BA 5IMDA 1TU8A 2ZUPA 2YV9A 4F0BA 4KH7A 2GZYA 2AJQB 5CYYA 3HKRA 3LYKA 1QFNA 3A5WA 3N9JA 4TR1A 2IN3A 3M8NA 1GUKA 3G7JA 4MF6A 3W8SA 4Q5NA 4IHUA 3BOAA 5G5FA 4HQZA 2CZ2A 5C04A 4CW9A 2UZ8A 1FVKA 3KTLA 4WEYA 4PNGA 1R5PA 1GTBA 2OE0A 4NWYA 5IIZA 3W8JA 2R2JA 2IMFA 5CRGA 1AIUA 3LGCA 4WETA 2WDUA 1Y6EA 5IO2A 2LEGA 4PQHA 4TR0A 3MSZA 4CDOA 2PGTA 1U88A 3H4KA 2YOIA 3BCKA 4PUAA 3C7MA 3N5OA 1XW5A 3FR6A 3F9UA 3QPMA 5CNWA 2YCDA 1PX6A 3QFAC 1YF0A 2VL2A 1J0FA 4KDYA 2WCIA 1FOVA 3CYNA 2VD0A 4RI6A 4H86A 1SL1B 2YWMA 1TRUA 2C3NA 7GSSA 2HQTA 1EEJA 2EIRA 3HZ4A 3FEUA 4GSSA 5JWRB 1ERTA 1I9DA 4BPYA 1X9WB 5GSTA 2V1MA 3HCZA 4J57E 2LQQA 2DMMA 1F9MA 2BTOT 1FO5A 1HNAA 4BL7A 2HRFA 4PXOA 3IXRA 5ABRA 1T4YA 5AGYA 1EOHA 1YKAA 2AUVA 4IJ3A 3ZIJA 1A2MA 3HJPA 4V2LA 3GUSA 3TUEA 5HQPA 4NMUA 1W89A 1EGRA 2H73A 5B8AA 2B5YA 2CV4A 4PTSA 4TVEA 4NAXA 1G6WA 4D73B 5GSSA 3APOA 4O92A 4DSSB 5KN0A 4K7NA 3GHAA 3TJBA 3ME7A 4HZ4A 4JZQA 3ZIVA 3RPNA 4IQAA 2VL3A 3DD3A 2P0GA 4BVYB 4POBA 4WBJA 5EVOA 3I6AA 2V6KA 4LA1A 3QOUA 3CTGA 1GNWA 4X1UA 3MWHA 2RM6A 3OR5A 3TKRA 1XPVA 4FYCA 2VD1A 5D93A 3EINA 4K8MA 1K3OA 5DDLA 3DMLA 4XS4A 3F8UA 3EURA 2NPBA 3ZVJA 1GTIA 1HQOA 2MMAA 1TK8B 2B7JA 3M3MA 5EPFA 4FIWA 1O8XA 3ZVJD 4I97A 2GT6A 5CO3A 4MZBA 4O32A 2EIQA 4ZIJA 3FY7A 3IA1A 3AY8A 2HSMB 2GTUA 3L4NA 2YWOA 1RQMA 1Q4JA 4ML1A 4OO4A 1WMJA 5D9XA 4DSQA 2VOCA 6GSXA 3KTBA 3HVXA 1THOA 1ERWA 2HSYA 1M2AA 3U5RE 3TKSE 2HI7A 3FZAA 4G0LA 5COHA 1ZYEA 4NHZA 1O85A 4G0IA 1MD3A 1J08A 3F3QA 1Q98A 4EL1A 1SKWB 3CXGA 1WP0A 2AHEA 1ZMAA 4XRDA 5H5SA 3P8WA 4TW5A 2JU5A 4ID0A 2GSQA 1G7OA 1GSFA 1GULA 2CX3A 1U3AA 4DSRA 1NW2A 1OC8A 3UVTA 1CQHA 2DJ0A 4BVXA 5J3RA 4IP1A 3PH9A 2LJAA 1HNCA 5J41A 1EGOA 11GSA 2FD3A 3L9VA 1XW6A 1QMVA 3O3TA 4PGTA 1DBYA 4EC0A 2DSAA 3BJ5A 4K0GA 5F05A 4K6XA 1YZXA 3HY2A 3EWLA 2R6KA 3TGZA 4AJ7A 1KTEA 1A24A 2HRKB 1SYRA 4ECBA 1A0RP 2LS5A 6GSUA 4QQ7A 2V32A 4F82A 3TRXA 5CRWA 3EVIA 1YEXA 1N2AA 5G5EA 3C1SA 4KA0A 2TIRA 1EOGA 1SU9A 1KBNA 1TP9A 2H0IA 4ACSA 2GVPA 2IIYA 5J9BA 1TW9A 5J5NA 5CP1A 3V1WA 1HD2A 4GLTA 2XC2A 4NV5A 1GL8A 2FCHA 3MDKA 2XHFA 2N5BA 4XS1A 3UOMA 2FNOA 4LL4B 1UA5A 4FQUA 4V1Ag 2M46A 1HYUA 2LKUA 1XWGA 2R5GA 1FG4A 1G7EA 2R37A 4DVCA 4L8EA 1WRYA 3C71A 3HXSA 3H93A 2DC5A 2X8HA 3KZQA 1U87A 4GQCA 2DJKA 2AV4A 2C1YA 5AISA 2NBSA 2M72A 1EV9A 1MEKA 5IO0A 1DSBA 1U6TA 4F2IA 4MP4A 12GSA 3IAM2 2X99A 3RDWA 13GSA 4ZXGA 2X64A 2IFQA 3ISOA 1WJKA 3A2WA 2PU9C 4IS0A 5ECQB 3IPZA 5J9CA 1F37A 1MDKA 1FB6A 5DCGA 5KEJA 1H4OA 2HFDA 1VF4A 3BCIA 1JZDA 1UN2A 5JWQB 4ZL8A 5IMAA 4KSMA 2AB6A 2HSMA 4PQIA 5DBQA 3Q74A 1SENA 2Z9SA 4ML6A 2PBJA 4ZB9A 2WGRA 5E4WA 2J9HA 2TRXA 2H6ZA 1K0OA 1I5GA 4KCEA 2PMTA 2WRTA 3G7IA 3FR9A 5JCUA 2L5LA 2DJ2A 1FVJA 4E8EA 4EDYA 3Q6OA 3UBLA 1R7HA 1MTCA 1WPIA 1JHBA 1OYJA 2KUCA 4HEA2 5D9VA 3D21A 4Q5QA 2IMKA 3LXTA 5F0GA 5LD0A 2YPMA 4MF7A 2LJKA 3VPTA 4AJ8A 1IYHA 2OBIA 3GX8A 3KCMA 4L5LA 2VL9A 3DWVA 1F3AA 4ZL9A 4ECCA 1OC3A 2YZHA 5ECPB 4OMVA 2GLRA 4BL7B 3A2VA 2H75A 4F9ZA 5B8BA 1FB0A 2C80A 3CBUA 1PD21 4TOPA 1PA3A 3LYPA 1M7TA 4BWQA 1A23A 3ME8A 1PQNA 4N30A 5C00A 2LRNA 3QDNA 1M99A 1BAYA 5ECKB 3SWLA 2H66A 5LCZA 2H8LA 2J23A 4I5QA 3J7Yk 2LRCA 4G10A 2WB9A 2N5AA 1GUHA 4G9HA 5JCWA 2WJUA 4NHWA 5ECSA 1ERUA 4LLRA 1K0MA 1X0RA 2VM2A 3O6TA 4MJCA 4USSA 4TR4A 3J7Yb 2LQOA 3IC4A 5ECHB 3TRPA 3VFIA 2VM1A 2YJHA 2GQLA 1M2BA 3UVHA 1PRXA 2I1UA 4GRFA 2CAQA 1T7PB 1BX9A 2C3TA 4XS4B 1SYXA 4JR4A 1Y25A 4IJIA 1T1VA 2IMIA 3Q19A 1Z7RA 4POLA 1TI3A 1S3AA 1TRVA 4KAEA 1AC1A 1USBA 6GSTA 2IJYA 5DQSA 3F6DA 4FH8A 1B9XC 4WBRD 2H0GA 3UBKA 3WT2A 4XTSA 2GSRA 2EC4A 2C4JA 5IMFA 3FRCA 3GKNA 1AQWA 3JCML 2GDRA 5AIXA 1PL1A 2P31A 1MDJA 1O8WA 2OACA 3M9JA 4GSTA 1O81A 5J4UA 3C73A 3ERWA 3Q18A 4HDEA 2L4QA 3TRQA 2F3MA 4KDXA 3LJRA 4RUVA 1FAAA 1NHYA 3KGKA 4GTUA 1THXA 3GMFA 2B1LA 1PL2A 4ECIA 4PX1A 1YDKA 3SBCA 3GN3A 1SKSB 4BVXB 2IL3A 1PN9A 1V58A 5D9TA 4PNFA 1TU7A 3TJFA 1B4QA 2B1KA 5ELAA 2VCVA 1T00A 4FO5A 1ERVA 4KE3A 3C8EA 1G6YA 3H1NA 1GTAA 1R26A 3QAVA 1NHOA 2H74A 2XPDA 4X43A 1SKRB 3RBTA 1NM3A 4E8HA 4EVMA 1SJZA 4TRXA 1W4VA 3KEBA 4MCUA 3HD5A 3D22A 4K9ZA 1Z6NA 2X8CA 3TJGA 4RQRA 2H70A 4WF5A 1VF1A 5GAPD 1UVZA 2HSHA 5FWGA 3WD6A 4XHMA 4TKYA 1SL0B 2WS2A 4YQMA 3QMXA 5B6MA 1OVNA 1SK2A 2G2QA 3A2XA 4KDUA 2GGTA 1XFLA 2MYGA 1O7UA 2VCWA 1N8JA 3WGEA 3PINA 3CTFA 4MPGA 4HQSA 4YAVA 4IBPA 2K8VA 2FLSA 3LXZA 4N0VA 3VWWA 3GRXA 5IOWA 1M9AA 3EYTA 1XVQA 1NSWA 3D6IA 3HHVA 4HZ2A 2IFQB 3M9KA 5ECLB 4KSOA 3ZMKA 2OBKA 1S3DA 1VRSD 1ZL9A 3F0IA 4ZBDA 2WULA 4F0CA 2ON5A 3DKSA 3DYRA 2IMEA 1V2AA 4I8BA 5IQYA 1F6MC 3VI5A 2H01A 3HVSA 1SJ6A 4JRRA 2F8FA 3KH7A 2QKEA 1A8YA 2RUEA 1IYIA 2LJRA 19GSA 4J56E 2HSNB 2JZRA 5D9WA 3VWXA 4CHSA 2B5EA 3PPUA 2WFCA 3DRNA 1DE1A 4YQVA 2YZUA 6GSWA 1A2LA 1G0TA 2A2SA 2CVBA 1EEMA 3L9SA 3FK8A 4ZL7A 1XXUA 2FA4A 1QXHA 4QL7A 4IW9A 3F4SA 1AQVA 4EDZA 2C3QA 1WE0A 2I4AA 4L5OA 1XIYA 4HS1A 1HNBA 4RQXA 1SJIA 4EO3A 2C0DA 1TI1A 2H6YA 3BBYA 1AUCA 2B6MA 2OA7A 3QR6A 4XS6A 4AF2A 4WKWA 3GKKA 2EIOA 2FHEA 1B4PA 3I69A 4Q5FA 3L9UA 3IBHA 3IOSA 3IDVA 1BQ7A 4QL9A 2FWHA 2HXKA 1TXXA 5FHIA 5DALA 3DXBA 1YKCA 1ZZYA 1ILOA 4Z7XA 4MK3A 2KLXA 4HJMA 4L0UA 3UMAA 1GSQA 2K9FA 2YJ7A 4POMA 1V57A 5H5RA 3GTUA 1V98A 4N11A 1SK1A 3TKSC 4IP6A 2N5FA 3QAGA 2FWFA 17GSA 1OE8A 4HJ2A 1EP8A 1O73A 2XBIA 4MA9A 3TKQA 3IK9A 3IE3A 3NOFA 1H75A 3UAPA 3KJYA 3G9BA 5DCHA 2R3XA 5DAKA 2MMNA 2QGVA 3G7YA 2KP2A 2P5RA 5HR2A 2NDOA 4BWSA 3ERFA 2E0QA 4MF5A 1GUMA 1U3IA 4WF4A 3IRAA 1R5AA 3ZFBA 2FUG2 4PQ1A 3ZZXA 2H30A 3UJ1A 2ALBA 5ELGA 2YV7A 3F3RA 4V1Ap 3LORA 5DVBA 1TJDA 1TTZA 2L6DA 4LMVA 4KGIA 1EWXA 5IPHA 1ON4A 1JZOA 5CREA 5E59A 1XWKA 5A4VA 3GH9A 5G2ZA 3FYGA 3HVVA 2JZTA 5G31A 4OFTA 3ZTLA 1GNEA 4JR6A 4EKZA 2CVDA 1XVWA 1PKZA 3CSHA 3RHBA 2JL4A 4TXOA 4OD7A 2BJXA 2KHPA 4POKA 2REMA 2ZNMA 3IAS2 1YJ6A 2LRTA 4TN8A 1XWBA 2KOKA 4MJBA 6GSSA 2V6OA 1GP1A 1DE2A 1RW1A 1CQGA 3F4RA 2LV3A 5G30A 2VCXA 3TOUA 2P5QA 3QAWA 3VPQA 2I9HA 3HZ8A 5F07A 5D8IA 2YNXA 1A2JA 8GSSA 3EC3A 5AN1A 3TOTA 6GSVA 2BMXA 3GKXA 6GSYA 3KMNA 2VCQA 2VUPA 3LEFA 4K7IA 5ECIB 4EE0A 20GSA 4IELA 2L57A 5HR3A 4G2EA 3PGTA 4MDCA 3ZFLA 3QCPA 2O8VB 2VL2C 2PVQA 1AW9A 3TDGA 1GTUA 1ML6A 5A4WA 3R2QA 5F06A 3EU3A 2H72A 5JCGA 1YEPA 2JSZA 1K0CA 4N10A 1M2DA 1OC9A 22GSA 4IGJA 5H5QA 3GL3A 1VGLA 4AGSA 4WXTA 3P2AA 2I81A 3KD0A 3H79A 3E3EA 3ZREA 1VF3A 4N0ZA 5KN3A 2ON7A 4KW6A 3RAZA 3F63A 1Z3EA 3TCOA 2V41A 2NTOA 1UC7A 1T3BA 2FWGA 4KUNA 4RI7A 1B9YC 5LNKe 5GZZB 2A2RA 2FY6A 5BMUA 1A0FA 1JZRA 2YP6A 2HYXA 1QUWA 4BA7A 3LG6A 2QSIA 3E0UA 4MJEA 5HFKA 4AJ6A 4JBBA 1GSDA 4JU5A 3UL3A 3F4TA 3MNGA 2C0EA 3VURA 1F2EA 2L4CA 3CMIA 1LJRA 1RK4A 3DVWA 2OE3A 1FHEA 1SD8A 4GWRA 3FW2A 2JSYA 1ACVA 5IPGA 2GSSA 3UIWA 1GSYA 2CA8A 5HR1A 1MD4A 4ZB8A 5IOXA 1OKDA 3QD9A 4MZWA 1LU4A 18GSA 1XOAA 3ZITA 3EE2A 2MMZA 4YQUA 3GX0A 5A4UA 2MBSA 1FW1A 3VWVA 4MLYA 1BEDA 1SD9A 3FZ5A 5INYA 2H19A 1DUGA 1K0AA 3F6FA 3NIVA 1XWCA 3GSTA 3GV1A 4OCEA 2DJJA 3IK7A 1GSEA 1JLWA 5ECOB 2K6VA 2RLIA 2VAFA 2H0HA 1B8XA 3FR3A 1K0DA 4KB3A 1E6BA 2H1AA 3I43A 4KX4A 1T4ZA 3UEMA 1MDIA 2CT6A 4MABA 3MAKA 5F8BA 1YQ1A 3VWUA 2AYTA 1E2YA 4X0XA 2OE1A 2RM5A 3A3TA 3HJOA 1K3YA 3GKMA 3LSZA 2RIIA 4G19A 3D4MA 1JFUA 2YANA 2PWJA 2E2GA 1K3LA 4HI7A 2HRAA 1GWCA 1XW9A 1TKDB 5KN2A 3CSIA 2L59A 4FYUA 4OCFA 2TRCP 1X9SB 3HYPA 4K0NA 3LFLA 1QK8A 2HT9A 1GSSA 2HE3A 4GCIA 2JACA 5ENUA 4K2DA 3GA4A 2B3SA 1TDIA 3M0FA 3TJKA 10GSA 5ID2B 3CRTA 3FHKA 5DALB 4KCAA 3CRUA 4ECJA 2VLVA 2F51A 4ZILA 2GSTA 5IM9A 2D2ZA 3GTUB 1URMA 1TRSA 4YAPA 2O89A 4XRAA 5A5KA 2PUKC 1TOFA 9GSSA 1YF1A 5DAKB 4K1FA 1TRWA 5GAND 2IMDA 1K0BA 2B7KA 2B5XA 4HU9A 3RPPA 3IV4A 2DLXA 1GRXA 4GF0A 3IR4A 3GYKA 4ILFA 4TR3A 3KP8A 5CAXA 1WIKA 3PR8A 5G1KA 1B48A 1V9WA 14GSA 3L0HA 2RUFA 4J2FA 4HUAA 2R4VA 5CRDA 2LUSA 3O76A 5HR0A 5CRHA 4JE1A 2VIMA 5DQYA 4IVFA 5ECRB 1OAZA 1Z6MA 4TXOB 4ULXA
chains in the Genus database with same CATH superfamily
2KP1A 2H76A 2VCZA 2HZEA 3IHGA 4OFNA 3GSSA 4MJAA 4AKIA 3I9V2 4PUFC 2G0FA 3P7XA 2H1LA 2JZSA 5L71A 1X5CA 5ECMB 1ST9A 3VI7A 1C72A 4KF9A 4G0KA 4K2XA 2MMOA 2VLUA 5IMCA 3ZMLA 3EMXA 5AIVA 1SVLA 3EPTA 1BYEA 2JADA 2EFEA 4MPFA 3K8NA 5JWOB 4XIHA 1SK0A 2A4VA 3RHCA 1R4WA 1S3CA 3DIEA 5D73A 4ZBAA 1PFOA 3ZLPA 1T8EB 2IPAA 1X5DA 5EY6A 5IMZA 3VK9A 2K8SA 4WR5A 3HDCA 1EP7A 2H1DA 2AAWA 2CAIA 3GURA 1OC9B 2XBQA 4IQ1A 3LWAA 3KH9A 2H1BA 4WR4A 4EXJA 2YWNA 5EL8A 2LSTA 4F03A 4ISDA 1JZWA 3UARA 2H6XA 1OE7A 2LNTA 3L78A 3FZ9A 4MH3A 1YY7A 2CX4A 4O5RA 2DBCA 2PN8A 2CQ9A 3DEXA 3WGXA 1WOUA 5BMUB 2QC7A 2HZFA 5ID2A 1X9MB 1M3IA 3HA9A 1ZCPA 3HJMA 3LQ7A 4FYBA 3KP9A 2FA8A 5DJLA 1XZOA 2MZCA 3KM6A 5FT3A 3NZNA 1F3BA 3WYWA 2VCTA 2O7KA 2F9SA 4GQFA 1AQXA 3GL5A 3BD2A 2GS3A 4MH2A 4MZCA 3FKFA 1VF2A 2O85A 1GLQA 3IC8A 1JLVA 2HRNA 2IWTA 3DGQA 4I6XA 3ERGA 4ZB6A 3M1GA 2OADA 5J4VA 5HFIA 2F8AA 3GIXA 1GLPA 2O87A 1KNGA 2DJ3A 2DIYA 4HU7A 1BG5A 2WW2A 3U6VA 2GZZA 1X5EA 1BJXA 4V2NA 2DIZA 5A5HB 4P3YB 4D73A 4PI0C 2PVOC 2GQKA 4DSSA 2GQMA 2H1GA 1LBKA 4Z2RA 1PKWA 3DVXA 3APQA 2YN1A 1O6JA 4V2MA 4BVYA 2WW0A 4DEJA 5IMVA 1ZYPA 2CZ3A 2ZCTA 2OJLA 2C8UA 3IHQA 4NXIA 2V2GA 1ZYQB 2PERA 4IKHA 1M0UA 4TR1B 1PGTA 2LTKA 2GZPA 3EMPA 4IN0A 2HNLA 4HOJA 1QQ2A 2DJ1A 1EZKA 4GSNA 3KMOA 4JEDA 3GFKA 3VLNA 3R3EA 2NVLA 1TK0B 3GNJA 1EV4A 5ECNB 2YWIA 2X4AA 1ABAA 3C1RA 4PURA 3CQFA 1XWAA 1BG1A 5KN1A 1AXDA 2OT3A 2H71A 3CSJA 1GH2A 2GT5A 4I2UA 3H8QA 3FZ4A 3WGDA 3KIJA 2X8GA 3ZL5A 1XCCA 1AAZA 3QFBC 2CVKA 