8LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA01
3ZV9A 1GCTB 1T8LA 1TNIA 5F8XA 3GDSA 4X1PU 3MNCA 1ZSKA 1ZYOA 2ZTXA 4CHAB 2A1DB 1FONA 2ZWLH 3UREA 2WPLS 3SN8A 2JETC 3A7ZA 1W13U 2OINA 1YPHC 2A7CA 2CMYA 3QUMP 1ZJDA 1QA7A 3LJOA 5A0AE 5C2ZA 1O33A 1BMMH 2PKAA 2BLVA 1TALA 1GI4A 3V12A 2QF0A 1OS8A 1W3CA 3ZZ4A 1TNKA 3P8NA 5C5NA 4DIIH 1TA2A 2VGCB 1MUEB 1Q3XA 4I8KA 3P95A 4DY7B 2A0QB 1RTFB 3V7TA 2SGDE 2GCHG 1OKXA 3BN9A 2TIOA 1GVZA 5K0HA 1JRTA 3SU4A 1O5GH 4CH2B 2SNWA 2BOHB 1K22H 2G5NA 4VGCC 1XM1A 1SGRE 4OGXA 3FANA 4I8JA 1FV9A 3AASA 1RIWC 3K6YA 1SBWA 4ZXXH 1EAXA 2J95A 1MCTA 2BOKA 3VXEH 2HPQH 4FUCA 1O2TA 4GCHF 2FOMB 4X6PA 3SNCA 4MPWA 1W2KH 1PJPA 4K5ZA 3U8TH 1C1UH 1F0RA 1DSTA 2VWMA 1SGIB 4A7IB 2H5DA 2DUCA 1P9UA 4HZHA 2FS9A 2ZDKA 3NWUA 2P59A 1QB6A 5DP4A 1FAKH 1BQYA 3UWIA 2F9VA 1TRYA 1CBWC 2WPIS 4CRCA 2VWLA 4OGYA 4MVNA 2Z3EA 1VCPA 1UTKA 2Y81A 3UQVA 4I8GA 3SHCH 4M7GA 2BZAA 3E0PB 1TA6A 1YPGH 2FXRA 1DT2A 2OC7A 3KCGH 3GCNA 2FOAA 3Q3XA 2A5KA 3FAOA 3U69H 3LPRA 4DGJA 4AOQA 1Z7KA 3QGJA 1SI5H 3RXGA 5HYOA 1UHBA 1EX3A 2FODA 1JWTA 1AVGH 4AYYB 2AEIH 1C2GA 4E06H 3GYLB 2PFEA 4MNVA 3LGIA 1J8AA 3RXSA 3A89A 4ZKNU 4KP0A 2SGPE 3UY9A 1L1NA 1MTUA 2I6SA 3URCA 5FCKA 2HNTF 2JH5D 1WAYB 2C90B 3LONA 1F2SE 1HV7A 2ZHDA 2XC5A 2EI6A 5FX5A 1BOQA 2XC0A 4RN6A 3BIVH 5ESBA 5H4IB 2FOEA 3F1SB 1FQ3A 1SLXB 2PKSB 1V2RT 1GDNA 2I6QA 3H5CB 1EPTA 4AB8A 3H7OA 5FCRA 1GMDF 3UNQA 2CF8H 4Q2KA 1FUJA 2ZU1A 1V2JT 2UWLA 4K60A 3FFGA 1TB6H 2PUQH 4Y8ZA 2Q6DA 3PTBA 2BDBA 3RM0H 1X7AC 1O2NA 1CT2E 1SGEE 2J94A 2ZPSA 4DIHH 1A3EH 4AX9H 4Y7BA 1ZGIA 1Z8JB 1D3TB 1O2WA 4GHQA 1MTWA 3UFAA 1L1JA 1BTUA 1CGJE 1T8OA 3S0NA 3SO3A 8ESTE 5I46H 1SGFA 3KGPA 1HLTH 4AFZA 5ABWA 3K9XB 3UPEA 3RXJA 4ISOA 1C1RA 1PPHE 1TPOA 4JZIA 3GISB 1TYNA 2OBOA 2WPKS 4UE7H 3D65E 2NU0E 3RXOA 3C1KA 1UCYE 2VU8E 3UUZA 1C5YB 1K1MA 4BAOB 1UVSH 3OY5U 4JK5A 1K28D 4TY7A 2Q6GA 2UUKB 1ZPZA 1TPSA 2QAAA 1TNJA 5DP5A 2J92A 3LKWA 2AH4X 2GGVB 2BHGA 2VIWA 4WWYA 1GJ4H 2VIPA 1Z71A 2FWWA 1F0TA 4ABIA 1A3BH 3TITA 3TJVA 1YF4A 1GBKA 1NFXA 2K1QA 2CXVA 1C4V2 2ZU4A 4JMYA 3ZZAA 2ZGBH 4NIVA 1P03A 4WVPE 3ATWA 1EB1H 1EXFA 1OWHA 2QGRA 3K2UA 2BD8A 3S9BA 4FUJA 1TX6A 2ZEBA 3BEFB 2WUBA 1GBDA 1Z6EA 2WV5A 1H9LB 4YT7H 5GCHG 1DICA 3U9AH 3M3SA 1MBQA 3SQHE 3LGUA 1VZQH 3QO6A 1L2EA 1AUJA 1E0FD 1AWHB 1XVMA 3EDXB 2A4RA 3E91A 1WTHD 2EC9H 1N8OB 3SQEE 3V13A 4ABDA 3MFJA 2QF3A 1EPTC 3L3TA 4Y7AA 4AGJA 1DSUA 3Q76A 2VINA 2GMTB 4MPUA 4DVAU 4BXWA 4NSVA 1B0FA 1ELGA 3V3MA 1GJBB 1H8DH 1DWDH 3AW1A 1K1NA 4I8HA 1EATA 1VCQA 4XOJA 4XE4A 1W0ZU 3I78A 2ZFSA 1O31A 1DUEA 2AERH 7LPRA 4KTUA 3GOVB 2ZQ1A 3UIRA 5BPEA 1S82A 1OPHB 3UR6A 3W94A 1EAUA 1S0QA 2QA9E 4IN2A 2QN5T 1BUIA 2FLRH 1XXFA 7KMEH 1O5EH 1MU8B 1TNLA 5HMAA 2M5TA 4LK4A 1OWIA 2BY7X 3OY6U 4H42U 1BTXA 2XXLA 5G4BA 3EE0B 4DJZB 4Z0KA 2NWNA 2ODQA 4AG1A 3VPKA 5HGGA 4D8NA 2G4TA 1SB1H 4NZQA 1KDQB 1BRUP 2PLXA 2OQ5A 2W7UA 2UWPA 3LT3A 1NRSH 1C1PA 1RJXB 1XUFA 1LPGB 2C4FH 4NIYA 1N6YA 4K1SA 1YCPH 1AQ7A 3EA7A 4DG4A 5HM2A 1P2QA 1KXFA 1O5BB 1O2YA 1MAXA 3SJ9A 1TPPA 3RC6A 1AKSB 2FOHA 1SMFE 2ZTZA 3SORA 1ARCA 1O2PA 4D7GA 1A4WH 1P2JA 3SJKA 1YM0A 4X8SH 1EQ9A 1QB9A 2Z9IA 1O3JA 1ZPCA 2VIDA 3HK6B 5EQSA 3SGQE 1P2MA 1P8VC 4ABGA 1BBRH 3T29A 2O8MA 3UQOA 1ZPBA 5C1UA 3PWBA 3VB3A 4AFUA 2QIQA 5DGJA 1A7SA 1SQOA 2Z9KA 1C5RA 3A8DA 2G55A 3P6ZB 4ZROA 2VIOA 2P16A 4O3TA 4MQAA 5DP6A 4MG3A 3ATMA 3FP6E 3FVFB 1O3CA 1BA8B 2QCYA 1HJ8A 2R9PA 3BF6H 1A5IA 3MNSA 2KAIB 3MO9A 4AZ2B 3BTDE 4B1TA 2AGIX 4B74A 3QWCH 3Q77A 1L0ZA 1GHXH 5CE1A 4CRBA 2D2DA 2YNBA 3HPTB 4YOGA 2ZTYA 1AFQB 2BQ7B 1GL1A 1E35B 1LKBA 1CE5A 1Z8GA 1EJAA 5F03A 1CHGA 1Y5BT 3JZ1B 3GY6A 2IN2A 1IHTH 1EZSC 3LOXA 4X8VH 2ZGHA 3BSQA 1C5QA 1MTNB 3KN2A 4FVDA 5JBBS 4YLUA 4TY6A 3SU3A 3DA9B 1G30B 4BNRA 3RXDA 6CHAC 2BDYA 1OYTH 2PHBA 1MKWK 2ZKSA 1S6FA 1J14A 1RRKA 3BEUA 1WV7H 3PO1C 3KIDU 4ABEA 3EA9A 2O8TA 1TRMA 3GY8A 3SGBE 1GDQA 1RTLA 5EOKA 5EODA 1GJDB 1ZMLA 3MU0A 1GBEA 1ANCA 1QBNA 1O2HA 1GHBG 4UONA 3IG6B 2SGEE 4IMQA 2F9BH 5F8ZA 1T7CA 3RU4D 4DW2U 5EXLA 1LTOA 4DURA 4SGBE 1NY22 2ESTE 1C1OA 1GG6C 1WUNH 1YPKH 3IWMA 1EZQA 2P95A 2OP9A 2QXIA 1Y3UA 1PPCE 3D49H 2EI8A 5C1YA 2ZCLP 1GMCG 3MO6A 4NCYA 1WCZA 1O3BA 4I33A 4LZ1H 3TNSA 5DP8A 5DO4H 4U01A 3SW2B 5EXMA 4A1VA 2ANWA 2HOBA 3RXIA 2BY6X 1O3FA 4CR9A 5J4QA 2Z94A 3DT0H 4WMDA 1MQ6A 1ZMNA 1DANH 3F6UH 3N7OA 4ZXYH 3TH2H 1WTGH 1ANEA 4AFQA 4XBDA 3RC5A 3GY5A 1NFWA 4JZFH 2FOCA 1NRRH 2P8OB 1LHCH 4IW4E 2OUAA 1FLEE 3TU7H 3T62A 1GBFA 1C1WH 1O2MA 2GTBA 2O8WA 3AAUA 3OYPA 3S7KB 1NFUA 4INKA 