4MMMA 2C0FA 1WWJA 1PX7A 4EF0A 1M3JA 2E7PA 3S9FA 4OWYA 2OKAA 4OFMA 4LMWA 2WZ9A 1XBSA 4EUYA 16GSA 3TKPA 2UV8G 3D0ZA 4NPBA 4NV2A 4YH2A 2C0GA 3E9JB 3TB2A 2HLSA 1J9BA 2VLTA 2WVYA 3APSA 3D4TA 1KEBA 5B6NA 4ZBBA 1GSUA 1SL2B 4Q5RA 1XOBA 4I2TA 3GH6A 3P90A 1PMTA 2I3YA 3ZRDA 4OO5A 2VO4A 5A1NA 4O7HA 4A5PA 4KNDA 3WT1A 4LL1B 4L0WA 3TJJA 4TXVA 2FWEA 2HRKA 2L5OA 1OKTA 2PPTA 5DJMA 5G1LA 2DMLA 5D96A 3D5JA 1Z7PA 1PSQA 3US3A 3CWGA 1Z5YE 1A8LA 5HFGA 2K18A 4XCSA 3TKSA 4Z2UA 2EFDA 2E2MA 3HMJG 1ZOFA 3ZYWA 1QGVA 4YKFA 3KXOA 3EU4A 3ED3A 2HZEB 1ZGNA 2MBTA 4ICYA 4GXZA 5B7CA 1K0NA 2FGXA 5J4YA 2O5VA 2ES7A 1TK5B 1Z9HA 4K7OA 2L6CA 2LNSA 2M80A 1V40A 3W6GA 2XPEA 1M9BA 5IMDA 1TU8A 2ZUPA 2YV9A 4F0BA 4KH7A 2GZYA 2AJQB 5CYYA 3HKRA 3LYKA 1QFNA 3A5WA 3N9JA 4TR1A 2IN3A 3RGBC 3M8NA 1GUKA 3G7JA 4MF6A 3W8SA 4Q5NA 4IHUA 3BOAA 5G5FA 4HQZA 2CZ2A 5C04A 4CW9A 2UZ8A 1FVKA 3KTLA 4WEYA 4PNGA 1R5PA 1GTBA 2OE0A 1XG8A 4NWYA 5IIZA 3W8JA 2R2JA 2IMFA 5CRGA 1AIUA 2WZSA 3LGCA 4WETA 2WDUA 1Y6EA 5IO2A 4CY6A 2LEGA 4PQHA 4GDFA 4TR0A 3MSZA 4CDOA 2PGTA 1U88A 3H4KA 2YOIA 3BCKA 4PUAA 3C7MA 3FMWA 3N5OA 1XW5A 3FR6A 4O5QA 3F9UA 3QPMA 5CNWA 2YCDA 1PX6A 3QFAC 1YF0A 2VL2A 1J0FA 4KDYA 2WCIA 4K5RA 1FOVA 3CYNA 2VD0A 4RI6A 4H86A 1SL1B 2YWMA 1TRUA 2C3NA 7GSSA 2HQTA 1EEJA 2EIRA 3HZ4A 3FEUA 4GSSA 5JWRB 1ERTA 1I9DA 4HSCX 4BPYA 1X9WB 5GSTA 2V1MA 3HCZA 4J57E 2LQQA 2DMMA 1F9MA 2BTOT 1FO5A 1HNAA 4BL7A 2HRFA 4PXOA 3IXRA 5ABRA 1T4YA 5AGYA 1EOHA 1YKAA 2AUVA 4IJ3A 3ZIJA 1A2MA 3HJPA 4V2LA 3GUSA 3TUEA 5HQPA 4NMUA 1W89A 1EGRA 2H73A 5B8AA 2B5YA 2CV4A 4PTSA 4TVEA 4NAXA 1G6WA 4D73B 5GSSA 3APOA 4O92A 4DSSB 2WVXA 5KN0A 4K7NA 3GHAA 3TJBA 3ME7A 4HZ4A 4JZQA 3ZIVA 3RPNA 4IQAA 2VL3A 3DD3A 2P0GA 4BVYB 4POBA 4WBJA 5EVOA 3I6AA 2V6KA 4LA1A 3QOUA 3CTGA 1SVOA 1GNWA 4X1UA 3MWHA 2RM6A 3OR5A 3TKRA 1XPVA 4FYCA 2VD1A 4E68A 5D93A 3EINA 4K8MA 1K3OA 5DDLA 3DMLA 4XS4A 3F8UA 3EURA 2NPBA 3ZVJA 5J47A 1GTIA 1HQOA 2MMAA 1TK8B 2B7JA 3M3MA 5EPFA 4FIWA 1O8XA 3ZVJD 4I97A 2GT6A 5CO3A 4MZBA 4O32A 2EIQA 4ZIJA 3FY7A 3IA1A 3AY8A 2HSMB 2GTUA 3L4NA 2YWOA 1RQMA 1Q4JA 4ML1A 4OO4A 1WMJA 5D9XA 4DSQA 2VOCA 6GSXA 3KTBA 3HVXA 1THOA 1ERWA 2HSYA 1M2AA 3U5RE 3TKSE 2HI7A 3FZAA 4G0LA 5COHA 1ZYEA 4NHZA 1O85A 4G0IA 1MD3A 1J08A 3F3QA 1Q98A 4EL1A 1SKWB 3CHXC 3CXGA 1WP0A 2AHEA 1ZMAA 4XRDA 5H5SA 3P8WA 4TW5A 2JU5A 4ID0A 2GSQA 1G7OA 1GSFA 1GULA 2CX3A 1U3AA 4DSRA 1NW2A 1OC8A 3UVTA 1CQHA 2DJ0A 4BVXA 5J3RA 4IP1A 3PH9A 2LJAA 1HNCA 5J41A 1EGOA 11GSA 2FD3A 3L9VA 1XW6A 1QMVA 3O3TA 4PGTA 1DBYA 4EC0A 2DSAA 3BJ5A 4K0GA 5A1NB 5F05A 4K6XA 1YZXA 3HY2A 3EWLA 2R6KA 3TGZA 4AJ7A 1KTEA 1A24A 2HRKB 1SYRA 4ECBA 1A0RP 2LS5A 6GSUA 4QQ7A 2V32A 4F82A 3TRXA 5CRWA 1SVMA 3EVIA 1YEXA 1N2AA 5G5EA 3C1SA 4KA0A 2TIRA 1EOGA 1SU9A 2DKIA 1KBNA 1TP9A 4MNNA 2H0IA 4ACSA 2GVPA 2IIYA 5J9BA 1TW9A 5J5NA 5CP1A 3V1WA 1HD2A 4GLTA 2XC2A 4NV5A 1GL8A 2FCHA 3MDKA 2XHFA 2N5BA 4XS1A 3UOMA 2FNOA 4LL4B 1UA5A 4FQUA 4V1Ag 2M46A 1HYUA 2LKUA 1XWGA 2R5GA 1FG4A 1G7EA 2R37A 4DVCA 5J40A 4L8EA 1WRYA 3C71A 3HXSA 3H93A 2DC5A 2X8HA 3KZQA 1U87A 4GQCA 2DJKA 2AV4A 2C1YA 5AISA 2NBSA 2M72A 1EV9A 1MEKA 5IO0A 1DSBA 1U6TA 4F2IA 4MP4A 12GSA 3IAM2 2X99A 3RDWA 13GSA 4ZXGA 2X64A 2IFQA 3ISOA 2O3EA 1WJKA 3A2WA 2PU9C 4IS0A 5ECQB 3IPZA 5J9CA 1F37A 1MDKA 1FB6A 5DCGA 5KEJA 1H4OA 2HFDA 1VF4A 3BCIA 1JZDA 1UN2A 5JWQB 4FXYP 1N25A 4ZL8A 5IMAA 4KSMA 2AB6A 2HSMA 4PQIA 5DBQA 3Q74A 1SENA 2Z9SA 4ML6A 2PBJA 4ZB9A 2WGRA 5E4WA 2J9HA 2TRXA 2H6ZA 1K0OA 1I5GA 4KCEA 2PMTA 2WRTA 3G7IA 3FR9A 5JCUA 2L5LA 2DJ2A 1FVJA 4E8EA 4EDYA 3Q6OA 3UBLA 4PI2C 1MTCA 1R7HA 1WPIA 1JHBA 1OYJA 2KUCA 4HEA2 5D9VA 3D21A 4Q5QA 4BIKA 2IMKA 3LXTA 5F0GA 5LD0A 2YPMA 4MF7A 2LJKA 3VPTA 4AJ8A 1IYHA 2OBIA 3GX8A 3KCMA 4L5LA 2VL9A 3DWVA 1F3AA 4ZL9A 4ECCA 1OC3A 2YZHA 5ECPB 4OMVA 2GLRA 4BL7B 3A2VA 2H75A 4F9ZA 5B8BA 1FB0A 2C80A 3CBUA 1PD21 4TOPA 1PA3A 3LYPA 1M7TA 4BWQA 1A23A 3ME8A 1PQNA 4N30A 5C00A 2LRNA 3QDNA 1M99A 1BAYA 5ECKB 1TXUA 3SWLA 2H66A 5LCZA 2H8LA 2J23A 4I5QA 3J7Yk 2LRCA 4G10A 2WB9A 2WVXB 2N5AA 1GUHA 4G9HA 5KOWA 5JCWA 2WJUA 4AKGA 4NHWA 5ECSA 1ERUA 4LLRA 1K0MA 1X0RA 2VM2A 3O6TA 4MJCA 4USSA 4TR4A 3J7Yb 2LQOA 3IC4A 5ECHB 3TRPA 3VFIA 2VM1A 2YJHA 2GQLA 1M2BA 3UVHA 1PRXA 2I1UA 4GRFA 2CAQA 1T7PB 1BX9A 2C3TA 1YEWC 4XS4B 1SYXA 4JR4A 1Y25A 4IJIA 1T1VA 2IMIA 3Q19A 1Z7RA 4POLA 1TI3A 1S3AA 1TRVA 4KAEA 1AC1A 1USBA 6GSTA 2IJYA 5DQSA 3F6DA 4FH8A 1B9XC 4WBRD 2H0GA 3UBKA 3WT2A 4XTSA 2GSRA 2EC4A 2C4JA 5IMFA 3FRCA 3GKNA 1AQWA 3JCML 2GDRA 5AIXA 1PL1A 2P31A 1MDJA 1O8WA 2OACA 3M9JA 4GSTA 1O81A 5J4UA 3C73A 3ERWA 3Q18A 4HDEA 2L4QA 3TRQA 2F3MA 4KDXA 1S3RA 3LJRA 4RUVA 1FAAA 1NHYA 3KGKA 4GTUA 1THXA 3GMFA 2B1LA 1PL2A 4ECIA 4PX1A 1YDKA 3SBCA 3GN3A 1SKSB 3A5IA 4BVXB 2IL3A 1PN9A 1V58A 5D9TA 4PNFA 1TU7A 3TJFA 1B4QA 2B1KA 5ELAA 2VCVA 1T00A 4FO5A 1ERVA 3MYDA 4KE3A 3C8EA 2EFHA 1G6YA 3H1NA 1GTAA 1R26A 3QAVA 1NHOA 2H74A 2XPDA 4X43A 1SKRB 3RBTA 1NM3A 4E8HA 4EVMA 1SJZA 4TRXA 1W4VA 3KEBA 4MCUA 3HD5A 3D22A 4K9ZA 2A4HA 1Z6NA 2X8CA 3TJGA 4RQRA 2H70A 4WF5A 2X49A 1VF1A 5GAPD 1UVZA 2HSHA 5FWGA 3WD6A 4XHMA 4TKYA 1SL0B 2WS2A 4YQMA 3QMXA 5B6MA 1OVNA 1SK2A 2G2QA 3A2XA 4KDUA 2GGTA 1XFLA 2MYGA 1O7UA 2VCWA 1N8JA 3WGEA 3PINA 3CTFA 4MPGA 4HQSA 4YAVA 4IBPA 2K8VA 2FLSA 3LXZA 4N0VA 3VWWA 3GRXA 5IOWA 1M9AA 3EYTA 1XVQA 1NSWA 3D6IA 3HHVA 4HZ2A 2IFQB 3M9KA 5ECLB 4KSOA 3ZMKA 2OBKA 1S3DA 1VRSD 1ZL9A 3F0IA 4ZBDA 2WULA 4F0CA 2ON5A 3DKSA 3DYRA 2IMEA 1V2AA 4I8BA 5IQYA 1F6MC 3VI5A 2H01A 3HVSA 1SJ6A 4JRRA 2F8FA 3KH7A 2QKEA 2DKHA 1A8YA 2RUEA 3HVNA 1IYIA 2LJRA 19GSA 4J56E 2HSNB 2JZRA 5D9WA 3VWXA 4CHSA 2B5EA 3PPUA 2WFCA 4EIPA 5A34A 4N3ZA 2R0GA 3DRNA 1DE1A 4YQVA 2YZUA 6GSWA 4AI6A 1A2LA 1G0TA 2A2SA 2CVBA 1EEMA 3L9SA 3FK8A 4ZL7A 1XXUA 2FA4A 1QXHA 4QL7A 4IW9A 3F4SA 1AQVA 4EDZA 2C3QA 1WE0A 2I4AA 4L5OA 1XIYA 4HS1A 1HNBA 4RQXA 1SJIA 4EO3A 2C0DA 1TI1A 2H6YA 3BBYA 1AUCA 2B6MA 2OA7A 3QR6A 4XS6A 4AF2A 4WKWA 2A2PA 3GKKA 2EIOA 2FHEA 1B4PA 3I69A 4Q5FA 3L9UA 1S4BP 3IOSA 3IBHA 3IDVA 1BQ7A 2R0CA 4QL9A 2FWHA 2HXKA 1TXXA 1BF5A 5FHIA 4Z2TA 5DALA 3DXBA 1YKCA 1ZZYA 1ILOA 4Z7XA 4MK3A 2KLXA 4HJMA 4L0UA 4O5UA 3UMAA 1GSQA 2K9FA 2YJ7A 4POMA 1V57A 4X4JA 5H5RA 3GTUA 1V98A 4N11A 1SK1A 3TKSC 4IP6A 2N5FA 3QAGA 2FWFA 17GSA 1OE8A 1YVLA 4HJ2A 1EP8A 1Y1UA 1O73A 2XBIA 4MA9A 3TKQA 3IK9A 3IE3A 3NOFA 1H75A 3UAPA 3KJYA 3G9BA 5DCHA 2R3XA 5DAKA 2MMNA 2QGVA 3G7YA 2KP2A 2P5RA 5HR2A 2EFCA 2NDOA 4BWSA 3ERFA 2VKZG 4QMKA 2E0QA 4MF5A 1GUMA 1U3IA 4WF4A 3IRAA 1R5AA 3ZFBA 2FUG2 4PQ1A 3ZZXA 2H30A 3UJ1A 2ALBA 5ELGA 2YV7A 3F3RA 4V1Ap 3LORA 5DVBA 1TJDA 1TTZA 2L6DA 4LMVA 4KGIA 1EWXA 5IPHA 1ON4A 1JZOA 5CREA 5E59A 2R0PA 1XWKA 5A4VA 3GH9A 5G2ZA 3FYGA 3HVVA 1I1IP 2JZTA 5G31A 4OFTA 4W66A 3ZTLA 4AKHA 1GNEA 4JR6A 4EKZA 2CVDA 1XVWA 1PKZA 3CSHA 3RHBA 2JL4A 4TXOA 4OD7A 2BJXA 2KHPA 4POKA 2REMA 2ZNMA 3IAS2 1YJ6A 2LRTA 4TN8A 1XWBA 2KOKA 4MJBA 6GSSA 2V6OA 1GP1A 1DE2A 1RW1A 1CQGA 3F4RA 2LV3A 5G30A 2VCXA 3TOUA 2P5QA 3QAWA 3VPQA 2I9HA 3HZ8A 5F07A 5D8IA 2YNXA 1A2JA 2HSNA 8GSSA 3EC3A 5AN1A 3TOTA 2WW1A 6GSVA 2BMXA 3GKXA 6GSYA 2QA2A 3KMNA 2VCQA 2VUPA 3LEFA 4K7IA 5ECIB 4EE0A 20GSA 4IELA 3LW9A 2L57A 5HR3A 4G2EA 3PGTA 4MDCA 3ZFLA 3QCPA 2O8VB 2VL2C 2PVQA 1AW9A 3TDGA 1GTUA 1ML6A 5A4WA 3R2QA 5F06A 3EU3A 2H72A 5JCGA 1YEPA 2JSZA 1K0CA 4N10A 1M2DA 1OC9A 22GSA 4IGJA 5H5QA 3GL3A 1VGLA 4AGSA 4WXTA 5KOXA 3P2AA 2I81A 3KD0A 3H79A 3E3EA 3ZREA 1VF3A 4N0ZA 5KN3A 2ON7A 4KW6A 3RAZA 3F63A 1Z3EA 3TCOA 2V41A 2NTOA 1UC7A 1T3BA 2FWGA 4KUNA 4RI7A 1B9YC 5LNKe 5GZZB 2A2RA 2FY6A 5BMUA 1A0FA 1JZRA 2YP6A 2HYXA 1QUWA 4BA7A 3LG6A 2QSIA 3E0UA 2O36A 4MJEA 5HFKA 4AJ6A 4JBBA 1GSDA 4JU5A 3UL3A 3F4TA 3MNGA 2C0EA 3VURA 1F2EA 2L4CA 3CMIA 1LJRA 5BRTA 1RK4A 3DVWA 2OE3A 1FHEA 1SD8A 4GWRA 3FW2A 2JSYA 1ACVA 5IPGA 2GSSA 3UIWA 1GSYA 2CA8A 5HR1A 1MD4A 4ZB8A 5IOXA 1OKDA 3QD9A 4MZWA 2WVZA 1LU4A 18GSA 1XOAA 4YKGA 3ZITA 3EE2A 2MMZA 4YQUA 3GX0A 3MIXA 5A4UA 2MBSA 1FW1A 3VWVA 5A5HA 4MLYA 4K5SA 1BEDA 1SD9A 3FZ5A 5INYA 2H19A 1DUGA 1K0AA 3F6FA 3NIVA 1XWCA 3GSTA 4PHZC 3GV1A 4OCEA 2DJJA 3IK7A 1GSEA 1JLWA 5ECOB 2K6VA 2RLIA 2VAFA 2H0HA 1B8XA 3FR3A 1K0DA 5A34B 4KB3A 1E6BA 2H1AA 3I43A 4KX4A 1T4ZA 3UEMA 1MDIA 2CT6A 4MABA 3MAKA 5F8BA 1YQ1A 3VWUA 2AYTA 1E2YA 4X0XA 2OE1A 2RM5A 3A3TA 3HJOA 1K3YA 4CY8A 3GKMA 3LSZA 2RIIA 4G19A 3D4MA 1JFUA 2YANA 2PWJA 2E2GA 1K3LA 4HI7A 2HRAA 1GWCA 1XW9A 1TKDB 5KN2A 3CSIA 2L59A 4FYUA 4OCFA 2TRCP 1X9SB 3HYPA 4K0NA 3LFLA 1QK8A 2HT9A 1GSSA 2HE3A 4GCIA 2JACA 2WW3A 4G01A 5ENUA 4K2DA 3GA4A 2B3SA 1TDIA 3M0FA 3TJKA 10GSA 5ID2B 3CRTA 3FHKA 5DALB 1PN0A 4ZB7A 4KCAA 3CRUA 4ECJA 2VLVA 2F51A 4ZILA 2GSTA 5IM9A 1ZYNA 2D2ZA 3GTUB 1URMA 1TRSA 3RFRC 1FOHA 4YAPA 2O89A 4XRAA 5A5KA 2PUKC 1TOFA 9GSSA 1YF1A 5DAKB 4AKXB 4K1FA 1TRWA 5GAND 2IMDA 1K0BA 2B7KA 2B5XA 4HU9A 3RPPA 3IV4A 2DLXA 1GRXA 4GF0A 3IR4A 3GYKA 4ILFA 4TR3A 3KP8A 5CAXA 1WIKA 3PR8A 5G1KA 1B48A 1V9WA 14GSA 3TU3B 3L0HA 2RUFA 4J2FA 2QA1A 4HUAA 2R4VA 5CRDA 2LUSA 3O76A 5HR0A 5CRHA 4JE1A 2VIMA 5DQYA 4IVFA 4EIQA 5ECRB 1OAZA 1Z6MA 4TXOB 4ULXA
chains in the Genus database with same CATH topology