4KELA 4ZKSU 2GZ9A 3RC4A 1E37B 1GI7B 1QY6A 2JKHA 3VXFH 3M3TA 2Y6TA 5JBTA 1FPCH 3PV4A 3HK3B 4MNYA 5FBEA 5JB9S 1CO7E 1FN8A 1A0LA 1UJ1A 1O3NA 3U8OH 4GCHG 4YOJA 4GVUA 4ZUHA 2XYAA 2CHAC 1FY1A 2Q6FA 1ZJKA 4Y79A 4UEHH 4YO9A 4NWKA 1NS3A 2BY5X 2FIRH 2O8LA 1S83A 2BY9X 1SVPA 2R3YA 1AZ8A 2XCFA 2GKVE 3ZZCA 1D9IA 2WYGA 1E36B 5GIBA 5BRRE 5T6GA 7GCHG 1YPEH 3LGYA 1Y5UT 2VIQA 1MD8A 5GPIB 9LPRA 5FPTA 2A2XH 1O36A 4K2YA 1WSSH 3ENSB 2VIVA 2GD4B 2ZHQH 1YCPM 4OS5A 1QQ4A 3BTHE 1P01A 2B0FA 2ZFFH 4TYDA 3SNBA 1AI8H 3A80A 1BITA 5DJ7A 5JYIA 1G2MA 4D7FA 3SV9A 2WINI 1TBQH 1THPB 4H6TA 3STJA 5I25A 4XBBA 3SV8A 2IPHA 3T28A 3TPIZ 3A83A 1QHRB 3PO1B 2VJ1A 3RXPA 8LPRA 1C5PA 1N6XA 2CN0H 1C4Y2 1W12U 3VGCC 2CJIA 3DFJA 1D3DB 3OSYA 4NFFA 3TNTA 4I7YH 1XUJA 3M5MA 1V2MT 3TLOA 1S6HA 3CP7A 4F4OC 3TK6A 2FI5E 1XMNB 2FOGA 4U2WA 1BRBE 4X1SU 2BVSH 1O5FH 3ZZ7A 3A86A 1HAVB 1V2OT 5EW2H 1S84A 5JDUB 2Q1JA 2THFB 1YCPK 1KTTB 5LGOA 1BDAA 3PB1E 1H8IH 1OWDA 1W8BH 2H2ZA 2ZGCA 1RXPA 3ZYEA 1UK3A 2GX4A 1O37A 1Z1JA 3A85A 5GDSH 5AFZH 1GBBA 2C8YB 1U6QA 1Z8IB 5A8YA 1C2DA 2WV4A 1DX5M 2V0BA 4JYVH 4ZMAH 4GPGA 3S9AA 4ABBA 2O9QA 4Y8XA 1B0EA 1KY9A 3MH5A 1HUTH 1KTSB 2TGAA 3FZZA 2W3KA 1SGNE 3PLPA 1ETTH 3QN7A 3EA8A 1AIXH 1QJ7B 3ZZ9A 1QQUA 3TGKE 1MQ5A 3MI4A 1HAOH 5DG6A 3T25A 1KXDA 1ZSLA 1G9IE 1HFDA 5L2ZH 4X2VA 1SOZA 3DD2H 4X8UH 2BTCE 3M5LA 1P05A 1FJSA 2GP9B 2QYIA 2PGBB 1D6WA 1O2UA 1VGCC 3GCTF 2ZNKH 3MTYA 2HLCA 4XFQA 1B7XB 1O3DA 4H4FA 1DLEA 1AKSA 1UTJA 3RMNH 4AG2A 1KSNA 4KGAA 2IJOB 1TMUH 2HVXA 1G36A 1HCGA 1O3HA 3PMBB 1C2FA 1UVUH 1FI8A 2J9NA 2PW8H 1AVWA 3P8FA 5AFYH 2OD3B 1AN1E 1W7XH 1O2RA 4JK6A 8GCHG 5FPYA 2OQUA 1TBRH 4AN7A 1GI3A 6ESTA 4WH6A 1SC8U 1ELVA 4XDEA 5JB8S 1BTZA 4HI3A 1TMBH 1HAZB 2ANKH 1NU7B 2A4QA 1J9CH 1HGTH 2XBVA 1GHWH 1ZHPA 1K1OA 4Y11E 2PSXA 1GI0A 3BTWE 2CF9H 1AFEH 2W5EA 4Q80A 1KLIH 5FHTA 4CRDA 1ZHMA 3M37A 1GJCB 1BMNH 3M5NA 3LH3A 1CA0C 2ZFQH 4X1QU 3VGCB 2ZPRA 1BHXF 1EZUC 3LJJA 3UNSA 4OS6A 2A2QH 1EJMA 4X1NU 5C5OA 1JMOH 3BTFE 1AUTC 1YPHE 2VVCA 3U98H 2ZFPH 3M5OA 1UTNA 2ZDLA 1DWCH 1C5UA 4FU9A 4U32A 1ZLRA 2JETB 1WU1A 2AMQA 5T6DA 4WJG2 1NC6A 3K6ZA 1PPZA 1O38A 2BDAA 2EA3A 2BD3A 1H9IE 4X2XA 5E2PA 2BDGA 4K3JA 2UWOA 1C1QA 5L2YH 4CBNA 1IQFA 2P94A 4CRGA 5GWZA 1C2JA 4NA9H 2PUXB 3RLYH 3A8CA 1BRCE 3BTQE 3VEQB 3M7TA 4LZ4B 3A7YA 1BJVA 1YPLH 3KQEA 2Z3CA 4H6SB 5DPAA 3T26A 1FY5A 1O32A 6GCHF 4AB9A 2F9NA 2V3OH 2ODYB 3A84A 1SL3A 4VGCB 5CMXH 1GVLA 2G81E 3AAVA 1ESTA 4TPIZ 4XBCA 3UNRA 1RIWB 1Z6JH 1V2KT 1E38B 3E3TA 4Y71A 3ZZDA 1HJAC 1UCYH 3GCOA 2IOTA 1NESE 4BAKB 1YGCH 1F0UA 1TQ0B 3TGIE 3RMMH 1NPMA 1C5XB 1AY6H 1CSOE 3RXEA 1WYKA 3ATIA 2TGPZ 5T3HA 1K1JA 4R8TB 4Y8YA 2ZP0H 3OTJE 3FZDA 1CGIE 2JH6D 2A5IA 1CBWB 5AF9H 1ZGVA 2BLWA 1VITF 2ALPA 2J2UA 4NG9H 2FTMA 4WH8A 1LQDB 1ZHRA 2VB0A 3NUMA 1L4ZA 3QZQA 1DOJA 1FMGA 5EGMA 3ELAH 3SV6A 1FDPA 1NO9H 5A0BA 2FP7B 4ABHA 2P93A 3E6PH 1KXAA 3RXTA 1ZTLA 3E1XB 4IN1A 4OS2A 1C2IA 1HAXB 4NGAH 1C5VA 1LVOA 2FI3E 1GJ9B 2XBYA 5E8EH 1XVOA 3DHKH 4XSKU 2BLOA 4X8TH 1A5HA 1Q31A 2ZDNA 1C1NA 2FYQA 2BQWB 1GI1A 2STAE 1HXEH 3NKKA 5AVDA 1IQHA 5K7RA 3TGJE 5DP9A 1EUFA 4A6LA 1GBMA 3PM3A 2BVXH 4B2AA 3F9EA 1EOLA 1KLJH 3NXPA 4MPVA 1HAPH 1NRPH 4ZHMU 1GDUA 1Z8RA 1MAYA 5FPSA 1RTKA 1MKXH 1VJAU 2HNTC 1DM4B 2Y7ZA 4A1XA 1TGCA 5C1XA 1P2IA 1O3EA 1IQGA 3VB6A 4JZEH 3OU0A 1C4U2 2FM2A 3ZVEA 3GCHC 1FIWA 1ZSJA 1GHVH 2BB4A 1PPGE 1C1TA 1P3CA 1QCPA 1O2LA 3ZZ3A 1HIAB 3MMGA 3BV9B 3RXFA 2C8WB 2R2WU 2XCNA 1MTSA 1T4VH 2CV3A 1GBJA 2XRCA 1DWEH 4BAMB 4UDWH 3BTTE 3SV2H 1Y5AT 4FUFA 1TRNA 1SGCA 1ESBA 1Y3VA 2ANMH 4ZH8A 2A4GA 1CHOF 2ZO3H 4IMZA 3STIA 4CR5A 3MHWU 3PLKA 4MDSA 1K1IA 3ZVBA 5F8TA 3ZVGA 2Y82A 3SHAH 1C5ZB 2RA0A 1WOFA 3EAJA 1HDTH 1SGQE 4IBLH 2C3SA 1HPGA 1IQMA 2ANYA 3ESTA 2ZQ2A 1UVTH 3GY7A 1XUHA 2SGAA 1XKBC 4UD9H 3S7HB 2VVVA 2YNAA 3RXVA 2PR3A 1EP5A 2VH0A 1FY4A 1CU1A 2QXHA 3SZNA 1P04A 3SUDA 3AW0A 3GDUA 4I8LA 1YPJH 5CHAC 4WY3A 1C2HA 1UHBB 1F5LA 1TGTA 1HJAB 2FOFA 3ATLA 1Y3XA 2J34A 1SFIA 2A32A 1HAVA 3RXCA 3URDA 4FUGA 1W7GH 2BY8X 3QZRA 3T2NA 5HXFA 3D62A 1AE8H 1ELDE 1C2MA 3GY2A 1WQSA 1V2TT 3BEIB 2A31A 4FVBA 3M36A 2H9TH 1O35A 5DK1A 2ZHWH 3ITIA 2RA3A 1BJUA 4GSOA 3LGTA 1HAIH 7ESTE 4LXBH 1YP9A 3RXAA 3R3GB 1EJNA 1TOMH 1V2QT 1IQKA 1P2KA 2BXTH 1EPTB 5E0GA 2Y5FA 4WXIA 2ZECA 4WF8A 4NFEA 1BT7A 1PPEE 3R0FA 1CGHA 1SHYA 1F7ZA 5JPMH 1ID5H 3T5FH 1ELEE 1ELFA 3EQ0H 1C5WB 1W10U 3P92A 5DP3A 2OC0A 3RXMA 2HRVA 1V2VT 4K69A 3Q3KA 4K8YA 1GL0E 1BTYA 2WUCA 2TBSA 2AMPA 2ZCKP 1THRH 4B71A 1ABJH 1OP8A 2FMJA 4E7NA 4I31A 1P10A 3MNXA 4B73A 2XBXA 2VVUA 2XWBI 5SGAE 3MO3A 4Y76A 9ESTA 4IC5A 4NWLA 1Q2WA 2ZHEH 4BAQB 1GJ7B 1O3PB 1O3KA 1DXPA 5L6NH 1GPZA 1TABE 5PTPA 1QRZA 2SNVA 1DFPA 1A2CH 1HXFH 1MTVA 3BG8A 4I32A 2QC2A 1P0SH 2PTNA 3T27A 5T6FA 3PMAB 1BB0B 3ZV8A 3VB4A 3RP2A 2WPHS 3KEEA 3SBKA 4CHAC 5LPEA 4X2YA 1V2NT 4Y0YE 5C3NA 2WPMS 4UFEH 4B75A 1TPAE 1LHEH 1DLKB 2XTTB 4FUHA 2BD7A 4ABJA 1RGQA 3LGVA 1EAIA 3ZYDA 3E16B 1NU9A 3MH4A 4NA8A 1PQ8A 2NU2E 4FXGH 1ZR0A 4AFSA 1L4DA 2ASUB 4WMFA 3AVZA 1A0HB 4RSPA 1DS2E 4YM9A 1XXDA 3PMJA 1OX1A 4HFPB 1AVXA 2WYJA 1XUGA 1O3AA 5HM9A 5EPNA 2BQ6B 1OXGA 2AYWA 3A87A 4NIXA 3TJNA 1UCYK 1GBIA 2PSYA 3ODFA 1FN6A 1C5MD 2BLQA 3RDZA 1GGDC 2JH0D 4ISNA 1IQLA 4KTSA 2AMDA 2C93B 3KQBA 1DPOA 1JXPA 1SQTA 4X6MA 1C2EA 3GCTG 2PTCE 1AU8A 1GJ6A 2SFAA 1V2WT 1VCWA 2G8TA 1QL8A 3NPSA 3QTVH 4U30A 3O8CA 1ELTA 2VH6A 2AFQB 1Y3YA 1O2JA 1C5TA 2EEKA 1D3PB 1O2GH 1VITH 1A0JA 2ZDMA 2B9LA 2BX4A 2ZFRH 4ISIH 4ISLA 4AYVB 3OX7U 3TVJB 1F5KU 4BTIB 2ZDVH 5LPFA 2ZIQH 1YKTA 4K1TA 1AHTH 1K21H 2ZU2A 1KYNA 2Y5GA 4GLYA 1V2PT 1FY8E 2OXSA 2STBE 6CHAB 1GMHF 4Q7ZA 1O2XA 3FP7E 2GT8A 2TGDA 1PPFE 2G5VA 3LGWA 2ZU5A 1QA0A 1A5GH 2UUJB 1HB0B 1TLDA 1SGFG 3RXUA 2FLBH 1DE7H 3FP8E 1O3OA 3SUFA 1D4PB 1IOEA 3M3VA 1TQ7B 1O2QA 1Y59T 2TGTA 2OC8A 2W26A 5TCCA 1QIXB 3RU4E 3KHVA 4A1TA 5GJ4B 1EB2A 1QJ1B 2ZFTA 4X0WU 4A5TS 1MKXK 5L30H 3ATKA 3SU1A 1SG8B 3RXLA 1G32B 2Y80A 1HNEE 2Z6BD 2HPPH 1GI8B 1GG6B 1GVKB 4JYUH 1P12E 2PKSC 1GMDG 3LC5A 1BRAA 1HAHH 1O3GA 2GCTC 1P3EA 3ODDA 1IHSH 4JZDH 2DE8A 2ZA5A 1QGFA 2BD4A 3RXHA 5ETXA 2OBQA 1PQ5A 2AGGX 1HAGE 1MU6B 1LHGH 1JIRA 1TNGA 3I77A 1UVPA 1GMCF 1UMAH 1C2KA 5E0HA 1HJ9A 4DCDA 3E0NB 1V2ST 1E34B 1B5GH 3DFLA 1Y3WA 3BTEE 2VNTA 3KF2A 4FU7A 1ZRKA 3LU9B 1BTHH 3RMLH 3ZVCA 2FTLE 1VJ9U 3B9FH 2LPRA 1O2VA 1OYQA 1BBRK 1BMLA 3BTME 3VFEA 3QX5H 5J4SA 3LH1A 2VWNA 3TK9A 4D9QA 1UTPA 2BM2A 3SU6A 3MNBA 6LPRA 1V3XA 2V35A 4YLQH 1GBTA 2XC4A 5EQRA 3O8RA 6GCHG 1RD3B 2ZG0H 4IC6A 1G3EA 2NU1E 2UUFB 3P17H 1C2LA 2ZCHP 4UFDH 3RXKA 1KDQA 4SGAE 1HYLA 4YESB 2FEQH 3A7TA 4FUIA 2BZ6H 2B7DH 4NIWA 4MLFB 5TCAA 1ETRH 1HIAA 1SR5C 2QXJA 2CHAB 2SGQE 4ASHA 4X6OA 4E7RG 1GGDB 2XNIA 1BCUH 1K2I1 2HWLB 3BG4C 1SOTA 1AZZA 1VITG 2QY0B 3F9GA 3GICB 1GBCA 1O3LA 1TGBA 1D3QB 3HGPA 5A8ZA 3HKJB 7GCHF 1UTMA 2G00A 1H4WA 2VWOA 1N8OC 2AIQA 3U1JB 1DY9A 3A8BA 3SUEA 1AO5A 1NT1A 1GHAF 1ZTJA 1O2SA 3HATH 1XX9A 3WY8A 1EP6A 2P3FH 2H6MA 1W11U 2XW9A 2GMTC 1EAWA 1ELCA 1IQEA 1ANDA 2KAIA 2CGAA 4B76A 2XBWA 1O30A 4JCNA 1FIZA 1MKWH 3RU4T 3H7TA 2O8UA 1F5RA 1LMWB 3TK5A 4TPYA 1VR1H 1O5CB 2FYRA 3I29A 1GHYH 2ZPQA 1S81A 1P09A 5EU8A 2D26C 1UK2A 1YBWA 4Q7YA 1UO6A 2BDCA 2Y7XA 1GWAA 1OP0A 1WBGB 1SQAA 4B2BA 1GI6A 2Z3DA 4RKJB 1D6RA 1ELBA 1P11E 1F92A 2FX4A 2FESH 2V6NA 1TNHA 4DOQA 2XWAA 1O2OA 1F0SA 1YYY1 2A5AA 1T8MA 5A2MH 1ABIH 1T8NA 2FPZA 5IDKA 1XUKA 4JZ1A 5FXLA 1G3BA 1LKAA 2GCTB 4Z6AH 2R0LA 3EGKH 4RKOB 1EOJA 2G4UA 2A7HA 2ZI2H 2R0KA 1O34A 4LOYH 2ZGJA 4D9RA 4FUBA 3SOSA 4THNH 4INHA 3BTGE 4Y6DA 4Y10E 1K1PA 2Z9JA 4CRFA 5GXPA 1SLUB 1C9TA 2W3IA 2F83A 1LDTT 3A7WA 1CHOG 1YC0A 2YOLA 3ZZ6A 1NM6A 2H9HA 1C5LH 1QURH 1BIOA 1OOKB 3P8OA 2BMGB 5EPYA 5JBCS 2UUYA 4WXVA 1HRTH 3SU0A 1HBTH 1O2IA 2ZDAH 2F3CE 4GUXA 3MU4A 3RM2H 3UOPA 4F49A 2GCHF 2A4OA 1YLCA 1H1BA 1O5AB 1PQAA 3L33A 4AORA 1NZQH 1SGDE 5E0JA 5LPRA 1CVWH 1C9PA 2OCVB 3M35A 1TFXA 3SNEA 1IQNA 1FNIA 1GI5A 2D1JA 2AIPA 1QTFA 4TWWA 1EZXC 4CH8B 3TJUA 3O8BA 1ZMJA 1VGCB 1GBLA 1LHDH 1ZTKA 5B6OA 1L1GA 1PQ7A 2A7JA 5AHGH 3SNDA 5A09A 3UWJH 2FOBA 3ZZ5A 4O03A 1OWJA 1AFQC 3MH6A 1PPBH 3M61U 3SU5A 3BG4B 4YOIA 4ZAEA 5A0CA 3QGNB 1KXBA 1BZXE 2TPIZ 4MTBA 3QK1A 3MWIU 1UTQA 1TBZH 3GY3A 2W7SA 1J15A 2G51A 3RUOA 1FPHH 1JRSA 1FXYA 3BIUH 4ABFA 3SJOA 1INCA 1MTNC 1S85A 4OS7A 4BTTB 8GCHF 3SUGA 1J17T 2PV9B 3GY4A 3A88A 3B23B 1P57B 5EG4A 1O3IA 4FUDA 1V2UT 1ZZZA 1O5DH 1THSH 4X6NA 4BANB 1W0YH 2AGEX 4BXSA 3ZVFA 4TWYA 4YTAA 2BDIA 2PKAB 3KQCA 1LCYA 2HALA 4CRAA 4ZKRU 3S69A 4D76A 2FX6A 1GJAB 2GV7A 3PMHB 4OS1A 4X1RU 3TIUA 3P70B 1HAYB 3RXRA 3ZZ8A 4MNWA 1UVOA 1GHZA 1RS0A 1CA0B 2DE9A 1QR3E 1GBHA 1LPKB 1A1RA 3MOCA 4NA7A 3LC3A 3CENA 2D8WA 2EI7A 1DXWA 5JBAS 4PROA 1ESAA 3UOUA 3UR9A 1BTPA 4CREA 2OC1A 3D23A 3NCLA 1SSXA 4FU8A 1SGPE 1P06A 1SGTA 1TGSZ 1G37A 1MBMA 3KNXA 3ZVAA 4UFGH 1MD7A 1MH0A 4YT6H 3F9FA 1AB9C 3PROA 3RLWH 1BBRE 1ARBA 2ZU3A 3U8RH 1KXEA 1P9SA 1O2ZA 3PTNA 2BYAX 1NTPA 3F9HA 3TH4H 4INLA 1Y8TA 2P8OC 3L6PA 1NRNH 1NN6A 2F9UA 1W14U 2J38A 4R0IA 1JIMA 1ANBA 1PYTD 3U1IB 1TE0A 1V2LT 2OTVA 3B8JA 1GBAA 1QRWA 1DWBH 1PYTC 5EXNA 2H9EH 2ULLA 2LNCA 1BMAA 