2KP1A 2H76A 2VCZA 2HZEA 3IHGA 4OFNA 3GSSA 4MJAA 4AKIA 3I9V2 4PUFC 2G0FA 3P7XA 2H1LA 2JZSA 5L71A 1X5CA 5ECMB 1ST9A 3VI7A 1C72A 4KF9A 4G0KA 4K2XA 2MMOA 2VLUA 5IMCA 3ZMLA 3EMXA 5AIVA 1SVLA 3EPTA 1BYEA 2JADA 2EFEA 4MPFA 3K8NA 5JWOB 4XIHA 1SK0A 2A4VA 3RHCA 1R4WA 1S3CA 3DIEA 5D73A 4ZBAA 3ZLPA 1T8EB 2IPAA 1X5DA 5EY6A 5IMZA 3VK9A 2K8SA 4WR5A 3HDCA 1EP7A 2H1DA 2AAWA 2CAIA 3GURA 1OC9B 2XBQA 4IQ1A 3LWAA 3KH9A 2H1BA 4WR4A 4EXJA 2YWNA 5EL8A 2LSTA 4F03A 4ISDA 1JZWA 3UARA 2H6XA 1OE7A 2LNTA 3L78A 3FZ9A 4MH3A 1YY7A 2CX4A 4O5RA 2DBCA 2PN8A 2CQ9A 3DEXA 3WGXA 1WOUA 5BMUB 2QC7A 2HZFA 5ID2A 1X9MB 3HA9A 1ZCPA 3HJMA 3LQ7A 4FYBA 3KP9A 2FA8A 5DJLA 1XZOA 2MZCA 3KM6A 5FT3A 3NZNA 1F3BA 3WYWA 2VCTA 2O7KA 2F9SA 4GQFA 1AQXA 3GL5A 3BD2A 2GS3A 4MH2A 4MZCA 3FKFA 1VF2A 2O85A 1GLQA 3IC8A 1JLVA 2HRNA 2IWTA 3DGQA 4I6XA 3ERGA 4ZB6A 3M1GA 2OADA 5J4VA 5HFIA 2F8AA 3GIXA 1GLPA 2O87A 1KNGA 2DJ3A 2DIYA 4HU7A 1BG5A 3U6VA 2GZZA 1X5EA 1BJXA 4V2NA 2DIZA 5A5HB 4P3YB 4D73A 2PVOC 2GQKA 4DSSA 2GQMA 2H1GA 1LBKA 4Z2RA 1PKWA 3DVXA 3APQA 2YN1A 1O6JA 4V2MA 4BVYA 4DEJA 5IMVA 1ZYPA 2CZ3A 2ZCTA 2OJLA 2C8UA 3IHQA 4NXIA 2V2GA 1ZYQB 2PERA 4IKHA 1M0UA 4TR1B 1PGTA 2LTKA 2GZPA 3EMPA 4IN0A 2HNLA 4HOJA 1QQ2A 2DJ1A 1EZKA 4GSNA 3KMOA 4JEDA 3GFKA 3VLNA 3R3EA 2NVLA 1TK0B 3GNJA 1EV4A 5ECNB 2YWIA 2X4AA 1ABAA 3C1RA 4PURA 1XWAA 1BG1A 5KN1A 1AXDA 2OT3A 2H71A 3CSJA 1GH2A 2GT5A 4I2UA 3H8QA 3FZ4A 3WGDA 3KIJA 2X8GA 3ZL5A 1XCCA 1AAZA 3QFBC 2CVKA 4MMMA 2C0FA 1WWJA 1PX7A 4EF0A 2E7PA 3S9FA 4OWYA 2OKAA 4OFMA 4LMWA 2WZ9A 1XBSA 4EUYA 16GSA 3TKPA 2UV8G 3D0ZA 4NPBA 4NV2A 4YH2A 2C0GA 3E9JB 3TB2A 2HLSA 1J9BA 2VLTA 3APSA 3D4TA 1KEBA 5B6NA 4ZBBA 1GSUA 1SL2B 4Q5RA 1XOBA 4I2TA 3GH6A 3P90A 1PMTA 2I3YA 3ZRDA 4OO5A 2VO4A 5A1NA 4O7HA 4A5PA 4KNDA 3WT1A 4LL1B 4L0WA 3TJJA 4TXVA 2FWEA 2HRKA 2L5OA 1OKTA 2PPTA 5DJMA 5G1LA 2DMLA 5D96A 3D5JA 1Z7PA 1PSQA 3US3A 3CWGA 1Z5YE 1A8LA 5HFGA 2K18A 4XCSA 3TKSA 4Z2UA 2EFDA 2E2MA 3HMJG 1ZOFA 3ZYWA 1QGVA 4YKFA 3KXOA 3EU4A 3ED3A 2HZEB 1ZGNA 2MBTA 4ICYA 4GXZA 5B7CA 1K0NA 2FGXA 5J4YA 2O5VA 2ES7A 1TK5B 1Z9HA 4K7OA 2L6CA 2LNSA 2M80A 1V40A 3W6GA 2XPEA 1M9BA 5IMDA 1TU8A 2ZUPA 2YV9A 4F0BA 4KH7A 2GZYA 2AJQB 5CYYA 3HKRA 3LYKA 1QFNA 3A5WA 3N9JA 4TR1A 2IN3A 3M8NA 1GUKA 3G7JA 4MF6A 3W8SA 4Q5NA 4IHUA 3BOAA 5G5FA 4HQZA 2CZ2A 5C04A 4CW9A 2UZ8A 1FVKA 3KTLA 4WEYA 4PNGA 1R5PA 1GTBA 2OE0A 4NWYA 5IIZA 3W8JA 2R2JA 2IMFA 5CRGA 1AIUA 3LGCA 4WETA 2WDUA 1Y6EA 5IO2A 4CY6A 2LEGA 4PQHA 4GDFA 4TR0A 3MSZA 4CDOA 2PGTA 1U88A 3H4KA 2YOIA 3BCKA 4PUAA 3C7MA 3FMWA 3N5OA 1XW5A 3FR6A 4O5QA 3F9UA 3QPMA 5CNWA 2YCDA 1PX6A 3QFAC 1YF0A 2VL2A 1J0FA 4KDYA 2WCIA 4K5RA 1FOVA 3CYNA 2VD0A 4RI6A 4H86A 1SL1B 2YWMA 1TRUA 2C3NA 7GSSA 2HQTA 1EEJA 2EIRA 3HZ4A 3FEUA 4GSSA 5JWRB 1ERTA 1I9DA 4BPYA 1X9WB 5GSTA 2V1MA 3HCZA 4J57E 2LQQA 2DMMA 1F9MA 2BTOT 1FO5A 1HNAA 4BL7A 2HRFA 4PXOA 3IXRA 5ABRA 1T4YA 5AGYA 1EOHA 1YKAA 2AUVA 4IJ3A 3ZIJA 1A2MA 3HJPA 4V2LA 3GUSA 3TUEA 5HQPA 4NMUA 1W89A 1EGRA 2H73A 5B8AA 2B5YA 2CV4A 4PTSA 4TVEA 4NAXA 1G6WA 4D73B 5GSSA 3APOA 4O92A 4DSSB 5KN0A 4K7NA 3GHAA 3TJBA 3ME7A 4HZ4A 4JZQA 3ZIVA 3RPNA 4IQAA 2VL3A 3DD3A 2P0GA 4BVYB 4POBA 4WBJA 5EVOA 3I6AA 2V6KA 4LA1A 3QOUA 3CTGA 1SVOA 1GNWA 4X1UA 3MWHA 2RM6A 3OR5A 3TKRA 1XPVA 4FYCA 2VD1A 4E68A 5D93A 3EINA 4K8MA 1K3OA 5DDLA 3DMLA 4XS4A 3F8UA 3EURA 2NPBA 3ZVJA 5J47A 1GTIA 1HQOA 2MMAA 1TK8B 2B7JA 3M3MA 5EPFA 4FIWA 1O8XA 3ZVJD 4I97A 2GT6A 5CO3A 4MZBA 4O32A 2EIQA 4ZIJA 3FY7A 3IA1A 3AY8A 2HSMB 2GTUA 3L4NA 2YWOA 1RQMA 1Q4JA 4ML1A 4OO4A 1WMJA 5D9XA 4DSQA 2VOCA 6GSXA 3KTBA 3HVXA 1THOA 1ERWA 2HSYA 1M2AA 3U5RE 3TKSE 2HI7A 3FZAA 4G0LA 5COHA 1ZYEA 4NHZA 1O85A 4G0IA 1MD3A 1J08A 3F3QA 1Q98A 4EL1A 1SKWB 3CXGA 1WP0A 2AHEA 1ZMAA 4XRDA 5H5SA 3P8WA 4TW5A 2JU5A 4ID0A 2GSQA 1G7OA 1GSFA 1GULA 2CX3A 1U3AA 4DSRA 1NW2A 1OC8A 3UVTA 1CQHA 2DJ0A 4BVXA 5J3RA 4IP1A 3PH9A 2LJAA 1HNCA 5J41A 1EGOA 11GSA 2FD3A 3L9VA 1XW6A 1QMVA 3O3TA 4PGTA 1DBYA 4EC0A 2DSAA 3BJ5A 4K0GA 5A1NB 5F05A 4K6XA 1YZXA 3HY2A 3EWLA 2R6KA 3TGZA 4AJ7A 1KTEA 1A24A 2HRKB 1SYRA 4ECBA 1A0RP 2LS5A 6GSUA 4QQ7A 2V32A 4F82A 3TRXA 5CRWA 1SVMA 3EVIA 1YEXA 1N2AA 5G5EA 3C1SA 4KA0A 2TIRA 1EOGA 1SU9A 2DKIA 1KBNA 1TP9A 4MNNA 2H0IA 4ACSA 2GVPA 2IIYA 5J9BA 1TW9A 5J5NA 5CP1A 3V1WA 1HD2A 4GLTA 2XC2A 4NV5A 1GL8A 2FCHA 3MDKA 2XHFA 2N5BA 4XS1A 3UOMA 2FNOA 4LL4B 1UA5A 4FQUA 4V1Ag 2M46A 1HYUA 2LKUA 1XWGA 2R5GA 1FG4A 1G7EA 2R37A 4DVCA 5J40A 4L8EA 1WRYA 3C71A 3HXSA 3H93A 2DC5A 2X8HA 3KZQA 1U87A 4GQCA 2DJKA 2AV4A 2C1YA 5AISA 2NBSA 2M72A 1EV9A 1MEKA 5IO0A 1DSBA 1U6TA 4F2IA 4MP4A 12GSA 3IAM2 2X99A 3RDWA 13GSA 4ZXGA 2X64A 2IFQA 3ISOA 1WJKA 3A2WA 2PU9C 4IS0A 5ECQB 3IPZA 5J9CA 1F37A 1MDKA 1FB6A 5DCGA 5KEJA 1H4OA 2HFDA 1VF4A 3BCIA 1JZDA 1UN2A 5JWQB 1N25A 4ZL8A 5IMAA 4KSMA 2AB6A 2HSMA 4PQIA 5DBQA 3Q74A 1SENA 2Z9SA 4ML6A 2PBJA 4ZB9A 2WGRA 5E4WA 2J9HA 2TRXA 2H6ZA 1K0OA 1I5GA 4KCEA 2PMTA 2WRTA 3G7IA 3FR9A 5JCUA 2L5LA 2DJ2A 1FVJA 4E8EA 4EDYA 3Q6OA 3UBLA 1R7HA 1MTCA 1WPIA 1JHBA 1OYJA 2KUCA 4HEA2 5D9VA 3D21A 4Q5QA 2IMKA 3LXTA 5F0GA 5LD0A 2YPMA 4MF7A 2LJKA 3VPTA 4AJ8A 1IYHA 2OBIA 3GX8A 3KCMA 4L5LA 2VL9A 3DWVA 1F3AA 4ZL9A 4ECCA 1OC3A 2YZHA 5ECPB 4OMVA 2GLRA 4BL7B 3A2VA 2H75A 4F9ZA 5B8BA 1FB0A 2C80A 3CBUA 1PD21 4TOPA 1PA3A 3LYPA 1M7TA 4BWQA 1A23A 3ME8A 1PQNA 4N30A 5C00A 2LRNA 3QDNA 1M99A 1BAYA 5ECKB 1TXUA 3SWLA 2H66A 5LCZA 2H8LA 2J23A 4I5QA 3J7Yk 2LRCA 4G10A 2WB9A 2N5AA 1GUHA 4G9HA 5KOWA 5JCWA 2WJUA 4AKGA 4NHWA 5ECSA 1ERUA 4LLRA 1K0MA 1X0RA 2VM2A 3O6TA 4MJCA 4USSA 4TR4A 3J7Yb 2LQOA 3IC4A 5ECHB 3TRPA 3VFIA 2VM1A 2YJHA 2GQLA 1M2BA 3UVHA 1PRXA 2I1UA 4GRFA 2CAQA 1T7PB 1BX9A 2C3TA 4XS4B 1SYXA 4JR4A 1Y25A 4IJIA 1T1VA 2IMIA 3Q19A 1Z7RA 4POLA 1TI3A 1S3AA 1TRVA 4KAEA 1AC1A 1USBA 6GSTA 2IJYA 5DQSA 3F6DA 4FH8A 1B9XC 4WBRD 2H0GA 3UBKA 3WT2A 4XTSA 2GSRA 2EC4A 2C4JA 5IMFA 3FRCA 3GKNA 1AQWA 3JCML 2GDRA 5AIXA 1PL1A 2P31A 1MDJA 1O8WA 2OACA 3M9JA 4GSTA 1O81A 5J4UA 3C73A 3ERWA 3Q18A 4HDEA 2L4QA 3TRQA 2F3MA 4KDXA 3LJRA 4RUVA 1FAAA 1NHYA 3KGKA 4GTUA 1THXA 3GMFA 2B1LA 1PL2A 4ECIA 4PX1A 1YDKA 3SBCA 3GN3A 1SKSB 3A5IA 4BVXB 2IL3A 1PN9A 1V58A 5D9TA 4PNFA 1TU7A 3TJFA 1B4QA 2B1KA 5ELAA 2VCVA 1T00A 4FO5A 1ERVA 3MYDA 4KE3A 3C8EA 2EFHA 1G6YA 3H1NA 1GTAA 1R26A 3QAVA 1NHOA 2H74A 2XPDA 4X43A 1SKRB 3RBTA 1NM3A 4E8HA 4EVMA 1SJZA 4TRXA 1W4VA 3KEBA 4MCUA 3HD5A 3D22A 4K9ZA 2A4HA 1Z6NA 2X8CA 3TJGA 4RQRA 2H70A 4WF5A 2X49A 1VF1A 5GAPD 1UVZA 2HSHA 5FWGA 3WD6A 4XHMA 4TKYA 1SL0B 2WS2A 4YQMA 3QMXA 5B6MA 1OVNA 1SK2A 2G2QA 3A2XA 4KDUA 2GGTA 1XFLA 2MYGA 1O7UA 2VCWA 1N8JA 3WGEA 3PINA 3CTFA 4MPGA 4HQSA 4YAVA 4IBPA 2K8VA 2FLSA 3LXZA 4N0VA 3VWWA 3GRXA 5IOWA 1M9AA 3EYTA 1XVQA 1NSWA 3D6IA 3HHVA 4HZ2A 2IFQB 3M9KA 5ECLB 4KSOA 3ZMKA 2OBKA 1S3DA 1VRSD 1ZL9A 3F0IA 4ZBDA 2WULA 4F0CA 2ON5A 3DKSA 3DYRA 2IMEA 1V2AA 4I8BA 5IQYA 1F6MC 3VI5A 2H01A 3HVSA 1SJ6A 4JRRA 2F8FA 3KH7A 2QKEA 2DKHA 1A8YA 2RUEA 1IYIA 2LJRA 19GSA 4J56E 2HSNB 2JZRA 5D9WA 3VWXA 4CHSA 2B5EA 3PPUA 2WFCA 4EIPA 5A34A 4N3ZA 2R0GA 3DRNA 1DE1A 4YQVA 2YZUA 6GSWA 4AI6A 1A2LA 1G0TA 2A2SA 2CVBA 1EEMA 3L9SA 3FK8A 4ZL7A 1XXUA 2FA4A 1QXHA 4QL7A 4IW9A 3F4SA 1AQVA 4EDZA 2C3QA 1WE0A 2I4AA 4L5OA 1XIYA 4HS1A 1HNBA 4RQXA 1SJIA 4EO3A 2C0DA 1TI1A 2H6YA 3BBYA 1AUCA 2B6MA 2OA7A 3QR6A 4XS6A 4AF2A 4WKWA 2A2PA 3GKKA 2EIOA 2FHEA 1B4PA 3I69A 4Q5FA 3L9UA 3IBHA 3IOSA 3IDVA 1BQ7A 2R0CA 4QL9A 2FWHA 2HXKA 1TXXA 1BF5A 5FHIA 4Z2TA 5DALA 3DXBA 1YKCA 1ZZYA 1ILOA 4Z7XA 4MK3A 2KLXA 4HJMA 4L0UA 4O5UA 3UMAA 1GSQA 2K9FA 2YJ7A 4POMA 1V57A 4X4JA 5H5RA 3GTUA 1V98A 4N11A 1SK1A 3TKSC 4IP6A 2N5FA 3QAGA 2FWFA 17GSA 1OE8A 1YVLA 4HJ2A 1EP8A 1Y1UA 1O73A 2XBIA 4MA9A 3TKQA 3IK9A 3IE3A 3NOFA 1H75A 3UAPA 3KJYA 3G9BA 5DCHA 2R3XA 5DAKA 2MMNA 2QGVA 3G7YA 2KP2A 2P5RA 5HR2A 2EFCA 2NDOA 4BWSA 3ERFA 2VKZG 4QMKA 2E0QA 4MF5A 1GUMA 1U3IA 4WF4A 3IRAA 1R5AA 3ZFBA 2FUG2 4PQ1A 3ZZXA 2H30A 3UJ1A 2ALBA 5ELGA 2YV7A 3F3RA 4V1Ap 3LORA 5DVBA 1TJDA 1TTZA 2L6DA 4LMVA 4KGIA 1EWXA 5IPHA 1ON4A 1JZOA 5CREA 5E59A 2R0PA 1XWKA 5A4VA 3GH9A 5G2ZA 3FYGA 3HVVA 2JZTA 5G31A 4OFTA 4W66A 3ZTLA 4AKHA 1GNEA 4JR6A 4EKZA 2CVDA 1XVWA 1PKZA 3CSHA 3RHBA 2JL4A 4TXOA 4OD7A 2BJXA 2KHPA 4POKA 2REMA 2ZNMA 3IAS2 1YJ6A 2LRTA 4TN8A 1XWBA 2KOKA 4MJBA 6GSSA 2V6OA 1GP1A 1DE2A 1RW1A 1CQGA 3F4RA 2LV3A 5G30A 2VCXA 3TOUA 2P5QA 3QAWA 3VPQA 2I9HA 3HZ8A 5F07A 5D8IA 2YNXA 1A2JA 2HSNA 8GSSA 3EC3A 5AN1A 3TOTA 6GSVA 2BMXA 3GKXA 6GSYA 2QA2A 3KMNA 2VCQA 2VUPA 3LEFA 4K7IA 5ECIB 4EE0A 20GSA 4IELA 3LW9A 2L57A 5HR3A 4G2EA 3PGTA 4MDCA 3ZFLA 3QCPA 2O8VB 2VL2C 2PVQA 1AW9A 3TDGA 1GTUA 1ML6A 5A4WA 3R2QA 5F06A 3EU3A 2H72A 5JCGA 1YEPA 2JSZA 1K0CA 4N10A 1M2DA 1OC9A 22GSA 4IGJA 5H5QA 3GL3A 1VGLA 4AGSA 4WXTA 5KOXA 3P2AA 2I81A 3KD0A 3H79A 3E3EA 3ZREA 1VF3A 4N0ZA 5KN3A 2ON7A 4KW6A 3RAZA 3F63A 1Z3EA 3TCOA 2V41A 2NTOA 1UC7A 1T3BA 2FWGA 4KUNA 4RI7A 1B9YC 5LNKe 5GZZB 2A2RA 2FY6A 5BMUA 1A0FA 1JZRA 2YP6A 2HYXA 1QUWA 4BA7A 3LG6A 2QSIA 3E0UA 4MJEA 5HFKA 4AJ6A 4JBBA 1GSDA 4JU5A 3UL3A 3F4TA 3MNGA 2C0EA 3VURA 1F2EA 2L4CA 3CMIA 1LJRA 5BRTA 1RK4A 3DVWA 2OE3A 1FHEA 1SD8A 4GWRA 3FW2A 2JSYA 1ACVA 5IPGA 2GSSA 3UIWA 1GSYA 2CA8A 5HR1A 1MD4A 4ZB8A 5IOXA 1OKDA 3QD9A 4MZWA 1LU4A 18GSA 1XOAA 4YKGA 3ZITA 3EE2A 2MMZA 4YQUA 3GX0A 3MIXA 5A4UA 2MBSA 1FW1A 3VWVA 5A5HA 4MLYA 4K5SA 1BEDA 1SD9A 3FZ5A 5INYA 2H19A 1DUGA 1K0AA 3F6FA 3NIVA 1XWCA 3GSTA 3GV1A 4OCEA 2DJJA 3IK7A 1GSEA 1JLWA 5ECOB 2K6VA 2RLIA 2VAFA 2H0HA 1B8XA 3FR3A 1K0DA 5A34B 4KB3A 1E6BA 2H1AA 3I43A 4KX4A 1T4ZA 3UEMA 1MDIA 2CT6A 4MABA 3MAKA 5F8BA 1YQ1A 3VWUA 2AYTA 1E2YA 4X0XA 2OE1A 2RM5A 3A3TA 3HJOA 1K3YA 4CY8A 3GKMA 3LSZA 2RIIA 4G19A 3D4MA 1JFUA 2YANA 2PWJA 2E2GA 1K3LA 4HI7A 2HRAA 1GWCA 