4ISHH 1LO6A 1N1LA 1IQIA 1S5SA 4NSYA 5FBIA 1GJ8B 3VB7A 4BTUB 1XUIA 3GYMA 3MYWA 3SI4H 1GI9B 1S0RA 4ABAA 2R3UA 4O97A 1TAWA 5DKMA 1OP2A 3C27B 2H1UA 1AD8H 2J4IA 2AS9A 4UFFH 1ACBE 3QLPH 1YPMH 1C5OH 5GCHF 1FAXA 2FO9A 3W95A 1QRXA 4HTCH 1IAUA 5LH8A 5FX6A 1QBOA 1CA8B 1FY3A 4ZHAA 4NZLA 3MU5A 2HGTH 3EYDA 3JZ2B 1ETSH 1DUAA 3A82A 4J2YB 1SPJA 2ZHFH 2WPJS 1A61H 2ZC9H 5TJXA 3QDZB 1G3DA 1IQJA 1GMHG 1OSSA 2BDHA 3SU2A 1KXCA 3SGAE 4GAWA 1T4UH 1C1MA 4K8BA 4O9VA 1LVYA 1JBUH 1DY8A 4ZHLU 3IITA 2GDEH 1P2OA 2HNTE 1O2KA 5EQQA 3A7VA 2NU3E 1AMHA 1KIGH 3Q3YA 3RMOH 2QV1A 1ELAA 3SNAA 4YZUA 2A45B 2FDAA 2BX3A 3PLBA 8KME2 3PWCA 3G01A 1UK4A 1UTLM 4GHTA 1C5NH 2ILNA 5E2OA 2FZZA 2F9OA 1H9HE 1LVMA 1FZZA 1GI2A 1MZDA 4DT7B 4QT8C 1GCTC 1TX7A 3HKIB 4OS4A 1YLDA 2F9PA 3TH3H 3SJ8A 1WQVH 3GCHB 4ZKOU 3CS7A 1NFYA 1G3CA 1CT4E 3Q00A 1BHXB 1BTWA 3UTUH 2ALVA 4AGKA 2PGQB 3P8GA 1LQEA 1K1LA 1O39A 3PYHA 2ODPA 1OWKA 3KL6A 1SLVB 1SFQB 4B2CA 1Z1IA 3LDXH 2GZ8A 4KKDA 1AB9B 1O0DH 2RDLA 3TJOA 5DP7A 1XKAC 1GJ5H 4Q7XA 1V6DA 1TGNA 2OLGA 2BD2A 2VGCC 3BTKE 1GCDA 1TOCB 3S9CA 3SJIA 1JOUB 2BVRH 2B8OH 4KTCA 1KLTA 2Z7FE 2Z9LA 2GT7A 1DVAH 5ESTE 2B5TB 2GVFA 1RFNA 3HGNA 3RXQA 1QL7A 2Z9GA 1C1SA 2SGFE 2GDDA 1OWEA 1NROH 2BD9A 1TONA 1SHHB 3A81A 5CHAB 3QTOH 4A92A 3A7XA 4WMEA 1MMJN 1CT0E 2P3TB 4BAHB 4JYTA 2QXGA 5F6MA 4IGDA 1CQQA 3SI3H 1DITH 2BXUH 1TX8A 4IS5A 4E05H 1NRQH 2Y5HA 2FS8A 3E8LA 3KQDA 3NK8A 1EKBB 3ZVDA 5A8XA 1LPZB 2TRMA 2NU4E 2ZZUH 4X2WA 1AE5A 1ORFA 1QB1A 3E90B 1C1VH 5C20A 1AGJA 3O8DA 3MU8A 1QJ6B 5C67A 1EASA 4CBOA 2H5CA 2P3UB 2GV6A 2ZGXH 1MZAA 1TWXB 2BD5A 3M7UA 1QL9A 4Y0ZE 3MU1A 2RG3A 1TIOA 3GDVA 1A46H 1UTOA 4FUEA 1GHAG 1SLWB 1QNJA 3LIWA 4HGCA 3VB5A 1TMTH 2GZ7A 1QFKH 2C8ZB 1C5SA 1J16A 4K1EA 4MNXA 1O3MA 2G52A 1P2NA 3MH7A 1M9UA 3M7QA 3ZZBA 1LVBA 1ZOMA 5FAHA 1T31A 4O3UA 3NZIA 4BOHA 1LHFH 2C8XB 1G2LA 3A8AA 4ESTE 2F91A 3DUXH 1P02A 4MPXA 5IYTA 3RXBA 2V3HH 1QBVH 4J1YA 1GHBF 1PFXC 2PWXA 1MCVA 1AWFH 1T32A 2FI4E 3CS0A 1DDJA 3K65B 1SGYE 5EW1H 2ZF0H 2R2MB 2RCEA 1ZRBA 3V0XA 3F68H 3SV7A 1K9OE
chains in the Genus database with same CATH superfamily
3ZV9A 1GCTB 1T8LA 3WWBA 1TNIA 5F8XA 4DT4A 3GDSA 2YMSB 4X1PU 3MNCA 1ZSKA 1ZYOA 2CK3D 2ZTXA 4CHAB 2A1DB 1FONA 2ZWLH 3UREA 2WPLS 3SN8A 2JETC 3A7ZA 1W13U 2OINA 1YPHC 2A7CA 2CMYA 1WDIA 3QUMP 1ZJDA 1QA7A 3LJOA 4B6EA 5A0AE 5C2ZA 1O33A 1BMMH 2PKAA 2BLVA 1TALA 1GI4A 3V12A 2QF0A 1OS8A 1W3CA 3ZZ4A 1TNKA 3P8NA 4RT0A 5C5NA 4DIIH 1TA2A 2VGCB 1MUEB 1Q3XA 4I8KA 3P95A 4DY7B 2A0QB 1RTFB 3V7TA 2SGDE 2GCHG 1OKXA 4P00A 3BN9A 2TIOA 1GVZA 5K0HA 1JRTA 3SU4A 1O5GH 4CH2B 2SNWA 4ASUD 2BOHB 1K22H 2G5NA 4VGCC 1XM1A 1SGRE 3N99A 3FANA 4I8JA 1FV9A 3AASA 4OGXA 1RIWC 2JJ1D 3K6YA 1SBWA 4ZXXH 1EAXA 2J95A 1MCTA 2BOKA 3VXEH 2HPQH 4FUCA 1O2TA 4GCHF 2FOMB 4X6PA 3SNCA 4MPWA 1W2KH 1PJPA 4K5ZA 3U8TH 1C1UH 1F0RA 1DSTA 2VWMA 1SGIB 4A7IB 2H5DA 2DUCA 1P9UA 4HZHA 2FS9A 2ZDKA 3NWUA 2P59A 1QB6A 5DP4A 1FAKH 1BQYA 3UWIA 2F9VA 3OFND 1TRYA 1CBWC 2WPIS 4CRCA 2VWLA 5HIZA 4OGYA 4MVNA 2Z3EA 1VCPA 1UTKA 2Y81A 3UQVA 4I8GA 3SHCH 1NBME 4M7GA 2BZAA 3E0PB 1TA6A 1YPGH 2FXRA 1DT2A 2OC7A 3KCGH 3GCNA 2FOAA 3Q3XA 2A5KA 2QF5A 3FAOA 3U69H 3LPRA 4DGJA 4AOQA 1Z7KA 3QGJA 1SI5H 3RXGA 5HYOA 1UHBA 1EX3A 2FODA 1JWTA 1AVGH 4AYYB 2AEIH 1C2GA 4E06H 3GYLB 2PFEA 4MNVA 3LGIA 1J8AA 3RXSA 2J97A 3A89A 3MQKC 4ZKNU 4KP0A 2SGPE 3UY9A 1L1NA 1MTUA 2I6SA 3URCA 5FCKA 2HNTF 2JH5D 1WAYB 2C90B 3LONA 1F2SE 1HV7A 2ZHDA 2XC5A 2EI6A 5FX5A 1BOQA 2XC0A 3KYGA 4RN6A 3BIVH 5ESBA 5H4IB 2FOEA 3F1SB 1FQ3A 1SLXB 2PKSB 1V2RT 1GDNA 4M9FA 2I6QA 3H5CB 4I86A 1EPTA 4AB8A 3H7OA 5FCRA 1GMDF 3UNQA 2L6OA 2CF8H 4Q2KA 1FUJA 2ZU1A 1V2JT 2UWLA 4K60A 3FFGA 1TB6H 2PUQH 4Y8ZA 2Q6DA 3PTBA 2BDBA 3RM0H 1X7AC 1O2NA 1CT2E 1SGEE 2J94A 2ZPSA 4DIHH 1A3EH 4AX9H 4Y7BA 1ZGIA 1Z8JB 1D3TB 1O2WA 4GHQA 1MTWA 3UFAA 1L1JA 1BTUA 1CGJE 2AHME 3N7DA 1T8OA 3S0NA 3SO3A 8ESTE 5I46H 1SGFA 3KGPA 1HLTH 4AFZA 3OTPA 5ABWA 3K9XB 3UPEA 3RXJA 4ISOA 1C1RA 1PPHE 1TPOA 4JZIA 3GISB 1TYNA 2OBOA 2WPKS 4UE7H 3D65E 2NU0E 3RXOA 3C1KA 1UCYE 2VU8E 3UUZA 1C5YB 1K1MA 4BAOB 1UVSH 3OY5U 4JK5A 1K28D 4TY7A 2Q6GA 2UUKB 1ZPZA 1TPSA 2QAAA 1TNJA 5DP5A 2J92A 3LKWA 2AH4X 2GGVB 2BHGA 2VIWA 4WWYA 1GJ4H 2VIPA 1Z71A 2FWWA 1F0TA 3FN8A 4ABIA 1A3BH 3TITA 3TJVA 1YF4A 1GBKA 1NFXA 2K1QA 2CXVA 1C4V2 2ZU4A 4JMYA 3ZZAA 2ZGBH 4NIVA 1P03A 4WVPE 3ATWA 1EB1H 1EXFA 1OWHA 2QGRA 3K2UA 2BD8A 3S9BA 4FUJA 4F48B 1TX6A 2ZEBA 3BEFB 4FETA 2WUBA 1GBDA 1Z6EA 2WV5A 1H9LB 4YT7H 5GCHG 1DICA 4XRNA 3U9AH 3M3SA 1MBQA 3SQHE 3LGUA 1VZQH 3QO6A 