1XW9A 1TKDB 5KN2A 3CSIA 2L59A 4FYUA 4OCFA 2TRCP 1X9SB 3HYPA 4K0NA 3LFLA 1QK8A 2HT9A 1GSSA 2HE3A 4GCIA 2JACA 4G01A 5ENUA 4K2DA 3GA4A 2B3SA 1TDIA 3M0FA 3TJKA 10GSA 5ID2B 3CRTA 3FHKA 5DALB 1PN0A 4ZB7A 4KCAA 3CRUA 4ECJA 2VLVA 2F51A 4ZILA 2GSTA 5IM9A 1ZYNA 2D2ZA 3GTUB 1URMA 1TRSA 1FOHA 4YAPA 2O89A 4XRAA 5A5KA 2PUKC 1TOFA 9GSSA 1YF1A 5DAKB 4AKXB 4K1FA 1TRWA 5GAND 2IMDA 1K0BA 2B7KA 2B5XA 4HU9A 3RPPA 3IV4A 2DLXA 1GRXA 4GF0A 3IR4A 3GYKA 4ILFA 4TR3A 3KP8A 5CAXA 1WIKA 3PR8A 5G1KA 1B48A 1V9WA 14GSA 3TU3B 3L0HA 2RUFA 4J2FA 2QA1A 4HUAA 2R4VA 5CRDA 2LUSA 3O76A 5HR0A 5CRHA 4JE1A 2VIMA 5DQYA 4IVFA 4EIQA 5ECRB 1OAZA 1Z6MA 4TXOB 4ULXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KP1 A;  2H76 A;  2VCZ A;  2HZE A;  4OFN A;  3GSS A;  4MJA A;  3I9V 2;  4PUF C;  2G0F A;  3P7X A;  2JZS A;  5L71 A;  1X5C A;  5ECM B;  1ST9 A;  3VI7 A;  1C72 A;  4KF9 A;  4G0K A;  2MMO A;  2VLU A;  5IMC A;  3ZML A;  3EMX A;  5AIV A;  1BYE A;  2JAD A;  4MPF A;  3K8N A;  5JWO B;  4XIH A;  1SK0 A;  2A4V A;  3RHC A;  1R4W A;  1S3C A;  3DIE A;  5D73 A;  4ZBA A;  3ZLP A;  1T8E B;  2IPA A;  1X5D A;  5EY6 A;  5IMZ A;  3VK9 A;  2K8S A;  4WR5 A;  3HDC A;  1EP7 A;  2H1D A;  2AAW A;  2CAI A;  3GUR A;  1OC9 B;  2XBQ A;  4IQ1 A;  3LWA A;  3KH9 A;  2H1B A;  4WR4 A;  4EXJ A;  2YWN A;  5EL8 A;  2LST A;  4F03 A;  4ISD A;  1JZW A;  3UAR A;  2H6X A;  1OE7 A;  2LNT A;  3L78 A;  3FZ9 A;  4MH3 A;  1YY7 A;  2CX4 A;  4O5R A;  2DBC A;  2PN8 A;  2CQ9 A;  3DEX A;  3WGX A;  1WOU A;  2QC7 A;  2HZF A;  5ID2 A;  1X9M B;  3HA9 A;  1ZCP A;  3HJM A;  3LQ7 A;  4FYB A;  3KP9 A;  2FA8 A;  5DJL A;  1XZO A;  2MZC A;  3KM6 A;  5FT3 A;  3NZN A;  1F3B A;  3WYW A;  2VCT A;  2O7K A;  2F9S A;  4GQF A;  1AQX A;  3GL5 A;  3BD2 A;  2GS3 A;  4MH2 A;  4MZC A;  3FKF A;  1VF2 A;  2O85 A;  1GLQ A;  3IC8 A;  1JLV A;  2HRN A;  2IWT A;  3DGQ A;  4I6X A;  3ERG A;  4ZB6 A;  3M1G A;  2OAD A;  5HFI A;  2F8A A;  3GIX A;  1GLP A;  2O87 A;  1KNG A;  2DJ3 A;  2DIY A;  4HU7 A;  1BG5 A;  3U6V A;  2GZZ A;  1X5E A;  1BJX A;  4V2N A;  2DIZ A;  4P3Y B;  4D73 A;  2PVO C;  2GQK A;  4DSS A;  2GQM A;  2H1G A;  1LBK A;  1PKW A;  3DVX A;  3APQ A;  2YN1 A;  1O6J A;  4V2M A;  4BVY A;  4DEJ A;  5IMV A;  2CZ3 A;  2ZCT A;  2OJL A;  2C8U A;  3IHQ A;  4NXI A;  2V2G A;  1ZYQ B;  2PER A;  4IKH A;  1M0U A;  4TR1 B;  1PGT A;  2LTK A;  2GZP A;  3EMP A;  4IN0 A;  2HNL A;  4HOJ A;  1QQ2 A;  2DJ1 A;  1EZK A;  4GSN A;  3KMO A;  4JED A;  3GFK A;  3VLN A;  3R3E A;  2NVL A;  1TK0 B;  3GNJ A;  1EV4 A;  5ECN B;  2YWI A;  1ABA A;  3C1R A;  4PUR A;  1XWA A;  5KN1 A;  1AXD A;  2H71 A;  3CSJ A;  1GH2 A;  2GT5 A;  4I2U A;  3H8Q A;  3FZ4 A;  3WGD A;  3KIJ A;  2X8G A;  3ZL5 A;  1XCC A;  1AAZ A;  3QFB C;  2CVK A;  4MMM A;  2C0F A;  1WWJ A;  1PX7 A;  4EF0 A;  2E7P A;  3S9F A;  4OWY A;  2OKA A;  4OFM A;  4LMW A;  2WZ9 A;  1XBS A;  4EUY A;  16GS A;  3TKP A;  3D0Z A;  4NPB A;  4NV2 A;  4YH2 A;  2C0G A;  3E9J B;  3TB2 A;  2HLS A;  1J9B A;  2VLT A;  3APS A;  3D4T A;  1KEB A;  5B6N A;  4ZBB A;  1GSU A;  1SL2 B;  4Q5R A;  1XOB A;  4I2T A;  3GH6 A;  3P90 A;  1PMT A;  2I3Y A;  3ZRD A;  4OO5 A;  2VO4 A;  4O7H A;  4KND A;  3WT1 A;  4LL1 B;  4L0W A;  3TJJ A;  4TXV A;  2FWE A;  2HRK A;  2L5O A;  1OKT A;  2PPT A;  5DJM A;  5G1L A;  2DML A;  5D96 A;  3D5J A;  1Z7P A;  1PSQ A;  3US3 A;  1Z5Y E;  1A8L A;  5HFG A;  2K18 A;  4XCS A;  3TKS A;  2E2M A;  1ZOF A;  3ZYW A;  1QGV A;  3KXO A;  3EU4 A;  3ED3 A;  2HZE B;  1ZGN A;  2MBT A;  4GXZ A;  5B7C A;  1K0N A;  2FGX A;  2ES7 A;  1TK5 B;  1Z9H A;  4K7O A;  2L6C A;  2LNS A;  2M80 A;  1V40 A;  3W6G A;  2XPE A;  1M9B A;  5IMD A;  1TU8 A;  2ZUP A;  2YV9 A;  4F0B A;  4KH7 A;  2GZY A;  2AJQ B;  5CYY A;  3HKR A;  3LYK A;  1QFN A;  3A5W A;  3N9J A;  4TR1 A;  2IN3 A;  3M8N A;  1GUK A;  3G7J A;  4MF6 A;  3W8S A;  4Q5N A;  4IHU A;  3BOA A;  5G5F A;  4HQZ A;  2CZ2 A;  5C04 A;  4CW9 A;  2UZ8 A;  1FVK A;  3KTL A;  4WEY A;  4PNG A;  1R5P A;  1GTB A;  2OE0 A;  4NWY A;  5IIZ A;  3W8J A;  2R2J A;  2IMF A;  5CRG A;  1AIU A;  3LGC A;  4WET A;  2WDU A;  1Y6E A;  5IO2 A;  2LEG A;  4PQH A;  4TR0 A;  3MSZ A;  4CDO A;  2PGT A;  1U88 A;  3H4K A;  2YOI A;  3BCK A;  4PUA A;  3C7M A;  3N5O A;  1XW5 A;  3FR6 A;  3F9U A;  3QPM A;  5CNW A;  2YCD A;  1PX6 A;  3QFA C;  1YF0 A;  2VL2 A;  1J0F A;  4KDY A;  2WCI A;  1FOV A;  3CYN A;  2VD0 A;  4RI6 A;  4H86 A;  1SL1 B;  2YWM A;  1TRU A;  2C3N A;  7GSS A;  2HQT A;  1EEJ A;  2EIR A;  3HZ4 A;  3FEU A;  4GSS A;  5JWR B;  1ERT A;  1I9D A;  4BPY A;  1X9W B;  5GST A;  2V1M A;  3HCZ A;  4J57 E;  2LQQ A;  2DMM A;  1F9M A;  2BTO T;  1FO5 A;  1HNA A;  4BL7 A;  2HRF A;  4PXO A;  3IXR A;  5ABR A;  1T4Y A;  5AGY A;  1EOH A;  1YKA A;  2AUV A;  4IJ3 A;  3ZIJ A;  1A2M A;  3HJP A;  4V2L A;  3GUS A;  3TUE A;  5HQP A;  4NMU A;  1W89 A;  1EGR A;  2H73 A;  5B8A A;  2B5Y A;  2CV4 A;  4PTS A;  4TVE A;  4NAX A;  1G6W A;  4D73 B;  5GSS A;  3APO A;  4O92 A;  4DSS B;  5KN0 A;  4K7N A;  3GHA A;  3TJB A;  3ME7 A;  4HZ4 A;  4JZQ A;  3ZIV A;  3RPN A;  4IQA A;  2VL3 A;  3DD3 A;  2P0G A;  4BVY B;  4POB A;  4WBJ A;  5EVO A;  3I6A A;  2V6K A;  4LA1 A;  3QOU A;  3CTG A;  1GNW A;  4X1U A;  3MWH A;  2RM6 A;  3OR5 A;  3TKR A;  1XPV A;  4FYC A;  2VD1 A;  5D93 A;  3EIN A;  4K8M A;  1K3O A;  5DDL A;  3DML A;  4XS4 A;  3F8U A;  3EUR A;  2NPB A;  3ZVJ A;  1GTI A;  1HQO A;  2MMA A;  1TK8 B;  2B7J A;  3M3M A;  5EPF A;  4FIW A;  1O8X A;  3ZVJ D;  4I97 A;  2GT6 A;  5CO3 A;  4MZB A;  4O32 A;  2EIQ A;  4ZIJ A;  3FY7 A;  3IA1 A;  3AY8 A;  2HSM B;  2GTU A;  3L4N A;  2YWO A;  1RQM A;  1Q4J A;  4ML1 A;  4OO4 A;  1WMJ A;  5D9X A;  4DSQ A;  2VOC A;  6GSX A;  3KTB A;  3HVX A;  1THO A;  1ERW A;  2HSY A;  1M2A A;  3U5R E;  3TKS E;  2HI7 A;  3FZA A;  4G0L A;  5COH A;  1ZYE A;  4NHZ A;  1O85 A;  4G0I A;  1MD3 A;  1J08 A;  3F3Q A;  1Q98 A;  4EL1 A;  1SKW B;  3CXG A;  1WP0 A;  2AHE A;  1ZMA A;  4XRD A;  5H5S A;  3P8W A;  4TW5 A;  2JU5 A;  4ID0 A;  2GSQ A;  1G7O A;  1GSF A;  1GUL A;  2CX3 A;  1U3A A;  4DSR A;  1NW2 A;  1OC8 A;  3UVT A;  1CQH A;  2DJ0 A;  4BVX A;  5J3R A;  4IP1 A;  3PH9 A;  2LJA A;  1HNC A;  5J41 A;  1EGO A;  11GS A;  2FD3 A;  3L9V A;  1XW6 A;  1QMV A;  3O3T A;  4PGT A;  1DBY A;  4EC0 A;  2DSA A;  3BJ5 A;  4K0G A;  5F05 A;  4K6X A;  1YZX A;  3HY2 A;  3EWL A;  2R6K A;  3TGZ A;  4AJ7 A;  1KTE A;  1A24 A;  2HRK B;  1SYR A;  4ECB A;  1A0R P;  2LS5 A;  6GSU A;  4QQ7 A;  2V32 A;  4F82 A;  3TRX A;  5CRW A;  3EVI A;  1YEX A;  1N2A A;  5G5E A;  3C1S A;  4KA0 A;  2TIR A;  1EOG A;  1SU9 A;  1KBN A;  1TP9 A;  2H0I A;  4ACS A;  2GVP A;  2IIY A;  5J9B A;  1TW9 A;  5J5N A;  5CP1 A;  3V1W A;  1HD2 A;  4GLT A;  2XC2 A;  4NV5 A;  1GL8 A;  2FCH A;  3MDK A;  2XHF A;  2N5B A;  4XS1 A;  3UOM A;  2FNO A;  4LL4 B;  1UA5 A;  4FQU A;  4V1A g;  2M46 A;  1HYU A;  2LKU A;  1XWG A;  2R5G A;  1FG4 A;  1G7E A;  2R37 A;  4DVC A;  4L8E A;  1WRY A;  3C71 A;  3HXS A;  3H93 A;  2DC5 A;  2X8H A;  3KZQ A;  1U87 A;  4GQC A;  2DJK A;  2AV4 A;  2C1Y A;  5AIS A;  2NBS A;  2M72 A;  1EV9 A;  1MEK A;  5IO0 A;  1DSB A;  1U6T A;  4F2I A;  4MP4 A;  12GS A;  3IAM 2;  2X99 A;  3RDW A;  13GS A;  4ZXG A;  2X64 A;  2IFQ A;  3ISO A;  1WJK A;  3A2W A;  2PU9 C;  4IS0 A;  5ECQ B;  3IPZ A;  5J9C A;  1F37 A;  1MDK A;  1FB6 A;  5DCG A;  5KEJ A;  1H4O A;  2HFD A;  1VF4 A;  3BCI A;  1JZD A;  1UN2 A;  5JWQ B;  4ZL8 A;  5IMA A;  4KSM A;  2AB6 A;  2HSM A;  4PQI A;  5DBQ A;  3Q74 A;  1SEN A;  2Z9S A;  4ML6 A;  2PBJ A;  4ZB9 A;  2WGR A;  5E4W A;  2J9H A;  2TRX A;  2H6Z A;  1K0O A;  1I5G A;  4KCE A;  2PMT A;  2WRT A;  3G7I A;  3FR9 A;  5JCU A;  2L5L A;  2DJ2 A;  1FVJ A;  4E8E A;  4EDY A;  3Q6O A;  3UBL A;  1R7H A;  1MTC A;  1WPI A;  1JHB A;  1OYJ A;  2KUC A;  4HEA 2;  5D9V A;  3D21 A;  4Q5Q A;  2IMK A;  3LXT A;  5F0G A;  5LD0 A;  2YPM A;  4MF7 A;  2LJK A;  3VPT A;  4AJ8 A;  1IYH A;  2OBI A;  3GX8 A;  3KCM A;  4L5L A;  2VL9 A;  3DWV A;  1F3A A;  4ZL9 A;  4ECC A;  1OC3 A;  2YZH A;  5ECP B;  4OMV A;  2GLR A;  4BL7 B;  3A2V A;  2H75 A;  4F9Z A;  5B8B A;  1FB0 A;  2C80 A;  3CBU A;  1PD2 1;  4TOP A;  1PA3 A;  3LYP A;  1M7T A;  4BWQ A;  1A23 A;  3ME8 A;  1PQN A;  4N30 A;  5C00 A;  2LRN A;  3QDN A;  1M99 A;  1BAY A;  5ECK B;  3SWL A;  2H66 A;  5LCZ A;  2H8L A;  2J23 A;  4I5Q A;  3J7Y k;  2LRC A;  4G10 A;  2WB9 A;  2N5A A;  1GUH A;  4G9H A;  5JCW A;  2WJU A;  4NHW A;  5ECS A;  1ERU A;  4LLR A;  1K0M A;  1X0R A;  2VM2 A;  3O6T A;  4MJC A;  4USS A;  4TR4 A;  3J7Y b;  2LQO A;  3IC4 A;  5ECH B;  3TRP A;  3VFI A;  2VM1 A;  2YJH A;  2GQL A;  1M2B A;  3UVH A;  1PRX A;  2I1U A;  4GRF A;  2CAQ A;  1T7P B;  1BX9 A;  2C3T A;  4XS4 B;  1SYX A;  4JR4 A;  1Y25 A;  4IJI A;  1T1V A;  2IMI A;  3Q19 A;  1Z7R A;  4POL A;  1TI3 A;  1S3A A;  1TRV A;  4KAE A;  1AC1 A;  1USB A;  6GST A;  2IJY A;  5DQS A;  3F6D A;  4FH8 A;  1B9X C;  4WBR D;  2H0G A;  3UBK A;  3WT2 A;  4XTS A;  2GSR A;  2EC4 A;  2C4J A;  5IMF A;  3FRC A;  3GKN A;  1AQW A;  3JCM L;  2GDR A;  5AIX A;  1PL1 A;  2P31 A;  1MDJ A;  1O8W A;  2OAC A;  3M9J A;  4GST A;  1O81 A;  5J4U A;  3C73 A;  3ERW A;  3Q18 A;  4HDE A;  2L4Q A;  3TRQ A;  2F3M A;  4KDX A;  3LJR A;  4RUV A;  1FAA A;  1NHY A;  3KGK A;  4GTU A;  1THX A;  3GMF