1L2EA 1AUJA 1E0FD 1AWHB 1XVMA 3EDXB 2A4RA 3E91A 1WTHD 2EC9H 1N8OB 3SQEE 3V13A 4ABDA 3MFJA 2QF3A 1EPTC 3L3TA 4Y7AA 4AGJA 1DSUA 4ACAA 3Q76A 2VINA 2GMTB 4MPUA 4DVAU 1QZ8A 4BXWA 4NSVA 1B0FA 1ELGA 3V3MA 1GJBB 1H8DH 1DWDH 3AW1A 1K1NA 4I8HA 2L74A 1EATA 1VCQA 4XOJA 4XE4A 1W0ZU 3I78A 2ZFSA 1O31A 1SKYE 1DUEA 2AERH 7LPRA 4KTUA 5C94A 3GOVB 2ZQ1A 3UIRA 5BPEA 1S82A 1OPHB 3UR6A 3W94A 1EAUA 1S0QA 2QA9E 4IN2A 2QN5T 1BUIA 2FLRH 1XXFA 7KMEH 1O5EH 1MU8B 1TNLA 5HMAA 2M5TA 4LK4A 1OWIA 2BY7X 3OY6U 1SQRA 4H42U 1BTXA 2XXLA 5G4BA 3EE0B 4DJZB 4Z0KA 2NWNA 2ODQA 4AG1A 3VPKA 5HGGA 4D8NA 2G4TA 1SB1H 4NZQA 1KDQB 1BRUP 2PLXA 2OQ5A 2W7UA 2UWPA 3LT3A 1NRSH 1C1PA 1RJXB 1XUFA 1LPGB 2C4FH 4NIYA 1N6YA 4K1SA 1YCPH 5KECA 1AQ7A 2WSSD 3EA7A 4DG4A 5HM2A 1P2QA 1KXFA 1O5BB 1O2YA 1MAXA 3SJ9A 1TPPA 3RC6A 3PV5A 1AKSB 2FOHA 1SMFE 2ZTZA 3SORA 1ARCA 1O2PA 4D7GA 1A4WH 1P2JA 3SJKA 1YM0A 4X8SH 1EQ9A 1QB9A 2Z9IA 1O3JA 1ZPCA 2VIDA 3HK6B 5EQSA 3SGQE 1P2MA 1P8VC 4ABGA 1W0JD 1BBRH 3T29A 2O8MA 3UQOA 1ZPBA 5C1UA 3PWBA 3VB3A 4AFUA 2QIQA 4TT3D 4ZCNA 5DGJA 1A7SA 1SQOA 2Z9KA 1C5RA 3A8DA 2G55A 3P6ZB 4ZROA 2VIOA 2P16A 4O3TA 4MQAA 5DP6A 2F4LA 3ATMA 4MG3A 3FP6E 3FVFB 1O3CA 1BA8B 2QCYA 1HJ8A 2R9PA 3BF6H 1A5IA 3MNSA 2KAIB 1K0HA 3MO9A 4AZ2B 4FOUC 2LP6A 3BTDE 4B1TA 2AGIX 4B74A 3QWCH 3Q77A 1L0ZA 1GHXH 5CE1A 1H8ED 2D2DA 4CRBA 2YNBA 3HPTB 4YOGA 2ZTYA 1AFQB 2BQ7B 5C0UA 1GL1A 1E35B 1LKBA 1CE5A 1Z8GA 1EJAA 5F03A 1CHGA 1Y5BT 3JZ1B 3GY6A 2IN2A 1IHTH 1EZSC 3LOXA 4X8VH 2ZGHA 3BSQA 1C5QA 1MTNB 3KN2A 4FVDA 5JBBS 4YLUA 4TY6A 2GJGA 3SU3A 3DA9B 1G30B 4BNRA 3RXDA 6CHAC 2BDYA 1OYTH 2PHBA 1MKWK 2ZKSA 1S6FA 1J14A 4XD7D 1RRKA 3BEUA 1WV7H 3PO1C 3KIDU 4ABEA 3EA9A 2O8TA 5EJLA 1TRMA 3GY8A 3SGBE 1GDQA 1RTLA 5EOKA 5EODA 1GJDB 1ZMLA 3MU0A 1GBEA 1ANCA 1QBNA 1O2HA 1GHBG 4UONA 3IG6B 2SGEE 4IMQA 2OK5A 2F9BH 5F8ZA 1T7CA 3RU4D 4DW2U 1COWD 5EXLA 1LTOA 4DURA 4SGBE 1NY22 2ESTE 1C1OA 1GG6C 1WUNH 1YPKH 3IWMA 1EZQA 2P95A 2OP9A 2QXIA 1Y3UA 1PPCE 3D49H 2EI8A 5C1YA 2ZCLP 1GMCG 3MO6A 4NCYA 1WCZA 2RFKC 1O3BA 4I33A 5C0TA 4LZ1H 3TNSA 5DP8A 5DO4H 4U01A 3SW2B 5EXMA 4A1VA 2ANWA 2HOBA 3OEHD 3RXIA 2BY6X 1O3FA 4CR9A 5J4QA 2Z94A 3DT0H 4WMDA 1MQ6A 1ZMNA 1DANH 3F6UH 3N7OA 4ZXYH 3TH2H 1WTGH 1ANEA 4AFQA 4XBDA 3RC5A 3GY5A 2HVYB 1NFWA 4JZFH 5IK2D 2FOCA 1NRRH 2P8OB 5EIYA 1LHCH 4IW4E 2OUAA 1FLEE 3TU7H 3T62A 1GBFA 1C1WH 1O2MA 2GTBA 2O8WA 3AAUA 3OYPA 3S7KB 1NFUA 4INKA 4KELA 4ZKSU 2GZ9A 3RC4A 1E37B 3U28C 1GI7B 1QY6A 2JKHA 3VXFH 3M3TA 2Y6TA 5JBTA 1FPCH 3PV4A 3HK3B 4MNYA 5FBEA 5JB9S 1CO7E 4F55A 1FN8A 1A0LA 1UJ1A 1O3NA 3U8OH 3WWFA 4GCHG 4YOJA 4GVUA 4ZUHA 2XYAA 2CHAC 1FY1A 2Q6FA 1ZJKA 4Y79A 4UEHH 4YO9A 4NWKA 1NS3A 2BY5X 2FIRH 2O8LA 1S83A 2BY9X 1SVPA 2KZ4A 2R3YA 1AZ8A 2XCFA 2GKVE 3ZZCA 1D9IA 2WYGA 1E36B 5GIBA 5BRRE 5T6GA 7GCHG 1YPEH 3KYFA 3LGYA 1Y5UT 2VIQA 1MD8A 5GPIB 9LPRA 5FPTA 2A2XH 1O36A 4K2YA 1WSSH 3ENSB 2VIVA 2GD4B 2ZHQH 1YCPM 4OS5A 1QQ4A 3BTHE 1P01A 2B0FA 2ZFFH 4TYDA 3SNBA 1AI8H 3A80A 1BITA 5DJ7A 5JYIA 1G2MA 4D7FA 3SV9A 2WINI 1TBQH 1THPB 4H6TA 2J5UA 3STJA 5I25A 4RI0A 4XBBA 3SV8A 2IPHA 3T28A 3TPIZ 3A83A 1QHRB 3PO1B 2VJ1A 3OAAD 3RXPA 8LPRA 1C5PA 1N6XA 2CN0H 1C4Y2 1W12U 3VGCC 2CJIA 2V3MA 3DFJA 1D3DB 3OSYA 4NFFA 3TNTA 4I7YH 1XUJA 3M5MA 3GS9A 1V2MT 3TLOA 1S6HA 3CP7A 4F4OC 3TK6A 2FI5E 1XMNB 2FOGA 4U2WA 1BRBE 3N7EA 4X1SU 2BVSH 1O5FH 3ZZ7A 3A86A 1HAVB 1V2OT 5EW2H 1S84A 5JDUB 3F0PA 2Q1JA 2THFB 1YCPK 1KTTB 5LGOA 1BDAA 3PB1E 1H8IH 1OWDA 1W8BH 2H2ZA 2ZGCA 1RXPA 3ZYEA 1UK3A 2GX4A 1O37A 1Z1JA 3A85A 4HG6A 5GDSH 5AFZH 1GBBA 2C8YB 1U6QA 1Z8IB 5A8YA 1C2DA 2RDEA 2WV4A 1DX5M 2V0BA 4JYVH 4ZMAH 4GPGA 3S9AA 3NRLA 5B6LA 4ABBA 2O9QA 1YLNA 4Y8XA 1B0EA 1KY9A 3MH5A 1HUTH 1KTSB 2TGAA 3FZZA 2W3KA 1SGNE 3PLPA 1ETTH 3QN7A 3EA8A 1AIXH 1QJ7B 3ZZ9A 1QQUA 3TGKE 1MQ5A 3MI4A 1HAOH 3F2FA 5DG6A 3T25A 1KXDA 1ZSLA 1G9IE 1HFDA 5L2ZH 1H8HD 4X2VA 1SOZA 3DD2H 4X8UH 2BTCE 3M5LA 1P05A 1FJSA 2GP9B 2QYIA 2PGBB 1D6WA 1O2UA 1VGCC 3GCTF 2ZNKH 3MTYA 2HLCA 4XFQA 1B7XB 1O3DA 4H4FA 1DLEA 4ACBA 1AKSA 1UTJA 3RMNH 4AG2A 1KSNA 4KGAA 2IJOB 1TMUH 2HVXA 1G36A 1HCGA 1O3HA 3PMBB 1C2FA 1UVUH 1FI8A 2J9NA 2PW8H 1AVWA 3P8FA 5AFYH 2OD3B 1AN1E 1W7XH 1O2RA 4JK6A 8GCHG 5FPYA 2OQUA 1TBRH 4AN7A 1GI3A 6ESTA 4WH6A 1SC8U 1ELVA 4XDEA 5JB8S 1BTZA 4HI3A 1TMBH 1HAZB 2ANKH 1NU7B 2A4QA 1J9CH 1HGTH 2XBVA 1GHWH 1ZHPA 1K1OA 4Y11E 5KGOA 2PSXA 1GI0A 3BTWE 2CF9H 1AFEH 2W5EA 4Q80A 1KLIH 5FHTA 4CRDA 1ZHMA 3M37A 1GJCB 1BMNH 3M5NA 3LH3A 1CA0C 2ZFQH 4X1QU 3VGCB 2ZPRA 1BHXF 1EZUC 3LJJA 3OEED 3UNSA 2V7QD 4OS6A 2A2QH 1EJMA 4X1NU 5C5OA 1JMOH 3BTFE 1AUTC 1YPHE 2VVCA 3U98H 2ZFPH 3M5OA 1UTNA 2ZDLA 1DWCH 1C5UA 4FU9A 4U32A 5KEDA 1ZLRA 2JETB 1WU1A 2AMQA 5T6DA 4WJG2 1NC6A 3K6ZA 1PPZA 1O38A 2BDAA 2EA3A 2BD3A 1H9IE 4X2XA 5E2PA 2BDGA 4K3JA 2UWOA 1C1QA 5L2YH 4CBNA 1IQFA 2P94A 4CRGA 5GWZA 1C2JA 4NA9H 2PUXB 3RLYH 3A8CA 1BRCE 3BTQE 3VEQB 3FO8D 3M7TA 4LZ4B 3A7YA 1BJVA 1YPLH 3KQEA 1YWUA 2Z3CA 4H6SB 5DPAA 3T26A 1FY5A 1O32A 6GCHF 5CDFE 2HLDD 4AB9A 2F9NA 2V3OH 2ODYB 3A84A 1SL3A 4VGCB 5CMXH 1GVLA 2G81E 3AAVA 1ESTA 4TPIZ 4XBCA 1E79D 3UNRA 1RIWB 1Z6JH 1V2KT 1E38B 3E3TA 4Y71A 3ZZDA 1HJAC 1UCYH 3GCOA 2IOTA 1NESE 4BAKB 1YGCH 4AC9A 1F0UA 1TQ0B 5FL7D 3RMMH 3TGIE 1NPMA 1C5XB 1AY6H 1CSOE 3RXEA 1WYKA 3ATIA 2TGPZ 5T3HA 1K1JA 4R8TB 4Y8YA 2ZP0H 3OTJE 3FZDA 2EQNA 1CGIE 2JH6D 2A5IA 4Q4LA 1CBWB 5AF9H 1ZGVA 2BLWA 1VITF 2ALPA 2J2UA 4NG9H 2FTMA 4WH8A 1LQDB 1ZHRA 2VB0A 3NUMA 1L4ZA 3QZQA 1DOJA 1FMGA 5EGMA 3ELAH 3SV6A 1FDPA 1NO9H 2WHXA 5A0BA 2FP7B 4ABHA 1E1RD 2P93A 3E6PH 1KXAA 3RXTA 1ZTLA 3E1XB 4OM9A 4IN1A 4OS2A 1C2IA 1HAXB 4NGAH 1C5VA 1LVOA 2FI3E 3UAIC 1GJ9B 2XBYA 5E8EH 1XVOA 3DHKH 4XSKU 2BLOA 4X8TH 1A5HA 1Q31A 2ZDNA 1C1NA 2FYQA 2BQWB 1GI1A 2STAE 1HXEH 3NKKA 5AVDA 1IQHA 5K7RA 2M2AA 3TGJE 5DP9A 1EUFA 4A6LA 1GBMA 3PM3A 2BVXH 4B2AA 3F9EA 1EOLA 1KLJH 3NXPA 4MPVA 1HAPH 1NRPH 4ZHMU 1GDUA 1Z8RA 1MAYA 5FPSA 1RTKA 1MKXH 1VJAU 2HNTC 1DM4B 3SZEA 2Y7ZA 4A1XA 1TGCA 3PV2A 5C1XA 1P2IA 1O3EA 1IQGA 3VB6A 4JZEH 3OU0A 1C4U2 2FM2A 3EE7A 3ZVEA 3GCHC 1FIWA 1ZSJA 1GHVH 2KX4A 2BB4A 1PPGE 1C1TA 1P3CA 1QCPA 1O2LA 3ZZ3A 1HIAB 3MMGA 3BV9B 3RXFA 2C8WB 2R2WU 2XCNA 1MTSA 1T4VH 2CV3A 1GBJA 2XRCA 1DWEH 4Q63A 4BAMB 4UDWH 3BTTE 3SV2H 1Y5AT 4FUFA 1TRNA 1SGCA 1ESBA 1Y3VA 2ANMH 4ZH8A 2A4GA 1CHOF 2ZO3H 4IMZA 3STIA 4CR5A 3MHWU 3PLKA 4MDSA 1K1IA 3ZVBA 5F8TA 3ZVGA 2Y82A 3SHAH 1C5ZB 2RA0A 1WOFA 3EAJA 1HDTH 1SGQE 4IBLH 2C3SA 1HPGA 1IQMA 2ANYA 3ESTA 2ZQ2A 1UVTH 3GY7A 1XUHA 4B6FA 4P02A 2SGAA 1XKBC 5F53A 4UD9H 2XNDD 3S7HB 2VVVA 2YNAA 3RXVA 2PR3A 1EP5A 2VH0A 1FY4A 1CU1A 2QXHA 3SZNA 1P04A 3SUDA 1MABB 3AW0A 3GDUA 4I8LA 1YPJH 5CHAC 4WY3A 1C2HA 1UHBB 1F5LA 1TGTA 1HJAB 2FOFA 3ATLA 1Y3XA 2J34A 1SFIA 3PRBA 2A32A 1HAVA 3RXCA 3URDA 4FUGA 1W7GH 2BY8X 3QZRA 3T2NA 5HXFA 3D62A 1AE8H 1ELDE 1C2MA 3GY2A 1WQSA 1V2TT 3BEIB 2A31A 3H09A 4FVBA 3M36A 2H9TH 1O35A 5DK1A 2ZHWH 3ITIA 2RA3A 1BJUA 4GSOA 3LGTA 1HAIH 7ESTE 4LXBH 1YP9A 3RXAA 3R3GB 1EJNA 1TOMH 1V2QT 1IQKA 1P2KA 2BXTH 1EPTB 5E0GA 2Y5FA 4WXIA 2ZECA 3UB0A 4WF8A 4NFEA 2XOKD 1BT7A 1PPEE 3R0FA 1CGHA 1SHYA 1F7ZA 5JPMH 1ID5H 3T5FH 1ELEE 1ELFA 3EQ0H 1C5WB 1W10U 3P92A 5DP3A 2OC0A 3RXMA 3VG8A 2HRVA 1V2VT 4K69A 3Q3KA 4K8YA 1GL0E 1BTYA 2WUCA 2TBSA 2AMPA 2ZCKP 1THRH 4B71A 1ABJH 1OP8A 2FMJA 4E7NA 4I31A 1P10A 3MNXA 4B73A 2XBXA 2VVUA 2XWBI 5SGAE 1OHHD 3MO3A 4Y76A 9ESTA 4IC5A 4NWLA 1Q2WA 2ZHEH 4BAQB 1GJ7B 1O3PB 1O3KA 1DXPA 5L6NH 1GPZA 1TABE 5PTPA 3AK5A 1QRZA 2SNVA 1DFPA 1A2CH 1HXFH 1MTVA 3BG8A 4I32A 2YMSC 2QC2A 1P0SH 2PTNA 3DSOA 3T27A 5T6FA 3PMAB 1BB0B 3ZV8A 3VB4A 3RP2A 2WPHS 3KEEA 3SBKA 4CHAC 5LPEA 4X2YA 1V2NT 4Y0YE 5C3NA 2WPMS 4UFEH 4B75A 1TPAE 1LHEH 1DLKB 2KCAA 2XTTB 4FUHA 2BD7A 4ABJA 1RGQA 3LGVA 1EAIA 3ZYDA 3E16B 1NU9A 1YY3A 3MH4A 4NA8A 3DSGA 1PQ8A 2NU2E 4FXGH 1ZR0A 4AFSA 1L4DA 2ASUB 4WMFA 3SYJA 3AVZA 1A0HB 4RSPA 1DS2E 4YM9A 1XXDA 3PMJA 1OX1A 4HFPB 1AVXA 2WYJA 2J98B 1XUGA 3PRDA 1O3AA 5HM9A 5EPNA 2BQ6B 1OXGA 2AYWA 3A87A 4NIXA 3TJNA 1UCYK 1GBIA 2PSYA 3ODFA 1FN6A 1C5MD 2IJD1 2BLQA 3OE7D 3RDZA 1GGDC 2JH0D 4ISNA 1IQLA 4KTSA 2AMDA 2C93B 3KQBA 1DPOA 1JXPA 1SQTA 4X6MA 1C2EA 3GCTG 2PTCE 1AU8A 1GJ6A 2SFAA 1V2WT 1VCWA 2G8TA 3FOAA 1QL8A 3NPSA 3QTVH 4U30A 3O8CA 1ELTA 2VH6A 2AFQB 1Y3YA 1O2JA 1C5TA 2EEKA 1D3PB 1O2GH 1VITH 1A0JA 2ZDMA 2B9LA 2BX4A 2ZFRH 4ISIH 4ISLA 4AYVB 3OX7U 3TVJB 1F5KU 4BTIB 2ZDVH 5LPFA 2ZIQH 1YKTA 4K1TA 1AHTH 5EJZA 1K21H 2ZU2A 1KYNA 2Y5GA 4GLYA 1V2PT 1FY8E 1NBMD 2OXSA 2STBE 6CHAB 1GMHF 4Q7ZA 1O2XA 3FP7E 2GT8A 2TGDA 5DSFA 1PPFE 2G5VA 3LGWA 2ZU5A 1QA0A 1A5GH 2UUJB 1HB0B 3F2HA 1TLDA 1SGFG 3RXUA 2FLBH 1DE7H 3FP8E 1O3OA 3SUFA 1D4PB 1IOEA 3M3VA 1TQ7B 1O2QA 1Y59T 2TGTA 2OC8A 2W26A 5TCCA 1QIXB 3RU4E 3KHVA 4A1TA 5GJ4B 1EB2A 1QJ1B 2ZFTA 4X0WU 4A5TS 1MKXK 5L30H 3ATKA 3SU1A 1SG8B 3RXLA 1G32B 2Y80A 1HNEE 2Z6BD 2HPPH 1GI8B 1GG6B 1GVKB 4JYUH 1P12E 2PKSC 1GMDG 3LC5A 1BRAA 2GCTC 1HAHH 1O3GA 3F2GA 1P3EA 3ODDA 1IHSH 4JZDH 2DE8A 2ZA5A 1QGFA 2BD4A 3RXHA 5ETXA 2OBQA 1PQ5A 2AGGX 3F3BA 1HAGE 1MU6B 1LHGH 1JIRA 1TNGA 3I77A 1UVPA 1GMCF 1UMAH 1C2KA 5E0HA 1HJ9A 4DCDA 3E0NB 1V2ST 