A;  2B1L A;  1PL2 A;  4ECI A;  4PX1 A;  1YDK A;  3SBC A;  3GN3 A;  1SKS B;  4BVX B;  2IL3 A;  1PN9 A;  1V58 A;  5D9T A;  4PNF A;  1TU7 A;  3TJF A;  1B4Q A;  2B1K A;  5ELA A;  2VCV A;  1T00 A;  4FO5 A;  1ERV A;  4KE3 A;  3C8E A;  1G6Y A;  3H1N A;  1GTA A;  1R26 A;  3QAV A;  1NHO A;  2H74 A;  2XPD A;  4X43 A;  1SKR B;  3RBT A;  1NM3 A;  4E8H A;  4EVM A;  1SJZ A;  4TRX A;  1W4V A;  3KEB A;  4MCU A;  3HD5 A;  3D22 A;  4K9Z A;  1Z6N A;  2X8C A;  3TJG A;  4RQR A;  2H70 A;  4WF5 A;  1VF1 A;  5GAP D;  1UVZ A;  2HSH A;  5FWG A;  3WD6 A;  4XHM A;  4TKY A;  1SL0 B;  2WS2 A;  4YQM A;  3QMX A;  5B6M A;  1OVN A;  1SK2 A;  2G2Q A;  3A2X A;  4KDU A;  2GGT A;  1XFL A;  2MYG A;  1O7U A;  2VCW A;  1N8J A;  3WGE A;  3PIN A;  3CTF A;  4MPG A;  4HQS A;  4YAV A;  4IBP A;  2K8V A;  2FLS A;  3LXZ A;  4N0V A;  3VWW A;  3GRX A;  5IOW A;  1M9A A;  3EYT A;  1XVQ A;  1NSW A;  3D6I A;  3HHV A;  4HZ2 A;  2IFQ B;  3M9K A;  5ECL B;  4KSO A;  3ZMK A;  2OBK A;  1S3D A;  1VRS D;  1ZL9 A;  3F0I A;  4ZBD A;  2WUL A;  4F0C A;  2ON5 A;  3DKS A;  3DYR A;  2IME A;  1V2A A;  4I8B A;  5IQY A;  1F6M C;  3VI5 A;  2H01 A;  3HVS A;  1SJ6 A;  4JRR A;  2F8F A;  3KH7 A;  2QKE A;  1A8Y A;  2RUE A;  1IYI A;  2LJR A;  19GS A;  4J56 E;  2HSN B;  2JZR A;  5D9W A;  3VWX A;  4CHS A;  2B5E A;  3PPU A;  2WFC A;  3DRN A;  1DE1 A;  4YQV A;  2YZU A;  6GSW A;  1A2L A;  1G0T A;  2A2S A;  2CVB A;  1EEM A;  3L9S A;  3FK8 A;  4ZL7 A;  1XXU A;  2FA4 A;  1QXH A;  4QL7 A;  4IW9 A;  3F4S A;  1AQV A;  4EDZ A;  2C3Q A;  1WE0 A;  2I4A A;  4L5O A;  1XIY A;  4HS1 A;  1HNB A;  4RQX A;  1SJI A;  4EO3 A;  2C0D A;  1TI1 A;  2H6Y A;  3BBY A;  1AUC A;  2B6M A;  2OA7 A;  3QR6 A;  4XS6 A;  4AF2 A;  4WKW A;  3GKK A;  2EIO A;  2FHE A;  1B4P A;  3I69 A;  4Q5F A;  3L9U A;  3IBH A;  3IOS A;  3IDV A;  1BQ7 A;  4QL9 A;  2FWH A;  2HXK A;  1TXX A;  5FHI A;  5DAL A;  3DXB A;  1YKC A;  1ZZY A;  1ILO A;  4Z7X A;  4MK3 A;  2KLX A;  4HJM A;  4L0U A;  3UMA A;  1GSQ A;  2K9F A;  2YJ7 A;  4POM A;  1V57 A;  5H5R A;  3GTU A;  1V98 A;  4N11 A;  1SK1 A;  3TKS C;  4IP6 A;  2N5F A;  3QAG A;  2FWF A;  17GS A;  1OE8 A;  4HJ2 A;  1EP8 A;  1O73 A;  2XBI A;  4MA9 A;  3TKQ A;  3IK9 A;  3IE3 A;  3NOF A;  1H75 A;  3UAP A;  3KJY A;  3G9B A;  5DCH A;  2R3X A;  5DAK A;  2MMN A;  2QGV A;  3G7Y A;  2KP2 A;  2P5R A;  5HR2 A;  2NDO A;  4BWS A;  3ERF A;  2E0Q A;  4MF5 A;  1GUM A;  1U3I A;  4WF4 A;  3IRA A;  1R5A A;  3ZFB A;  2FUG 2;  4PQ1 A;  3ZZX A;  2H30 A;  3UJ1 A;  2ALB A;  5ELG A;  2YV7 A;  3F3R A;  4V1A p;  3LOR A;  5DVB A;  1TJD A;  1TTZ A;  2L6D A;  4LMV A;  4KGI A;  1EWX A;  5IPH A;  1ON4 A;  1JZO A;  5CRE A;  5E59 A;  1XWK A;  5A4V A;  3GH9 A;  5G2Z A;  3FYG A;  3HVV A;  2JZT A;  5G31 A;  4OFT A;  3ZTL A;  1GNE A;  4JR6 A;  4EKZ A;  2CVD A;  1XVW A;  1PKZ A;  3CSH A;  3RHB A;  2JL4 A;  4TXO A;  4OD7 A;  2BJX A;  2KHP A;  4POK A;  2REM A;  2ZNM A;  3IAS 2;  1YJ6 A;  2LRT A;  4TN8 A;  1XWB A;  2KOK A;  4MJB A;  6GSS A;  2V6O A;  1GP1 A;  1DE2 A;  1RW1 A;  1CQG A;  3F4R A;  2LV3 A;  5G30 A;  2VCX A;  3TOU A;  2P5Q A;  3QAW A;  3VPQ A;  2I9H A;  3HZ8 A;  5F07 A;  5D8I A;  2YNX A;  1A2J A;  8GSS A;  3EC3 A;  5AN1 A;  3TOT A;  6GSV A;  2BMX A;  3GKX A;  6GSY A;  3KMN A;  2VCQ A;  2VUP A;  3LEF A;  4K7I A;  5ECI B;  4EE0 A;  20GS A;  4IEL A;  2L57 A;  5HR3 A;  4G2E A;  3PGT A;  4MDC A;  3ZFL A;  3QCP A;  2O8V B;  2VL2 C;  2PVQ A;  1AW9 A;  3TDG A;  1GTU A;  1ML6 A;  5A4W A;  3R2Q A;  5F06 A;  3EU3 A;  2H72 A;  5JCG A;  1YEP A;  2JSZ A;  1K0C A;  4N10 A;  1M2D A;  1OC9 A;  22GS A;  4IGJ A;  5H5Q A;  3GL3 A;  1VGL A;  4AGS A;  4WXT A;  3P2A A;  2I81 A;  3KD0 A;  3H79 A;  3E3E A;  3ZRE A;  1VF3 A;  4N0Z A;  5KN3 A;  2ON7 A;  4KW6 A;  3RAZ A;  3F63 A;  1Z3E A;  3TCO A;  2V41 A;  2NTO A;  1UC7 A;  1T3B A;  2FWG A;  4KUN A;  4RI7 A;  1B9Y C;  5LNK e;  5GZZ B;  2A2R A;  2FY6 A;  5BMU A;  1A0F A;  1JZR A;  2YP6 A;  2HYX A;  1QUW A;  4BA7 A;  3LG6 A;  2QSI A;  3E0U A;  4MJE A;  5HFK A;  4AJ6 A;  4JBB A;  1GSD A;  4JU5 A;  3UL3 A;  3F4T A;  3MNG A;  2C0E A;  3VUR A;  1F2E A;  2L4C A;  3CMI A;  1LJR A;  1RK4 A;  3DVW A;  2OE3 A;  1FHE A;  1SD8 A;  4GWR A;  3FW2 A;  2JSY A;  1ACV A;  5IPG A;  2GSS A;  3UIW A;  1GSY A;  2CA8 A;  5HR1 A;  1MD4 A;  4ZB8 A;  5IOX A;  1OKD A;  3QD9 A;  4MZW A;  1LU4 A;  18GS A;  1XOA A;  3ZIT A;  3EE2 A;  2MMZ A;  4YQU A;  3GX0 A;  5A4U A;  2MBS A;  1FW1 A;  3VWV A;  4MLY A;  1BED A;  1SD9 A;  3FZ5 A;  5INY A;  2H19 A;  1DUG A;  1K0A A;  3F6F A;  3NIV A;  1XWC A;  3GST A;  3GV1 A;  4OCE A;  2DJJ A;  3IK7 A;  1GSE A;  1JLW A;  5ECO B;  2K6V A;  2RLI A;  2VAF A;  2H0H A;  1B8X A;  3FR3 A;  1K0D A;  4KB3 A;  1E6B A;  2H1A A;  3I43 A;  4KX4 A;  1T4Z A;  3UEM A;  1MDI A;  2CT6 A;  4MAB A;  3MAK A;  5F8B A;  1YQ1 A;  3VWU A;  2AYT A;  1E2Y A;  4X0X A;  2OE1 A;  2RM5 A;  3A3T A;  3HJO A;  1K3Y A;  3GKM A;  3LSZ A;  2RII A;  4G19 A;  3D4M A;  1JFU A;  2YAN A;  2PWJ A;  2E2G A;  1K3L A;  4HI7 A;  2HRA A;  1GWC A;  1XW9 A;  1TKD B;  5KN2 A;  3CSI A;  2L59 A;  4FYU A;  4OCF A;  2TRC P;  1X9S B;  3HYP A;  4K0N A;  3LFL A;  1QK8 A;  2HT9 A;  1GSS A;  2HE3 A;  4GCI A;  2JAC A;  5ENU A;  4K2D A;  3GA4 A;  2B3S A;  1TDI A;  3M0F A;  3TJK A;  10GS A;  5ID2 B;  3CRT A;  3FHK A;  5DAL B;  4KCA A;  3CRU A;  4ECJ A;  2VLV A;  2F51 A;  4ZIL A;  2GST A;  5IM9 A;  2D2Z A;  3GTU B;  1URM A;  1TRS A;  4YAP A;  2O89 A;  4XRA A;  5A5K A;  2PUK C;  1TOF A;  9GSS A;  1YF1 A;  5DAK B;  4K1F A;  1TRW A;  5GAN D;  2IMD A;  1K0B A;  2B7K A;  2B5X A;  4HU9 A;  3RPP A;  3IV4 A;  2DLX A;  1GRX A;  4GF0 A;  3IR4 A;  3GYK A;  4ILF A;  4TR3 A;  3KP8 A;  5CAX A;  1WIK A;  3PR8 A;  5G1K A;  1B48 A;  1V9W A;  14GS A;  3L0H A;  2RUF A;  4J2F A;  4HUA A;  2R4V A;  5CRD A;  2LUS A;  3O76 A;  5HR0 A;  5CRH A;  4JE1 A;  2VIM A;  5DQY A;  4IVF A;  5ECR B;  1OAZ A;  1Z6M A;  4TXO B;  4ULX A; 
#chains in the Genus database with same CATH topology
 2KP1 A;  2H76 A;  2VCZ A;  2HZE A;  3IHG A;  4OFN A;  3GSS A;  4MJA A;  4AKI A;  3I9V 2;  4PUF C;  2G0F A;  3P7X A;  2H1L A;  2JZS A;  5L71 A;  1X5C A;  5ECM B;  1ST9 A;  3VI7 A;  1C72 A;  4KF9 A;  4G0K A;  4K2X A;  2MMO A;  2VLU A;  5IMC A;  3ZML A;  3EMX A;  5AIV A;  1SVL A;  3EPT A;  1BYE A;  2JAD A;  2EFE A;  4MPF A;  3K8N A;  5JWO B;  4XIH A;  1SK0 A;  2A4V A;  3RHC A;  1R4W A;  1S3C A;  3DIE A;  5D73 A;  4ZBA A;  1PFO A;  3ZLP A;  1T8E B;  2IPA A;  1X5D A;  5EY6 A;  5IMZ A;  3VK9 A;  2K8S A;  4WR5 A;  3HDC A;  1EP7 A;  2H1D A;  2AAW A;  2CAI A;  3GUR A;  1OC9 B;  2XBQ A;  4IQ1 A;  3LWA A;  3KH9 A;  2H1B A;  4WR4 A;  4EXJ A;  2YWN A;  5EL8 A;  2LST A;  4F03 A;  4ISD A;  1JZW A;  3UAR A;  2H6X A;  1OE7 A;  2LNT A;  3L78 A;  3FZ9 A;  4MH3 A;  1YY7 A;  2CX4 A;  4O5R A;  2DBC A;  2PN8 A;  2CQ9 A;  3DEX A;  3WGX A;  1WOU A;  5BMU B;  2QC7 A;  2HZF A;  5ID2 A;  1X9M B;  1M3I A;  3HA9 A;  1ZCP A;  3HJM A;  3LQ7 A;  4FYB A;  3KP9 A;  2FA8 A;  5DJL A;  1XZO A;  2MZC A;  3KM6 A;  5FT3 A;  3NZN A;  1F3B A;  3WYW A;  2VCT A;  2O7K A;  2F9S A;  4GQF A;  1AQX A;  3GL5 A;  3BD2 A;  2GS3 A;  4MH2 A;  4MZC A;  3FKF A;  1VF2 A;  2O85 A;  1GLQ A;  3IC8 A;  1JLV A;  2HRN A;  2IWT A;  3DGQ A;  4I6X A;  3ERG A;  4ZB6 A;  3M1G A;  2OAD A;  5J4V A;  5HFI A;  2F8A A;  3GIX A;  1GLP A;  2O87 A;  1KNG A;  2DJ3 A;  2DIY A;  4HU7 A;  1BG5 A;  2WW2 A;  3U6V A;  2GZZ A;  1X5E A;  1BJX A;  4V2N A;  2DIZ A;  5A5H B;  4P3Y B;  4D73 A;  4PI0 C;  2PVO C;  2GQK A;  4DSS A;  2GQM A;  2H1G A;  1LBK A;  4Z2R A;  1PKW A;  3DVX A;  3APQ A;  2YN1 A;  1O6J A;  4V2M A;  4BVY A;  2WW0 A;  4DEJ A;  5IMV A;  1ZYP A;  2CZ3 A;  2ZCT A;  2OJL A;  2C8U A;  3IHQ A;  4NXI A;  2V2G A;  1ZYQ B;  2PER A;  4IKH A;  1M0U A;  4TR1 B;  1PGT A;  2LTK A;  2GZP A;  3EMP A;  4IN0 A;  2HNL A;  4HOJ A;  1QQ2 A;  2DJ1 A;  1EZK A;  4GSN A;  3KMO A;  4JED A;  3GFK A;  3VLN A;  3R3E A;  2NVL A;  1TK0 B;  3GNJ A;  1EV4 A;  5ECN B;  2YWI A;  2X4A A;  1ABA A;  3C1R A;  4PUR A;  3CQF A;  1XWA A;  1BG1 A;  5KN1 A;  1AXD A;  2OT3 A;  2H71 A;  3CSJ A;  1GH2 A;  2GT5 A;  4I2U A;  3H8Q A;  3FZ4 A;  3WGD A;  3KIJ A;  2X8G A;  3ZL5 A;  1XCC A;  1AAZ A;  3QFB C;  2CVK A;  4MMM A;  2C0F A;  1WWJ A;  1PX7 A;  4EF0 A;  1M3J A;  2E7P A;  3S9F A;  4OWY A;  2OKA A;  4OFM A;  4LMW A;  2WZ9 A;  1XBS A;  4EUY A;  16GS A;  3TKP A;  2UV8 G;  3D0Z A;  4NPB A;  4NV2 A;  4YH2 A;  2C0G A;  3E9J B;  3TB2 A;  2HLS A;  1J9B A;  2VLT A;  2WVY A;  3APS A;  3D4T A;  1KEB A;  5B6N A;  4ZBB A;  1GSU A;  1SL2 B;  4Q5R A;  1XOB A;  4I2T A;  3GH6 A;  3P90 A;  1PMT A;  2I3Y A;  3ZRD A;  4OO5 A;  2VO4 A;  5A1N A;  4O7H A;  4A5P A;  4KND A;  3WT1 A;  4LL1 B;  4L0W A;  3TJJ A;  4TXV A;  2FWE A;  2HRK A;  2L5O A;  1OKT A;  2PPT A;  5DJM A;  5G1L A;  2DML A;  5D96 A;  3D5J A;  1Z7P A;  1PSQ A;  3US3 A;  3CWG A;  1Z5Y E;  1A8L A;  5HFG A;  2K18 A;  4XCS A;  3TKS A;  4Z2U A;  2EFD A;  2E2M A;  3HMJ G;  1ZOF A;  3ZYW A;  1QGV A;  4YKF A;  3KXO A;  3EU4 A;  3ED3 A;  2HZE B;  1ZGN A;  2MBT A;  4ICY A;  4GXZ A;  5B7C A;  1K0N A;  2FGX A;  5J4Y A;  2O5V A;  2ES7 A;  1TK5 B;  1Z9H A;  4K7O A;  2L6C A;  2LNS A;  2M80 A;  1V40 A;  3W6G A;  2XPE A;  1M9B A;  5IMD A;  1TU8 A;  2ZUP A;  2YV9 A;  4F0B A;  4KH7 A;  2GZY A;  2AJQ B;  5CYY A;  3HKR A;  3LYK A;  1QFN A;  3A5W A;  3N9J A;  4TR1 A;  2IN3 A;  3RGB C;  3M8N A;  1GUK A;  3G7J A;  4MF6 A;  3W8S A;  4Q5N A;  4IHU A;  3BOA A;  5G5F A;  4HQZ A;  2CZ2 A;  5C04 A;  4CW9 A;  2UZ8 A;  1FVK A;  3KTL A;  4WEY A;  4PNG A;  1R5P A;  1GTB A;  2OE0 A;  1XG8 A;  4NWY A;  5IIZ A;  3W8J A;  2R2J A;  2IMF A;  5CRG A;  1AIU A;  2WZS A;  3LGC A;  4WET A;  2WDU A;  1Y6E A;  5IO2 A;  4CY6 A;  2LEG A;  4PQH A;  4GDF A;  4TR0 A;  3MSZ A;  4CDO A;  2PGT A;  1U88 A;  3H4K A;  2YOI A;  3BCK A;  4PUA A;  3C7M A;  3FMW A;  3N5O A;  1XW5 A;  3FR6 A;  4O5Q A;  3F9U A;  3QPM A;  5CNW A;  2YCD A;  1PX6 A;  3QFA C;  1YF0 A;  2VL2 A;  1J0F A;  4KDY A;  2WCI A;  4K5R A;  1FOV A;  3CYN A;  2VD0 A;  4RI6 A;  4H86 A;  1SL1 B;  2YWM A;  1TRU A;  2C3N A;  7GSS A;  2HQT A;  1EEJ A;  2EIR A;  3HZ4 A;  3FEU A;  4GSS A;  5JWR B;  1ERT A;  1I9D A;  4HSC X;  4BPY A;  1X9W B;  5GST A;  2V1M A;  3HCZ A;  4J57 E;  2LQQ A;  2DMM A;  1F9M A;  2BTO T;  1FO5 A;  1HNA A;  4BL7 A;  2HRF A;  4PXO A;  3IXR A;  5ABR A;  1T4Y A;  5AGY A;  1EOH A;  1YKA A;  2AUV A;  4IJ3 A;  3ZIJ A;  1A2M A;  3HJP A;  4V2L A;  3GUS A;  3TUE A;  5HQP A;  4NMU A;  1W89 A;  1EGR A;  2H73 A;  5B8A A;  2B5Y A;  2CV4 A;  4PTS A;  4TVE A;  4NAX A;  1G6W A;  4D73 B;  5GSS A;  3APO A;  4O92 A;  4DSS B;  2WVX A;  5KN0 A;  4K7N A;  3GHA A;  3TJB A;  3ME7 A;  4HZ4 A;  4JZQ A;  3ZIV A;  3RPN A;  4IQA A;  2VL3 A;  3DD3 A;  2P0G A;  4BVY B;  4POB A;  4WBJ A;  5EVO A;  3I6A A;  2V6K A;  4LA1 A;  3QOU A;  3CTG A;  1SVO A;  1GNW A;  4X1U A;  3MWH A;  2RM6 A;  3OR5 A;  3TKR A;  1XPV A;  4FYC A;  2VD1 A;  4E68 A;  5D93 A;  3EIN A;  4K8M A;  1K3O A;  5DDL A;  3DML A;  4XS4 A;  3F8U A;  3EUR A;  2NPB A;  3ZVJ A;  5J47 A;  1GTI A;  1HQO A;  2MMA A;  1TK8 B;  2B7J A;  3M3M A;  5EPF A;  4FIW A;  1O8X A;  3ZVJ D;  4I97 A;  2GT6 A;  5CO3 A;  4MZB A;  4O32 A;  2EIQ A;  4ZIJ A;  3FY7 A;  3IA1 A;  3AY8 A;  2HSM B;  2GTU A;  3L4N A;  2YWO A;  1RQM A;  1Q4J A;  4ML1 A;  4OO4 A;  1WMJ A;  5D9X A;  4DSQ A;  2VOC A;  6GSX A;  3KTB A;  3HVX A;  1THO A;  1ERW A;  2HSY A;  1M2A A;  3U5R E;  3TKS E;  2HI7 A;  3FZA A;  4G0L A;  5COH A;  1ZYE A;  4NHZ A;  1O85 A;  4G0I A;  1MD3 A;  1J08 A;  3F3Q A;  1Q98 A;  4EL1 A;  1SKW B;  3CHX C;  3CXG A;  1WP0 A;  2AHE A;  1ZMA A;  4XRD A;  5H5S A;  3P8W A;  4TW5 A;  2JU5 A;  4ID0 A;  2GSQ A;  1G7O A;  1GSF A;  1GUL A;  2CX3 A;  1U3A A;  4DSR A;  1NW2 A;  1OC8 A;  3UVT A;  1CQH A;  2DJ0 A;  4BVX A;  5J3R A;  4IP1 A;  3PH9 A;  2LJA A;  1HNC A;  5J41 A;  1EGO A;  11GS A;  2FD3 A;  3L9V A;  1XW6 A;  1QMV A;  3O3T A;  4PGT A;  1DBY A;  4EC0 A;  2DSA A;  3BJ5 A;  4K0G A;  5A1N B;  5F05 A;  4K6X A;  1YZX A;  3HY2 A;  3EWL A;  2R6K A;  3TGZ A;  4AJ7 A;  1KTE A;  1A24 A;  2HRK B;  1SYR A;  4ECB A;  1A0R P;  2LS5 A;  6GSU A;  4QQ7 A;  2V32 A;  4F82 A;  3TRX A;  5CRW A;  1SVM A;  3EVI A;  1YEX A;  1N2A A;  5G5E A;  3C1S A;  4KA0 A;  2TIR A;  1EOG A;  1SU9 A;  2DKI A;  1KBN A;  1TP9 A;  4MNN A;  2H0I A;  4ACS A;  2GVP A;  2IIY A;  5J9B A;  1TW9 A;  5J5N A;  5CP1 A;  3V1W A;  1HD2 A;  4GLT A;  2XC2 A;  4NV5 A;  1GL8 A;  2FCH A;  3MDK A;  2XHF A;  2N5B A;  4XS1 A;  3UOM A;  2FNO A;  4LL4 B;  1UA5 A;  4FQU A;  4V1A g;  2M46 A;  1HYU A;  2LKU A;  1XWG A;  2R5G A;  1FG4 A;  1G7E A;  2R37 A;  4DVC A;  5J40 A;  4L8E A;  1WRY A;  3C71 A;  3HXS A;  3H93 A;  2DC5 A;  2X8H A;  3KZQ A;  1U87 A;  4GQC A;  2DJK A;  2AV4 A;  2C1Y A;  5AIS A;  2NBS A;  2M72 A;  1EV9 A;  1MEK A;  5IO0 A;  1DSB A;  1U6T A;  4F2I A;  4MP4 A;  12GS A;  3IAM 2;  2X99 A;  3RDW A;  13GS A;  4ZXG A;  2X64 A;  2IFQ A;  3ISO A;  2O3E A;  1WJK A;  3A2W A;  2PU9 C;  4IS0 A;  5ECQ B;  3IPZ A;  5J9C A;  1F37 A;  1MDK A;  1FB6 A;  5DCG A;  5KEJ A;  1H4O A;  2HFD A;  1VF4 A;  3BCI A;  1JZD A;  1UN2 A;  5JWQ B;  4FXY P;  1N25 A;  4ZL8 A;  5IMA A;  4KSM A;  2AB6 A;  2HSM A;  4PQI A;  5DBQ A;  3Q74 A;  1SEN A;  2Z9S A;  4ML6 A;  2PBJ A;  4ZB9 A;  2WGR A;  5E4W A;  2J9H A;  2TRX A;  2H6Z A;  1K0O A;  1I5G A;  4KCE A;  2PMT A;  2WRT A;  3G7I A;  3FR9 A;  5JCU A;  2L5L A;  2DJ2 A;  1FVJ A;  4E8E A;  4EDY A;  3Q6O A;  3UBL A;  4PI2 C;  1MTC A;  1R7H A;  1WPI A;  1JHB A;  1OYJ A;  2KUC A;  4HEA 2;  5D9V A;  3D21 A;  4Q5Q A;  4BIK A;  2IMK A;  3LXT A;  5F0G A;  5LD0 A;  2YPM A;  4MF7 A;  2LJK A;  3VPT A;  4AJ8 A;  1IYH A;  2OBI A;  3GX8 A;  3KCM A;  4L5L A;  2VL9 A;  3DWV A;  1F3A A;  4ZL9 A;  4ECC A;  1OC3 A;  2YZH A;  5ECP B;  4OMV A;  2GLR A;  4BL7 B;  3A2V A;  2H75 A;  4F9Z A;  5B8B A;  1FB0 A;  2C80 A;  3CBU A;  1PD2 1;  4TOP A;  1PA3 A;  3LYP A;  1M7T A;  4BWQ A;  1A23 A;  3ME8 A;  1PQN A;  4N30 A;  5C00 A;  2LRN A;  3QDN A;  1M99 A;  1BAY A;  5ECK B;  1TXU A;  3SWL A;  2H66 A;  5LCZ A;  2H8L A;  2J23 A;  4I5Q A;  3J7Y k;  2LRC A;  4G10 A;  2WB9 A;  2WVX B;  2N5A A;  1GUH A;  4G9H A;  5KOW A;  5JCW A;  2WJU A;  4AKG A;  4NHW A;  5ECS A;  1ERU A;  4LLR A;  1K0M A;  1X0R A;  2VM2 A;  3O6T A;  4MJC A;  4USS A;  4TR4 A;  3J7Y b;  2LQO A;  3IC4 A;  5ECH B;  3TRP A;  3VFI A;  2VM1 A;  2YJH A;  2GQL A;  1M2B A;  3UVH A;  1PRX A;  2I1U A;  4GRF A;  2CAQ A;  1T7P B;  1BX9 A;  2C3T A;  1YEW C;  4XS4 B;  1SYX A;  4JR4 A;  1Y25 A;  4IJI A;  1T1V A;  2IMI A;  3Q19 A;  1Z7R A;  4POL A;  1TI3 A;  1S3A A;  1TRV A;  4KAE A;  1AC1 A;  1USB A;  6GST A;  2IJY A;  5DQS A;  3F6D A;  4FH8 A;  1B9X C;  4WBR D;  2H0G A;  3UBK A;  3WT2 A;  4XTS A;  2GSR A;  2EC4 A;  2C4J A;  5IMF A;  3FRC A;  3GKN A;  1AQW A;  3JCM L;  2GDR A;  5AIX A;  1PL1 A;  2P31 A;  1MDJ A;  1O8W A;  2OAC A;  3M9J A;  4GST A;  1O81 A;  5J4U A;  3C73 A;  3ERW A;  3Q18 A;  4HDE A;  2L4Q A;  3TRQ A;  2F3M A;  4KDX A;  1S3R A;  3LJR A;  4RUV A;  1FAA A;  1NHY A;  3KGK A;  4GTU A;  1THX A;  3GMF A;  2B1L A;  1PL2 A;  4ECI A;  4PX1 A;  1YDK A;  3SBC A;  3GN3 A;  1SKS B;  3A5I A;  4BVX B;  2IL3 A;  1PN9 A;  1V58 A;  5D9T A;  4PNF A;  1TU7 A;  3TJF A;  1B4Q A;  2B1K A;  5ELA A;  2VCV A;  1T00 A;  4FO5 A;  1ERV A;  3MYD A;  4KE3 A;  3C8E A;  2EFH A;  1G6Y A;  3H1N A;  1GTA A;  1R26 A;  3QAV A;  1NHO A;  2H74 A;  2XPD A;  4X43 A;  1SKR B;  3RBT A;  1NM3 A;  4E8H A;  4EVM A;  1SJZ A;  4TRX A;  1W4V A;  3KEB A;  4MCU A;  3HD5 A;  3D22 A;  4K9Z A;  2A4H A;  1Z6N A;  2X8C A;  3TJG A;  4RQR A;  2H70 A;  4WF5 A;  2X49 A;  1VF1 A;  5GAP D;  1UVZ A;  2HSH A;  5FWG A;  3WD6 A;  4XHM A;  4TKY A;  1SL0 B;  2WS2 A;  4YQM A;  3QMX A;  5B6M A;  1OVN A;  1SK2 A;  2G2Q A;  3A2X A;  4KDU A;  2GGT A;  1XFL A;  2MYG A;  1O7U A;  2VCW A;  1N8J A;  3WGE A;  3PIN A;  3CTF A;  4MPG A;  4HQS A;  4YAV A;  4IBP A;  2K8V A;  2FLS A;  3LXZ A;  4N0V A;  3VWW A;  3GRX A;  5IOW A;  1M9A A;  3EYT A;  1XVQ A;  1NSW A;  3D6I A;  3HHV A;  4HZ2 A;  2IFQ B;  3M9K A;  5ECL B;  4KSO A;  3ZMK A;  2OBK A;  1S3D A;  1VRS D;  1ZL9 A;  3F0I A;  4ZBD A;  2WUL A;  4F0C A;  2ON5 A;  3DKS A;  3DYR A;  2IME A;  1V2A A;  4I8B A;  5IQY A;  1F6M C;  3VI5 A;  2H01 A;  3HVS A;  1SJ6 A;  4JRR A;  2F8F A;  3KH7 A;  2QKE A;  2DKH A;  1A8Y A;  2RUE A;  3HVN A;  1IYI A;  2LJR A;  19GS A;  4J56 E;  2HSN B;  2JZR A;  5D9W A;  3VWX A;  4CHS A;  2B5E A;  3PPU A;  2WFC A;  4EIP A;  5A34 A;  4N3Z A;  2R0G A;  3DRN A;  1DE1 A;  4YQV A;  2YZU A;  6GSW A;  4AI6 A;  1A2L A;  1G0T A;  2A2S A;  2CVB A;  1EEM A;  3L9S A;  3FK8 A;  4ZL7 A;  1XXU A;  2FA4 A;  1QXH A;  4QL7 A;  4IW9 A;  3F4S A;  1AQV A;  4EDZ A;  2C3Q A;  1WE0 A;  2I4A A;  4L5O A;  1XIY A;  4HS1 A;  1HNB A;  4RQX A;  1SJI A;  4EO3 A;  2C0D A;  1TI1 A;  2H6Y A;  3BBY A;  1AUC A;  2B6M A;  2OA7 A;  3QR6 A;  4XS6 A;  4AF2 A;  4WKW A;  2A2P A;  3GKK A;  2EIO A;  2FHE A;  1B4P A;  3I69 A;  4Q5F A;  3L9U A;  1S4B P;  3IOS A;  3IBH A;  3IDV A;  1BQ7 A;  2R0C A;  4QL9 A;  2FWH A;  2HXK A;  1TXX A;  1BF5 A;  5FHI A;  4Z2T A;  5DAL A;  3DXB A;  1YKC A;  1ZZY A;  1ILO A;  4Z7X A;  4MK3 A;  2KLX A;  4HJM A;  4L0U A;  4O5U A;  3UMA A;  1GSQ A;  2K9F A;  2YJ7 A;  4POM A;  1V57 A;  4X4J A;  5H5R A;  3GTU A;  1V98 A;  4N11 A;  1SK1 A;  3TKS C;  4IP6 A;  2N5F A;  3QAG A;  2FWF A;  17GS A;  1OE8 A;  1YVL A;  4HJ2 A;  1EP8 A;  1Y1U A;  1O73 A;  2XBI A;  4MA9 A;  3TKQ A;  3IK9 A;  3IE3 A;  3NOF A;  1H75 A;  3UAP A;  3KJY A;  3G9B A;  5DCH A;  2R3X A;  5DAK A;  2MMN A;  2QGV A;  3G7Y A;  2KP2 A;  2P5R A;  5HR2 A;  2EFC A;  2NDO A;  4BWS A;  3ERF A;  2VKZ G;  4QMK A;  2E0Q A;  4MF5 A;  1GUM A;  1U3I A;  4WF4 A;  3IRA A;  1R5A A;  3ZFB A;  2FUG 2;  4PQ1 A;  3ZZX A;  2H30 A;  3UJ1 A;  2ALB A;  5ELG A;  2YV7 A;  3F3R A;  4V1A p;  3LOR A;  5DVB A;  1TJD A;  1TTZ A;  2L6D A;  4LMV A;  4KGI A;  1EWX A;  5IPH A;  1ON4 A;  1JZO A;  5CRE A;  5E59 A;  2R0P A;  1XWK A;  5A4V A;  3GH9 A;  5G2Z A;  3FYG A;  3HVV A;  1I1I P;  2JZT A;  5G31 A;  4OFT A;  4W66 A;  3ZTL A;  4AKH A;  1GNE A;  4JR6 A;  4EKZ A;  2CVD A;  1XVW A;  1PKZ A;  3CSH A;  3RHB A;  2JL4 A;  4TXO A;  4OD7 A;  2BJX A;  2KHP A;  4POK A;  2REM A;  2ZNM A;  3IAS 2;  1YJ6 A;  2LRT A;  4TN8 A;  1XWB A;  2KOK A;  4MJB A;  6GSS A;  2V6O A;  1GP1 A;  1DE2 A;  1RW1 A;  1CQG A;  3F4R A;  2LV3 A;  5G30 A;  2VCX A;  3TOU A;  