1E34B 1B5GH 3DFLA 1Y3WA 3BTEE 2VNTA 3KF2A 4FU7A 1ZRKA 3LU9B 1BTHH 1KMHB 3RMLH 3ZVCA 2FTLE 1VJ9U 3B9FH 2K8IA 2LPRA 1O2VA 1OYQA 1BBRK 2WPDD 1BMLA 3BTME 3VFEA 3QX5H 5J4SA 5T1VA 3LH1A 2VWNA 3TK9A 4D9QA 1UTPA 2BM2A 3SU6A 3MNBA 6LPRA 1V3XA 2V35A 4YLQH 1GBTA 2XC4A 5EQRA 3O8RA 6GCHG 1RD3B 2ZG0H 4IC6A 1G3EA 2NU1E 2UUFB 3P17H 1C2LA 2ZCHP 4UFDH 3RXKA 1KDQA 4SGAE 1HYLA 4YESB 2FEQH 3A7TA 4FUIA 2W6ID 2BZ6H 2B7DH 2KCYA 4NIWA 4MLFB 5TCAA 1ETRH 1HIAA 1SR5C 2QXJA 2CHAB 2SGQE 4ASHA 4X6OA 4E7RG 1GGDB 2XNIA 1BCUH 1K2I1 2HWLB 2QF4A 3BG4C 1SOTA 1AZZA 1VITG 2QY0B 3F9GA 3GICB 1GBCA 1O3LA 1TGBA 1D3QB 3HGPA 5A8ZA 3HKJB 7GCHF 1UTMA 2G00A 1H4WA 2VWOA 1N8OC 2AIQA 3U1JB 1DY9A 3A8BA 3SUEA 1AO5A 1NT1A 1GHAF 1ZTJA 1O2SA 3HATH 1XX9A 3WY8A 1EP6A 1W11U 2H6MA 2P3FH 2XW9A 2GMTC 1EAWA 1FX0B 5C17A 1ELCA 1IQEA 1ANDA 2KAIA 2CGAA 4B76A 2XBWA 1O30A 4JCNA 1FIZA 1MKWH 3RU4T 3H7TA 2O8UA 1F5RA 1LMWB 3TK5A 4TPYA 1VR1H 1O5CB 2FYRA 3I29A 1GHYH 2ZPQA 1S81A 1P09A 5EU8A 2D26C 1UK2A 1YBWA 4Q7YA 1UO6A 2BDCA 2Y7XA 1GWAA 1OP0A 1WBGB 1SQAA 4B2BA 1GI6A 2Z3DA 4RKJB 1D6RA 1ELBA 1E1QD 1F92A 1P11E 2FX4A 2FESH 2V6NA 1TNHA 4DOQA 2XWAA 1O2OA 1F0SA 1YYY1 2A5AA 1T8MA 5A2MH 1ABIH 1T8NA 2FPZA 5IDKA 1XUKA 4JZ1A 5FXLA 1G3BA 1LKAA 2GCTB 4Z6AH 2R0LA 3EGKH 4RKOB 1EOJA 2G4UA 2A7HA 2ZI2H 2R0KA 1O34A 2VBCA 4LOYH 2ZGJA 4D9RA 2JJ2D 4FUBA 3SOSA 2EY4C 4THNH 4INHA 3BTGE 4Y6DA 4Y10E 1K1PA 2Z9JA 4CRFA 5GXPA 1SLUB 1C9TA 2W3IA 2F83A 1LDTT 3A7WA 1CHOG 1YC0A 2YOLA 3ZZ6A 1NM6A 4YXWD 2H9HA 1C5LH 1QURH 1BIOA 1OOKB 3P8OA 2BMGB 5EPYA 5JBCS 2UUYA 4WXVA 1HRTH 3SU0A 1HBTH 1O2IA 2ZDAH 2F3CE 4GUXA 3MU4A 3RM2H 3UOPA 4F49A 2GCHF 2A4OA 1YLCA 1H1BA 1O5AB 1PQAA 3L33A 4AORA 1NZQH 1SGDE 5E0JA 5LPRA 1CVWH 1C9PA 2OCVB 3M35A 1TFXA 3SNEA 1IQNA 1FNIA 1GI5A 2D1JA 2AIPA 1QTFA 4TWWA 1EZXC 4CH8B 3TJUA 2W6JD 3O8BA 1ZMJA 4TSFD 1VGCB 1GBLA 1LHDH 1ZTKA 5B6OA 1L1GA 1PQ7A 2A7JA 5AHGH 3SNDA 5HKKD 5A09A 3UWJH 4RT1A 2FOBA 3ZZ5A 1BMFD 4O03A 1OWJA 1AFQC 3MH6A 1PPBH 3M61U 3SU5A 3BG4B 4YOIA 4ZAEA 5A0CA 3QGNB 1KXBA 1BZXE 2TPIZ 4MTBA 3QK1A 3MWIU 1UTQA 1TBZH 3CNRA 3GY3A 2W7SA 1J15A 2KFWA 2IPQX 2G51A 3RUOA 1FPHH 1JRSA 1FXYA 3BIUH 4ABFA 3SJOA 1INCA 1MTNC 1S85A 4OS7A 4BTTB 8GCHF 3SUGA 1J17T 2PV9B 3GY4A 2J98A 3A88A 3B23B 1P57B 5EG4A 1O3IA 4FUDA 1V2UT 1ZZZA 1O5DH 1THSH 4X6NA 4BANB 1W0YH 2AGEX 4BXSA 3ZVFA 4TWYA 4YTAA 2BDIA 2PKAB 3KQCA 1LCYA 2HALA 4CRAA 2JIZD 4ZKRU 3F0OA 3S69A 4D76A 2FX6A 1GJAB 2GV7A 3PMHB 4OS1A 4X1RU 3TIUA 3P70B 1HAYB 3RXRA 3ZZ8A 4MNWA 1UVOA 1GHZA 1RS0A 1CA0B 2DE9A 1QR3E 1GBHA 1LPKB 1A1RA 3MOCA 4NA7A 3LC3A 1EFRD 3CENA 2D8WA 2EI7A 1DXWA 5JBAS 4PROA 1ESAA 3UOUA 3UR9A 2JDID 1BTPA 4CREA 2OC1A 3D23A 3NCLA 1SSXA 4FU8A 1SGPE 1P06A 1SGTA 1TGSZ 1G37A 1MBMA 3KNXA 3ZVAA 4UFGH 1MD7A 1MH0A 4YT6H 3F9FA 1AB9C 3PROA 1VKYA 3RLWH 1BBRE 1ARBA 1W0KD 2ZU3A 3U8RH 1KXEA 1P9SA 1O2ZA 3PTNA 2BYAX 1NTPA 3F9HA 2WZQA 3TH4H 4INLA 1Y8TA 2P8OC 3L6PA 1NRNH 5HIYA 1NN6A 2F9UA 1W14U 2J38A 4R0IA 1JIMA 1ANBA 1PYTD 3U1IB 1TE0A 1V2LT 2OTVA 3B8JA 1GBAA 1QRWA 1DWBH 1PYTC 5EXNA 2KCPA 2H9EH 2ULLA 2LNCA 1BMAA 4ISHH 1LO6A 1N1LA 1IQIA 1S5SA 4NSYA 5FBIA 1GJ8B 3VB7A 4BTUB 1XUIA 3GYMA 3MYWA 3SI4H 1GI9B 1S0RA 4ABAA 2R3UA 4O97A 1TAWA 5DKMA 1OP2A 3C27B 2H1UA 1AD8H 2J4IA 2AS9A 4UFFH 1ACBE 3FKSD 3DSPA 3QLPH 1YPMH 1C5OH 5GCHF 1FAXA 2FO9A 3W95A 1QRXA 4HTCH 1IAUA 5LH8A 5FX6A 1QBOA 1CA8B 1FY3A 4ZHAA 4NZLA 1UW7A 3MU5A 2HGTH 3EYDA 3JZ2B 1ETSH 1DUAA 3A82A 4J2YB 1SPJA 2ZHFH 2WPJS 1A61H 1S6LA 2ZC9H 5TJXA 3QDZB 1G3DA 2PP6A 1IQJA 1GMHG 1OSSA 2BDHA 3SU2A 1KXCA 3SGAE 4GAWA 1T4UH 1C1MA 4K8BA 4O9VA 1LVYA 1JBUH 1DY8A 4ZHLU 3IITA 2GDEH 1P2OA 2HNTE 1O2KA 5EQQA 1WXRA 2KM0A 3A7VA 2NU3E 1AMHA 1KIGH 5GNDA 3Q3YA 3RMOH 2QV1A 1ELAA 3SNAA 4YZUA 2A45B 2FDAA 2BX3A 3PLBA 8KME2 3PWCA 2KR7A 3G01A 1UK4A 1UTLM 4GHTA 1C5NH 2ILNA 5E2OA 2FZZA 2F9OA 1H9HE 1LVMA 1FZZA 1GI2A 1MZDA 4DT7B 3W1EA 4QT8C 2YMSD 1GCTC 1TX7A 3HKIB 4OS4A 1YLDA 2F9PA 3TH3H 3SJ8A 1WQVH 3GCHB 4ZKOU 3CS7A 1NFYA 2LELA 1G3CA 1CT4E 3Q00A 1BHXB 1BTWA 3UTUH 2ALVA 4AGKA 2PGQB 3P8GA 1LQEA 1K1LA 2QE7D 1O39A 3PYHA 2ODPA 1OWKA 3KL6A 1SLVB 1SFQB 3ZIAD 4B2CA 1Z1IA 3LDXH 2GZ8A 4KKDA 5DN6D 1AB9B 1O0DH 2RDLA 3TJOA 5DP7A 1XKAC 1GJ5H 4Q7XA 1V6DA 1TGNA 2OLGA 2BD2A 2WV9A 2VGCC 3BTKE 1GCDA 1TOCB 3S9CA 3SJIA 1JOUB 2BVRH 2B8OH 4KTCA 1KLTA 2Z7FE 2Z9LA 2GT7A 1DVAH 5ESTE 2B5TB 2GVFA 1RFNA 3HGNA 3RXQA 1QL7A 2Z9GA 1C1SA 2SGFE 2GDDA 1OWEA 1NROH 2BD9A 1TONA 1SHHB 3A81A 5CHAB 3QTOH 4A92A 3A7XA 4WMEA 1MMJN 1CT0E 2P3TB 4BAHB 4JYTA 2QXGA 5F6MA 4IGDA 1CQQA 