2P5Q A;  3QAW A;  3VPQ A;  2I9H A;  3HZ8 A;  5F07 A;  5D8I A;  2YNX A;  1A2J A;  2HSN A;  8GSS A;  3EC3 A;  5AN1 A;  3TOT A;  2WW1 A;  6GSV A;  2BMX A;  3GKX A;  6GSY A;  2QA2 A;  3KMN A;  2VCQ A;  2VUP A;  3LEF A;  4K7I A;  5ECI B;  4EE0 A;  20GS A;  4IEL A;  3LW9 A;  2L57 A;  5HR3 A;  4G2E A;  3PGT A;  4MDC A;  3ZFL A;  3QCP A;  2O8V B;  2VL2 C;  2PVQ A;  1AW9 A;  3TDG A;  1GTU A;  1ML6 A;  5A4W A;  3R2Q A;  5F06 A;  3EU3 A;  2H72 A;  5JCG A;  1YEP A;  2JSZ A;  1K0C A;  4N10 A;  1M2D A;  1OC9 A;  22GS A;  4IGJ A;  5H5Q A;  3GL3 A;  1VGL A;  4AGS A;  4WXT A;  5KOX A;  3P2A A;  2I81 A;  3KD0 A;  3H79 A;  3E3E A;  3ZRE A;  1VF3 A;  4N0Z A;  5KN3 A;  2ON7 A;  4KW6 A;  3RAZ A;  3F63 A;  1Z3E A;  3TCO A;  2V41 A;  2NTO A;  1UC7 A;  1T3B A;  2FWG A;  4KUN A;  4RI7 A;  1B9Y C;  5LNK e;  5GZZ B;  2A2R A;  2FY6 A;  5BMU A;  1A0F A;  1JZR A;  2YP6 A;  2HYX A;  1QUW A;  4BA7 A;  3LG6 A;  2QSI A;  3E0U A;  2O36 A;  4MJE A;  5HFK A;  4AJ6 A;  4JBB A;  1GSD A;  4JU5 A;  3UL3 A;  3F4T A;  3MNG A;  2C0E A;  3VUR A;  1F2E A;  2L4C A;  3CMI A;  1LJR A;  5BRT A;  1RK4 A;  3DVW A;  2OE3 A;  1FHE A;  1SD8 A;  4GWR A;  3FW2 A;  2JSY A;  1ACV A;  5IPG A;  2GSS A;  3UIW A;  1GSY A;  2CA8 A;  5HR1 A;  1MD4 A;  4ZB8 A;  5IOX A;  1OKD A;  3QD9 A;  4MZW A;  2WVZ A;  1LU4 A;  18GS A;  1XOA A;  4YKG A;  3ZIT A;  3EE2 A;  2MMZ A;  4YQU A;  3GX0 A;  3MIX A;  5A4U A;  2MBS A;  1FW1 A;  3VWV A;  5A5H A;  4MLY A;  4K5S A;  1BED A;  1SD9 A;  3FZ5 A;  5INY A;  2H19 A;  1DUG A;  1K0A A;  3F6F A;  3NIV A;  1XWC A;  3GST A;  4PHZ C;  3GV1 A;  4OCE A;  2DJJ A;  3IK7 A;  1GSE A;  1JLW A;  5ECO B;  2K6V A;  2RLI A;  2VAF A;  2H0H A;  1B8X A;  3FR3 A;  1K0D A;  5A34 B;  4KB3 A;  1E6B A;  2H1A A;  3I43 A;  4KX4 A;  1T4Z A;  3UEM A;  1MDI A;  2CT6 A;  4MAB A;  3MAK A;  5F8B A;  1YQ1 A;  3VWU A;  2AYT A;  1E2Y A;  4X0X A;  2OE1 A;  2RM5 A;  3A3T A;  3HJO A;  1K3Y A;  4CY8 A;  3GKM A;  3LSZ A;  2RII A;  4G19 A;  3D4M A;  1JFU A;  2YAN A;  2PWJ A;  2E2G A;  1K3L A;  4HI7 A;  2HRA A;  1GWC A;  1XW9 A;  1TKD B;  5KN2 A;  3CSI A;  2L59 A;  4FYU A;  4OCF A;  2TRC P;  1X9S B;  3HYP A;  4K0N A;  3LFL A;  1QK8 A;  2HT9 A;  1GSS A;  2HE3 A;  4GCI A;  2JAC A;  2WW3 A;  4G01 A;  5ENU A;  4K2D A;  3GA4 A;  2B3S A;  1TDI A;  3M0F A;  3TJK A;  10GS A;  5ID2 B;  3CRT A;  3FHK A;  5DAL B;  1PN0 A;  4ZB7 A;  4KCA A;  3CRU A;  4ECJ A;  2VLV A;  2F51 A;  4ZIL A;  2GST A;  5IM9 A;  1ZYN A;  2D2Z A;  3GTU B;  1URM A;  1TRS A;  3RFR C;  1FOH A;  4YAP A;  2O89 A;  4XRA A;  5A5K A;  2PUK C;  1TOF A;  9GSS A;  1YF1 A;  5DAK B;  4AKX B;  4K1F A;  1TRW A;  5GAN D;  2IMD A;  1K0B A;  2B7K A;  2B5X A;  4HU9 A;  3RPP A;  3IV4 A;  2DLX A;  1GRX A;  4GF0 A;  3IR4 A;  3GYK A;  4ILF A;  4TR3 A;  3KP8 A;  5CAX A;  1WIK A;  3PR8 A;  5G1K A;  1B48 A;  1V9W A;  14GS A;  3TU3 B;  3L0H A;  2RUF A;  4J2F A;  2QA1 A;  4HUA A;  2R4V A;  5CRD A;  2LUS A;  3O76 A;  5HR0 A;  5CRH A;  4JE1 A;  2VIM A;  5DQY A;  4IVF A;  4EIQ A;  5ECR B;  1OAZ A;  1Z6M A;  4TXO B;  4ULX A; 
#chains in the Genus database with same CATH homology
 2KP1 A;  2H76 A;  2VCZ A;  2HZE A;  3IHG A;  4OFN A;  3GSS A;  4MJA A;  4AKI A;  3I9V 2;  4PUF C;  2G0F A;  3P7X A;  2H1L A;  2JZS A;  5L71 A;  1X5C A;  5ECM B;  1ST9 A;  3VI7 A;  1C72 A;  4KF9 A;  4G0K A;  4K2X A;  2MMO A;  2VLU A;  5IMC A;  3ZML A;  3EMX A;  5AIV A;  1SVL A;  3EPT A;  1BYE A;  2JAD A;  2EFE A;  4MPF A;  3K8N A;  5JWO B;  4XIH A;  1SK0 A;  2A4V A;  3RHC A;  1R4W A;  1S3C A;  3DIE A;  5D73 A;  4ZBA A;  3ZLP A;  1T8E B;  2IPA A;  1X5D A;  5EY6 A;  5IMZ A;  3VK9 A;  2K8S A;  4WR5 A;  3HDC A;  1EP7 A;  2H1D A;  2AAW A;  2CAI A;  3GUR A;  1OC9 B;  2XBQ A;  4IQ1 A;  3LWA A;  3KH9 A;  2H1B A;  4WR4 A;  4EXJ A;  2YWN A;  5EL8 A;  2LST A;  4F03 A;  4ISD A;  1JZW A;  3UAR A;  2H6X A;  1OE7 A;  2LNT A;  3L78 A;  3FZ9 A;  4MH3 A;  1YY7 A;  2CX4 A;  4O5R A;  2DBC A;  2PN8 A;  2CQ9 A;  3DEX A;  3WGX A;  1WOU A;  5BMU B;  2QC7 A;  2HZF A;  5ID2 A;  1X9M B;  3HA9 A;  1ZCP A;  3HJM A;  3LQ7 A;  4FYB A;  3KP9 A;  2FA8 A;  5DJL A;  1XZO A;  2MZC A;  3KM6 A;  5FT3 A;  3NZN A;  1F3B A;  3WYW A;  2VCT A;  2O7K A;  2F9S A;  4GQF A;  1AQX A;  3GL5 A;  3BD2 A;  2GS3 A;  4MH2 A;  4MZC A;  3FKF A;  1VF2 A;  2O85 A;  1GLQ A;  3IC8 A;  1JLV A;  2HRN A;  2IWT A;  3DGQ A;  4I6X A;  3ERG A;  4ZB6 A;  3M1G A;  2OAD A;  5J4V A;  5HFI A;  2F8A A;  3GIX A;  1GLP A;  2O87 A;  1KNG A;  2DJ3 A;  2DIY A;  4HU7 A;  1BG5 A;  3U6V A;  2GZZ A;  1X5E A;  1BJX A;  4V2N A;  2DIZ A;  5A5H B;  4P3Y B;  4D73 A;  2PVO C;  2GQK A;  4DSS A;  2GQM A;  2H1G A;  1LBK A;  4Z2R A;  1PKW A;  3DVX A;  3APQ A;  2YN1 A;  1O6J A;  4V2M A;  4BVY A;  4DEJ A;  5IMV A;  1ZYP A;  2CZ3 A;  2ZCT A;  2OJL A;  2C8U A;  3IHQ A;  4NXI A;  2V2G A;  1ZYQ B;  2PER A;  4IKH A;  1M0U A;  4TR1 B;  1PGT A;  2LTK A;  2GZP A;  3EMP A;  4IN0 A;  2HNL A;  4HOJ A;  1QQ2 A;  2DJ1 A;  1EZK A;  4GSN A;  3KMO A;  4JED A;  3GFK A;  3VLN A;  3R3E A;  2NVL A;  1TK0 B;  3GNJ A;  1EV4 A;  5ECN B;  2YWI A;  2X4A A;  1ABA A;  3C1R A;  4PUR A;  1XWA A;  1BG1 A;  5KN1 A;  1AXD A;  2OT3 A;  2H71 A;  3CSJ A;  1GH2 A;  2GT5 A;  4I2U A;  3H8Q A;  3FZ4 A;  3WGD A;  3KIJ A;  2X8G A;  3ZL5 A;  1XCC A;  1AAZ A;  3QFB C;  2CVK A;  4MMM A;  2C0F A;  1WWJ A;  1PX7 A;  4EF0 A;  2E7P A;  3S9F A;  4OWY A;  2OKA A;  4OFM A;  4LMW A;  2WZ9 A;  1XBS A;  4EUY A;  16GS A;  3TKP A;  2UV8 G;  3D0Z A;  4NPB A;  4NV2 A;  4YH2 A;  2C0G A;  3E9J B;  3TB2 A;  2HLS A;  1J9B A;  2VLT A;  3APS A;  3D4T A;  1KEB A;  5B6N A;  4ZBB A;  1GSU A;  1SL2 B;  4Q5R A;  1XOB A;  4I2T A;  3GH6 A;  3P90 A;  1PMT A;  2I3Y A;  3ZRD A;  4OO5 A;  2VO4 A;  5A1N A;  4O7H A;  4A5P A;  4KND A;  3WT1 A;  4LL1 B;  4L0W A;  3TJJ A;  4TXV A;  2FWE A;  2HRK A;  2L5O A;  1OKT A;  2PPT A;  5DJM A;  5G1L A;  2DML A;  5D96 A;  3D5J A;  1Z7P A;  1PSQ A;  3US3 A;  3CWG A;  1Z5Y E;  1A8L A;  5HFG A;  2K18 A;  4XCS A;  3TKS A;  4Z2U A;  2EFD A;  2E2M A;  3HMJ G;  1ZOF A;  3ZYW A;  1QGV A;  4YKF A;  3KXO A;  3EU4 A;  3ED3 A;  2HZE B;  1ZGN A;  2MBT A;  4ICY A;  4GXZ A;  5B7C A;  1K0N A;  2FGX A;  5J4Y A;  2O5V A;  2ES7 A;  1TK5 B;  1Z9H A;  4K7O A;  2L6C A;  2LNS A;  2M80 A;  1V40 A;  3W6G A;  2XPE A;  1M9B A;  5IMD A;  1TU8 A;  2ZUP A;  2YV9 A;  4F0B A;  4KH7 A;  2GZY A;  2AJQ B;  5CYY A;  3HKR A;  3LYK A;  1QFN A;  3A5W A;  3N9J A;  4TR1 A;  2IN3 A;  3M8N A;  1GUK A;  3G7J A;  4MF6 A;  3W8S A;  4Q5N A;  4IHU A;  3BOA A;  5G5F A;  4HQZ A;  2CZ2 A;  5C04 A;  4CW9 A;  2UZ8 A;  1FVK A;  3KTL A;  4WEY A;  4PNG A;  1R5P A;  1GTB A;  2OE0 A;  4NWY A;  5IIZ A;  3W8J A;  2R2J A;  2IMF A;  5CRG A;  1AIU A;  3LGC A;  4WET A;  2WDU A;  1Y6E A;  5IO2 A;  4CY6 A;  2LEG A;  4PQH A;  4GDF A;  4TR0 A;  3MSZ A;  4CDO A;  2PGT A;  1U88 A;  3H4K A;  2YOI A;  3BCK A;  4PUA A;  3C7M A;  3FMW A;  3N5O A;  1XW5 A;  3FR6 A;  4O5Q A;  3F9U A;  3QPM A;  5CNW A;  2YCD A;  1PX6 A;  3QFA C;  1YF0 A;  2VL2 A;  1J0F A;  4KDY A;  2WCI A;  4K5R A;  1FOV A;  3CYN A;  2VD0 A;  4RI6 A;  4H86 A;  1SL1 B;  2YWM A;  1TRU A;  2C3N A;  7GSS A;  2HQT A;  1EEJ A;  2EIR A;  3HZ4 A;  3FEU A;  4GSS A;  5JWR B;  1ERT A;  1I9D A;  4BPY A;  1X9W B;  5GST A;  2V1M A;  3HCZ A;  4J57 E;  2LQQ A;  2DMM A;  1F9M A;  2BTO T;  1FO5 A;  1HNA A;  4BL7 A;  2HRF A;  4PXO A;  3IXR A;  5ABR A;  1T4Y A;  5AGY A;  1EOH A;  1YKA A;  2AUV A;  4IJ3 A;  3ZIJ A;  1A2M A;  3HJP A;  4V2L A;  3GUS A;  3TUE A;  5HQP A;  4NMU A;  1W89 A;  1EGR A;  2H73 A;  5B8A A;  2B5Y A;  2CV4 A;  4PTS A;  4TVE A;  4NAX A;  1G6W A;  4D73 B;  5GSS A;  3APO A;  4O92 A;  4DSS B;  5KN0 A;  4K7N A;  3GHA A;  3TJB A;  3ME7 A;  4HZ4 A;  4JZQ A;  3ZIV A;  3RPN A;  4IQA A;  2VL3 A;  3DD3 A;  2P0G A;  4BVY B;  4POB A;  4WBJ A;  5EVO A;  3I6A A;  2V6K A;  4LA1 A;  3QOU A;  3CTG A;  1SVO A;  1GNW A;  4X1U A;  3MWH A;  2RM6 A;  3OR5 A;  3TKR A;  1XPV A;  4FYC A;  2VD1 A;  4E68 A;  5D93 A;  3EIN A;  4K8M A;  1K3O A;  5DDL A;  3DML A;  4XS4 A;  3F8U A;  3EUR A;  2NPB A;  3ZVJ A;  5J47 A;  1GTI A;  1HQO A;  2MMA A;  1TK8 B;  2B7J A;  3M3M A;  5EPF A;  4FIW A;  1O8X A;  3ZVJ D;  4I97 A;  2GT6 A;  5CO3 A;  4MZB A;  4O32 A;  2EIQ A;  4ZIJ A;  3FY7 A;  3IA1 A;  3AY8 A;  2HSM B;  2GTU A;  3L4N A;  2YWO A;  1RQM A;  1Q4J A;  4ML1 A;  4OO4 A;  1WMJ A;  5D9X A;  4DSQ A;  2VOC A;  6GSX A;  3KTB A;  3HVX A;  1THO A;  1ERW A;  2HSY A;  1M2A A;  3U5R E;  3TKS E;  2HI7 A;  3FZA A;  4G0L A;  5COH A;  1ZYE A;  4NHZ A;  1O85 A;  4G0I A;  1MD3 A;  1J08 A;  3F3Q A;  1Q98 A;  4EL1 A;  1SKW B;  3CXG A;  1WP0 A;  2AHE A;  1ZMA A;  4XRD A;  5H5S A;  3P8W A;  4TW5 A;  2JU5 A;  4ID0 A;  2GSQ A;  1G7O A;  1GSF A;  1GUL A;  2CX3 A;  1U3A A;  4DSR A;  1NW2 A;  1OC8 A;  3UVT A;  1CQH A;  2DJ0 A;  4BVX A;  5J3R A;  4IP1 A;  3PH9 A;  2LJA A;  1HNC A;  5J41 A;  1EGO A;  11GS A;  2FD3 A;  3L9V A;  1XW6 A;  1QMV A;  3O3T A;  4PGT A;  1DBY A;  4EC0 A;  2DSA A;  3BJ5 A;  4K0G A;  5A1N B;  5F05 A;  4K6X A;  1YZX A;  3HY2 A;  3EWL A;  2R6K A;  3TGZ A;  4AJ7 A;  1KTE A;  1A24 A;  2HRK B;  1SYR A;  4ECB A;  1A0R P;  2LS5 A;  6GSU A;  4QQ7 A;  2V32 A;  4F82 A;  3TRX A;  5CRW A;  1SVM A;  3EVI A;  1YEX A;  1N2A A;  5G5E A;  3C1S A;  4KA0 A;  2TIR A;  1EOG A;  1SU9 A;  2DKI A;  1KBN A;  1TP9 A;  4MNN A;  2H0I A;  4ACS A;  2GVP A;  2IIY A;  5J9B A;  1TW9 A;  5J5N A;  5CP1 A;  3V1W A;  1HD2 A;  4GLT A;  2XC2 A;  4NV5 A;  1GL8 A;  2FCH A;  3MDK A;  2XHF A;  2N5B A;  4XS1 A;  3UOM A;  2FNO A;  4LL4 B;  1UA5 A;  4FQU A;  4V1A g;  2M46 A;  1HYU A;  2LKU A;  1XWG A;  2R5G A;  1FG4 A;  1G7E A;  2R37 A;  4DVC A;  5J40 A;  4L8E A;  1WRY A;  3C71 A;  3HXS A;  3H93 A;  2DC5 A;  2X8H A;  3KZQ A;  1U87 A;  4GQC A;  2DJK A;  2AV4 A;  2C1Y A;  5AIS A;  2NBS A;  2M72 A;  1EV9 A;  1MEK A;  5IO0 A;  1DSB A;  1U6T A;  4F2I A;  4MP4 A;  12GS A;  3IAM 2;  2X99 A;  3RDW A;  13GS A;  4ZXG A;  2X64 A;  2IFQ A;  3ISO A;  1WJK A;  3A2W A;  2PU9 C;  4IS0 A;  5ECQ B;  3IPZ A;  5J9C A;  1F37 A;  1MDK A;  1FB6 A;  5DCG A;  5KEJ A;  1H4O A;  2HFD A;  1VF4 A;  3BCI A;  1JZD A;  1UN2 A;  5JWQ B;  1N25 A;  4ZL8 A;  5IMA A;  4KSM A;  2AB6 A;  2HSM A;  4PQI A;  5DBQ A;  3Q74 A;  1SEN A;  2Z9S A;  4ML6 A;  2PBJ A;  4ZB9 A;  2WGR A;  5E4W A;  2J9H A;  2TRX A;  2H6Z A;  1K0O A;  1I5G A;  4KCE A;  2PMT A;  2WRT A;  3G7I A;  3FR9 A;  5JCU A;  2L5L A;  2DJ2 A;  1FVJ A;  4E8E A;  4EDY A;  3Q6O A;  3UBL A;  1R7H A;  1MTC A;  1WPI A;  1JHB A;  1OYJ A;  2KUC A;  4HEA 2;  5D9V A;  3D21 A;  4Q5Q A;  2IMK A;  3LXT A;  5F0G A;  5LD0 A;  2YPM A;  4MF7 A;  2LJK A;  3VPT A;  4AJ8 A;  1IYH A;  2OBI A;  3GX8 A;  3KCM A;  4L5L A;  2VL9 A;  3DWV A;  1F3A A;  4ZL9 A;  4ECC A;  1OC3 A;  2YZH A;  5ECP B;  4OMV A;  2GLR A;  4BL7 B;  3A2V A;  2H75 A;  4F9Z A;  5B8B A;  1FB0 A;  2C80 A;  3CBU A;  1PD2 1;  4TOP A;  1PA3 A;  3LYP A;  1M7T A;  4BWQ A;  1A23 A;  3ME8 A;  1PQN A;  4N30 A;  5C00 A;  2LRN A;  3QDN A;  1M99 A;  1BAY A;  5ECK B;  1TXU A;  3SWL A;  2H66 A;  5LCZ A;  2H8L A;  2J23 A;  4I5Q A;  3J7Y k;  2LRC A;  4G10 A;  2WB9 A;  2N5A A;  1GUH A;  4G9H A;  5KOW A;  5JCW A;  2WJU A;  4AKG A;  4NHW A;  5ECS A;  1ERU A;  4LLR A;  1K0M A;  1X0R A;  2VM2 A;  3O6T A;  4MJC A;  4USS A;  4TR4 A;  3J7Y b;  2LQO A;  3IC4 A;  5ECH B;  3TRP A;  3VFI A;  2VM1 A;  2YJH A;  2GQL A;  1M2B A;  3UVH A;  1PRX A;  2I1U A;  4GRF A;  2CAQ A;  1T7P B;  1BX9 A;  2C3T A;  4XS4 B;  1SYX A;  4JR4 A;  1Y25 A;  4IJI A;  1T1V A;  2IMI A;  3Q19 A;  1Z7R A;  4POL A;  1TI3 A;  1S3A A;  1TRV A;  4KAE A;  1AC1 A;  1USB A;  6GST A;  2IJY A;  5DQS A;  3F6D A;  4FH8 A;  1B9X C;  4WBR D;  2H0G A;  3UBK A;  3WT2 A;  4XTS A;  2GSR A;  2EC4 A;  2C4J A;  5IMF A;  3FRC A;  3GKN A;  1AQW A;  3JCM L;  2GDR A;  5AIX A;  1PL1 A;  2P31 A;  1MDJ A;  1O8W A;  2OAC A;  3M9J A;  4GST A;  1O81 A;  5J4U A;  3C73 A;  3ERW A;  3Q18 A;  4HDE A;  2L4Q A;  3TRQ A;  2F3M A;  4KDX A;  3LJR A;  4RUV A;  1FAA A;  1NHY A;  3KGK A;  4GTU A;  1THX A;  3GMF A;  2B1L A;  1PL2 A;  4ECI A;  4PX1 A;  1YDK A;  3SBC A;  3GN3 A;  1SKS B;  3A5I A;  4BVX B;  2IL3 A;  1PN9 A;  1V58 A;  5D9T A;  4PNF A;  1TU7 A;  3TJF A;  1B4Q A;  2B1K A;  5ELA A;  2VCV A;  1T00 A;  4FO5 A;  1ERV A;  3MYD A;  4KE3 A;  3C8E A;  2EFH A;  1G6Y A;  3H1N A;  1GTA A;  1R26 A;  3QAV A;  1NHO A;  2H74 A;  2XPD A;  4X43 A;  1SKR B;  3RBT A;  1NM3 A;  4E8H A;  4EVM A;  1SJZ A;  4TRX A;  1W4V A;  3KEB A;  4MCU A;  3HD5 A;  3D22 A;  4K9Z A;  2A4H A;  1Z6N A;  2X8C A;  3TJG A;  4RQR A;  2H70 A;  4WF5 A;  2X49 A;  1VF1 A;  5GAP D;  1UVZ A;  2HSH A;  5FWG A;  3WD6 A;  4XHM A;  4TKY A;  1SL0 B;  2WS2 A;  4YQM A;  3QMX A;  5B6M A;  1OVN A;  1SK2 A;  2G2Q A;  3A2X A;  4KDU A;  2GGT A;  1XFL A;  2MYG A;  1O7U A;  2VCW A;  1N8J A;  3WGE A;  3PIN A;  3CTF A;  4MPG A;  4HQS A;  4YAV A;  4IBP A;  2K8V A;  2FLS A;  3LXZ A;  4N0V A;  3VWW A;  3GRX A;  5IOW A;  1M9A A;  3EYT A;  1XVQ A;  1NSW A;  3D6I A;  3HHV A;  4HZ2 A;  2IFQ B;  3M9K A;  5ECL B;  4KSO A;  3ZMK A;  2OBK A;  1S3D A;  1VRS D;  1ZL9 A;  3F0I A;  4ZBD A;  2WUL A;  4F0C A;  2ON5 A;  3DKS A;  3DYR A;  2IME A;  1V2A A;  4I8B A;  5IQY A;  1F6M C;  3VI5 A;  2H01 A;  3HVS A;  1SJ6 A;  4JRR A;  2F8F A;  3KH7 A;  2QKE A;  2DKH A;  1A8Y A;  2RUE A;  1IYI A;  2LJR A;  19GS A;  4J56 E;  2HSN B;  2JZR A;  5D9W A;  3VWX A;  4CHS A;  2B5E A;  3PPU A;  2WFC A;  4EIP A;  5A34 A;  4N3Z A;  2R0G A;  3DRN A;  1DE1 A;  4YQV A;  2YZU A;  6GSW A;  4AI6 A;  1A2L A;  1G0T A;  2A2S A;  2CVB A;  1EEM A;  3L9S A;  3FK8 A;  4ZL7 A;  1XXU A;  2FA4 A;  1QXH A;  4QL7 A;  4IW9 A;  3F4S A;  1AQV A;  4EDZ A;  2C3Q A;  1WE0 A;  2I4A A;  4L5O A;  1XIY A;  4HS1 A;  1HNB A;  4RQX A;  1SJI A;  4EO3 A;  2C0D A;  1TI1 A;  2H6Y A;  3BBY A;  1AUC A;  2B6M A;  2OA7 A;  3QR6 A;  4XS6 A;  4AF2 A;  4WKW A;  2A2P A;  3GKK A;  2EIO A;  2FHE A;  1B4P A;  3I69 A;  4Q5F A;  3L9U A;  3IBH A;  3IOS A;  3IDV A;  1BQ7 A;  2R0C A;  4QL9 A;  2FWH A;  2HXK A;  1TXX A;  1BF5 A;  5FHI A;  4Z2T A;  5DAL A;  3DXB A;  1YKC A;  1ZZY A;  1ILO A;  4Z7X A;  4MK3 A;  2KLX A;  4HJM A;  4L0U A;  4O5U A;  3UMA A;  1GSQ A;  2K9F A;  2YJ7 A;  4POM A;  1V57 A;  4X4J A;  5H5R A;  3GTU A;  1V98 A;  4N11 A;  1SK1 A;  3TKS C;  4IP6 A;  2N5F A;  3QAG A;  2FWF A;  17GS A;  1OE8 A;  1YVL A;  4HJ2 A;  1EP8 A;  1Y1U A;  1O73 A;  2XBI A;  4MA9 A;  3TKQ A;  3IK9 A;  3IE3 A;  3NOF A;  1H75 A;  3UAP A;  3KJY A;  3G9B A;  5DCH A;  2R3X A;  5DAK A;  2MMN A;  2QGV A;  3G7Y A;  2KP2 A;  2P5R A;  5HR2 A;  2EFC A;  2NDO A;  4BWS A;  3ERF A;  2VKZ G;  4QMK A;  2E0Q A;  4MF5 A;  1GUM A;  1U3I A;  4WF4 A;  3IRA A;  1R5A A;  3ZFB A;  2FUG 2;  4PQ1 A;  3ZZX A;  2H30 A;  3UJ1 A;  2ALB A;  5ELG A;  2YV7 A;  3F3R A;  4V1A p;  3LOR A;  5DVB A;  1TJD A;  1TTZ A;  2L6D A;  4LMV A;  4KGI A;  1EWX A;  5IPH A;  1ON4 A;  1JZO A;  5CRE A;  5E59 A;  2R0P A;  1XWK A;  5A4V A;  3GH9 A;  5G2Z A;  3FYG A;  3HVV A;  2JZT A;  5G31 A;  4OFT A;  4W66 A;  3ZTL A;  4AKH A;  1GNE A;  4JR6 A;  4EKZ A;  2CVD A;  1XVW A;  1PKZ A;  3CSH A;  3RHB A;  2JL4 A;  4TXO A;  4OD7 A;  2BJX A;  2KHP A;  4POK A;  2REM A;  2ZNM A;  3IAS 2;  1YJ6 A;  2LRT A;  4TN8 A;  1XWB A;  2KOK A;  4MJB A;  6GSS A;  2V6O A;  1GP1 A;  1DE2 A;  1RW1 A;  1CQG A;  3F4R A;  2LV3 A;  5G30 A;  2VCX A;  3TOU A;  2P5Q A;  3QAW A;  3VPQ A;  2I9H A;  3HZ8 A;  5F07 A;  5D8I A;  2YNX A;  1A2J A;  2HSN A;  8GSS A;  3EC3 A;  5AN1 A;  3TOT A;  6GSV A;  2BMX A;  3GKX A;  6GSY A;  2QA2 A;  3KMN A;  2VCQ A;  2VUP A;  3LEF A;  4K7I A;  5ECI B;  4EE0 A;  20GS A;  4IEL A;  3LW9 A;  2L57 A;  5HR3 A;  4G2E A;  3PGT A;  4MDC A;  3ZFL A;  3QCP A;  2O8V B;  2VL2 C;  2PVQ A;  1AW9 A;  3TDG A;  1GTU A;  1ML6 A;  5A4W A;  3R2Q A;  5F06 A;  3EU3 A;  2H72 A;  5JCG A;  1YEP A;  2JSZ A;  1K0C A;  4N10 A;  1M2D A;  1OC9 A;  22GS A;  4IGJ A;  5H5Q A;  3GL3 A;  1VGL A;  4AGS A;  4WXT A;  5KOX A;  3P2A A;  2I81 A;  3KD0 A;  3H79 A;  3E3E A;  3ZRE A;  1VF3 A;  4N0Z A;  5KN3 A;  2ON7 A;  4KW6 A;  3RAZ A;  3F63 A;  1Z3E A;  3TCO A;  2V41 A;  2NTO A;  1UC7 A;  1T3B A;  2FWG A;  4KUN A;  4RI7 A;  1B9Y C;  5LNK e;  5GZZ B;  2A2R A;  2FY6 A;  5BMU A;  1A0F A;  1JZR A;  2YP6 A;  2HYX A;  1QUW A;  4BA7 A;  3LG6 A;  2QSI A;  3E0U A;  4MJE A;  5HFK A;  4AJ6 A;  4JBB A;  1GSD A;  4JU5 A;  3UL3 A;  3F4T A;  3MNG A;  2C0E A;  3VUR A;  1F2E A;  2L4C A;  3CMI A;  1LJR A;  5BRT A;  1RK4 A;  3DVW A;  2OE3 A;  1FHE A;  1SD8 A;  4GWR A;  3FW2 A;  2JSY A;  1ACV A;  5IPG A;  2GSS A;  3UIW A;  1GSY A;  2CA8 A;  5HR1 A;  1MD4 A;  4ZB8 A;  5IOX A;  1OKD A;  3QD9 A;  4MZW A;  1LU4 A;  18GS A;  1XOA A;  4YKG A;  3ZIT A;  3EE2 A;  2MMZ A;  4YQU A;  3GX0 A;  3MIX A;  5A4U A;  2MBS A;  1FW1 A;  3VWV A;  5A5H A;  4MLY A;  4K5S A;  1BED A;  1SD9 A;  3FZ5 A;  5INY A;  2H19 A;  1DUG A;  1K0A A;  3F6F A;  3NIV A;  1XWC A;  3GST A;  3GV1 A;  4OCE A;  2DJJ A;  3IK7 A;  1GSE A;  1JLW A;  5ECO B;  2K6V A;  2RLI A;  2VAF A;  2H0H A;  1B8X A;  3FR3 A;  1K0D A;  5A34 B;  4KB3 A;  1E6B A;  2H1A A;  3I43 A;  4KX4 A;  1T4Z A;  3UEM A;  1MDI A;  2CT6 A;  4MAB A;  3MAK A;  5F8B A;  1YQ1 A;  3VWU A;  2AYT A;  1E2Y A;  4X0X A;  2OE1 A;  2RM5 A;  3A3T A;  3HJO A;  1K3Y A;  4CY8 A;  3GKM A;  3LSZ A;  2RII A;  4G19 A;  3D4M A;  1JFU A;  2YAN A;  2PWJ A;  2E2G A;  1K3L A;  4HI7 A;  2HRA A;  1GWC A;  1XW9 A;  1TKD B;  5KN2 A;  3CSI A;  2L59 A;  4FYU A;  4OCF A;  2TRC P;  1X9S B;  3HYP A;  4K0N A;  3LFL A;  1QK8 A;  2HT9 A;  1GSS A;  2HE3 A;  4GCI A;  2JAC A;  4G01 A;  5ENU A;  4K2D A;  3GA4 A;  2B3S A;  1TDI A;  3M0F A;  3TJK A;  10GS A;  5ID2 B;  3CRT A;  3FHK A;  5DAL B;  1PN0 A;  4ZB7 A;  4KCA A;  3CRU A;  4ECJ A;  2VLV A;  2F51 A;  4ZIL A;  2GST A;  5IM9 A;  1ZYN A;  2D2Z A;  3GTU B;  1URM A;  1TRS A;  1FOH A;  4YAP A;  2O89 A;  4XRA A;  5A5K A;  2PUK C;  1TOF A;  9GSS A;  1YF1 A;  5DAK B;  4AKX B;  4K1F A;  1TRW A;  5GAN D;  2IMD A;  1K0B A;  2B7K A;  2B5X A;  4HU9 A;  3RPP A;  3IV4 A;  2DLX A;  1GRX A;  4GF0 A;  3IR4 A;  3GYK A;  4ILF A;  4TR3 A;  3KP8 A;  5CAX A;  1WIK A;  3PR8 A;  5G1K A;  1B48 A;  1V9W A;  14GS A;  3TU3 B;  3L0H A;  2RUF A;  4J2F A;  2QA1 A;  4HUA A;  2R4V A;  5CRD A;  2LUS A;  3O76 A;  5HR0 A;  5CRH A;  4JE1 A;  2VIM A;  5DQY A;  4IVF A;  4EIQ A;  5ECR B;  1OAZ A;  1Z6M A;  4TXO B;  4ULX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...