3SI3H 1DITH 2BXUH 1TX8A 4IS5A 4E05H 1NRQH 2Y5HA 2FS8A 3E8LA 3KQDA 3NK8A 1EKBB 3ZVDA 5A8XA 1LPZB 2TRMA 2NU4E 2ZZUH 4X2WA 1AE5A 1ORFA 1QB1A 3E90B 1C1VH 5C20A 1AGJA 3O8DA 3MU8A 1QJ6B 5C67A 1EASA 4CBOA 2H5CA 2P3UB 2GV6A 2ZGXH 2K0QA 1MZAA 1TWXB 2BD5A 3M7UA 1QL9A 4Y0ZE 2F43B 3MU1A 2RG3A 1TIOA 3GDVA 3DCLA 1A46H 1UTOA 4FUEA 1GHAG 1SLWB 1QNJA 3LIWA 4HGCA 3VB5A 1TMTH 2GZ7A 1QFKH 2C8ZB 1C5SA 1J16A 4K1EA 4MNXA 1O3MA 2G52A 1P2NA 3MH7A 1M9UA 3M7QA 3KQ5A 3ZZBA 1LVBA 1ZOMA 4Z1MD 5FAHA 1T31A 4O3UA 3NZIA 4BOHA 1LHFH 2C8XB 1G2LA 3A8AA 4ESTE 2F91A 3DUXH 1P02A 4MPXA 5IYTA 3RXBA 2V3HH 1QBVH 4J1YA 1GHBF 1PFXC 5EJ1A 2PWXA 1MCVA 3WW7A 1AWFH 1T32A 2FI4E 3CS0A 1DDJA 2KCOA 3K65B 1SGYE 5EW1H 2ZF0H 5CHBA 2R2MB 2RCEA 1ZRBA 3V0XA 3F68H 3SV7A 1K9OE
chains in the Genus database with same CATH topology
3ZV9A 1GCTB 1T8LA 1TNIA 5F8XA 3GDSA 4X1PU 3MNCA 1ZSKA 1ZYOA 2ZTXA 4CHAB 2A1DB 1FONA 2ZWLH 3UREA 2WPLS 3SN8A 2JETC 3A7ZA 1W13U 2OINA 1YPHC 2A7CA 2CMYA 3QUMP 1ZJDA 1QA7A 3LJOA 5A0AE 5C2ZA 1O33A 1BMMH 2PKAA 2BLVA 1TALA 1GI4A 3V12A 2QF0A 1OS8A 1W3CA 3ZZ4A 1TNKA 3P8NA 5C5NA 4DIIH 1TA2A 2VGCB 1MUEB 1Q3XA 4I8KA 3P95A 4DY7B 2A0QB 1RTFB 3V7TA 2SGDE 2GCHG 1OKXA 3BN9A 2TIOA 1GVZA 5K0HA 1JRTA 3SU4A 1O5GH 4CH2B 2SNWA 2BOHB 1K22H 2G5NA 4VGCC 1XM1A 1SGRE 4OGXA 3FANA 4I8JA 1FV9A 3AASA 1RIWC 3K6YA 1SBWA 4ZXXH 1EAXA 2J95A 1MCTA 2BOKA 3VXEH 2HPQH 4FUCA 1O2TA 4GCHF 2FOMB 4X6PA 3SNCA 4MPWA 1W2KH 1PJPA 4K5ZA 3U8TH 1C1UH 1F0RA 1DSTA 2VWMA 1SGIB 4A7IB 2H5DA 2DUCA 1P9UA 4HZHA 2FS9A 2ZDKA 3NWUA 2P59A 1QB6A 5DP4A 1FAKH 1BQYA 3UWIA 2F9VA 1TRYA 1CBWC 2WPIS 4CRCA 2VWLA 4OGYA 4MVNA 2Z3EA 1VCPA 1UTKA 2Y81A 3UQVA 4I8GA 3SHCH 4M7GA 2BZAA 3E0PB 1TA6A 1YPGH 2FXRA 1DT2A 2OC7A 3KCGH 3GCNA 2FOAA 3Q3XA 2A5KA 3FAOA 3U69H 3LPRA 4DGJA 4AOQA 1Z7KA 3QGJA 1SI5H 3RXGA 5HYOA 1UHBA 1EX3A 2FODA 1JWTA 1AVGH 4AYYB 2AEIH 1C2GA 4E06H 3GYLB 2PFEA 4MNVA 3LGIA 1J8AA 3RXSA 3A89A 4ZKNU 4KP0A 2SGPE 3UY9A 1L1NA 1MTUA 2I6SA 3URCA 5FCKA 2HNTF 2JH5D 1WAYB 2C90B 3LONA 1F2SE 1HV7A 2ZHDA 2XC5A 2EI6A 5FX5A 1BOQA 2XC0A 4RN6A 3BIVH 5ESBA 5H4IB 2FOEA 3F1SB 1FQ3A 1SLXB 2PKSB 1V2RT 1GDNA 2I6QA 3H5CB 1EPTA 4AB8A 3H7OA 5FCRA 1GMDF 3UNQA 2CF8H 4Q2KA 1FUJA 2ZU1A 1V2JT 2UWLA 4K60A 3FFGA 1TB6H 2PUQH 4Y8ZA 2Q6DA 3PTBA 2BDBA 3RM0H 1X7AC 1O2NA 1CT2E 1SGEE 2J94A 2ZPSA 4DIHH 1A3EH 4AX9H 4Y7BA 1ZGIA 1Z8JB 1D3TB 1O2WA 4GHQA 1MTWA 3UFAA 1L1JA 1BTUA 1CGJE 1T8OA 3S0NA 3SO3A 8ESTE 5I46H 1SGFA 3KGPA 1HLTH 4AFZA 5ABWA 3K9XB 3UPEA 3RXJA 4ISOA 1C1RA 1PPHE 1TPOA 4JZIA 3GISB 1TYNA 2OBOA 2WPKS 4UE7H 3D65E 2NU0E 3RXOA 3C1KA 1UCYE 2VU8E 3UUZA 1C5YB 1K1MA 4BAOB 1UVSH 3OY5U 4JK5A 1K28D 4TY7A 2Q6GA 2UUKB 1ZPZA 1TPSA 2QAAA 1TNJA 5DP5A 2J92A 3LKWA 2AH4X 2GGVB 2BHGA 2VIWA 4WWYA 1GJ4H 2VIPA 1Z71A 2FWWA 1F0TA 4ABIA 1A3BH 3TITA 3TJVA 1YF4A 1GBKA 1NFXA 2K1QA 2CXVA 1C4V2 2ZU4A 4JMYA 3ZZAA 2ZGBH 4NIVA 1P03A 4WVPE 3ATWA 1EB1H 1EXFA 1OWHA 2QGRA 3K2UA 2BD8A 3S9BA 4FUJA 1TX6A 2ZEBA 3BEFB 2WUBA 1GBDA 1Z6EA 2WV5A 1H9LB 4YT7H 5GCHG 1DICA 3U9AH 3M3SA 1MBQA 3SQHE 3LGUA 1VZQH 3QO6A 1L2EA 1AUJA 1E0FD 1AWHB 1XVMA 3EDXB 2A4RA 3E91A 1WTHD 2EC9H 1N8OB 3SQEE 3V13A 4ABDA 3MFJA 2QF3A 1EPTC 3L3TA 4Y7AA 4AGJA 1DSUA 3Q76A 2VINA 2GMTB 4MPUA 4DVAU 4BXWA 4NSVA 1B0FA 1ELGA 3V3MA 1GJBB 1H8DH 1DWDH 3AW1A 1K1NA 4I8HA 1EATA 1VCQA 4XOJA 4XE4A 1W0ZU 3I78A 2ZFSA 1O31A 1DUEA 2AERH 7LPRA 4KTUA 3GOVB 2ZQ1A 3UIRA 5BPEA 1S82A 1OPHB 3UR6A 3W94A 1EAUA 1S0QA 2QA9E 4IN2A 2QN5T 1BUIA 2FLRH 1XXFA 7KMEH 1O5EH 1MU8B 1TNLA 5HMAA 2M5TA 4LK4A 1OWIA 2BY7X 3OY6U 4H42U 1BTXA 2XXLA 5G4BA 3EE0B 4DJZB 4Z0KA 2NWNA 2ODQA 4AG1A 3VPKA 5HGGA 4D8NA 2G4TA 1SB1H 4NZQA 1KDQB 1BRUP 2PLXA 2OQ5A 2W7UA 2UWPA 3LT3A 1NRSH 1C1PA 1RJXB 1XUFA 1LPGB 2C4FH 4NIYA 1N6YA 4K1SA 1YCPH 1AQ7A 3EA7A 4DG4A 5HM2A 1P2QA 1KXFA 1O5BB 1O2YA 1MAXA 3SJ9A 1TPPA 3RC6A 1AKSB 2FOHA 1SMFE 2ZTZA 3SORA 1ARCA 1O2PA 4D7GA 1A4WH 1P2JA 3SJKA 1YM0A 4X8SH 1EQ9A 1QB9A 2Z9IA 1O3JA 1ZPCA 2VIDA 3HK6B 5EQSA 3SGQE 1P2MA 1P8VC 4ABGA 1BBRH 3T29A 2O8MA 3UQOA 1ZPBA 5C1UA 3PWBA 3VB3A 4AFUA 2QIQA 5DGJA 1A7SA 1SQOA 2Z9KA 1C5RA 3A8DA 2G55A 3P6ZB 4ZROA 2VIOA 2P16A 4O3TA 4MQAA 5DP6A 4MG3A 3ATMA 3FP6E 3FVFB 1O3CA 1BA8B 2QCYA 1HJ8A 2R9PA 3BF6H 1A5IA 3MNSA 2KAIB 3MO9A 4AZ2B 3BTDE 4B1TA 2AGIX 4B74A 3QWCH 3Q77A 1L0ZA 1GHXH 5CE1A 4CRBA 2D2DA 2YNBA 3HPTB 4YOGA 2ZTYA 1AFQB 2BQ7B 1GL1A 1E35B 1LKBA 1CE5A 1Z8GA 1EJAA 5F03A 1CHGA 1Y5BT 3JZ1B 3GY6A 2IN2A 1IHTH 1EZSC 3LOXA 4X8VH 2ZGHA 3BSQA 1C5QA 1MTNB 3KN2A 4FVDA 5JBBS 4YLUA 4TY6A 3SU3A 3DA9B 1G30B 4BNRA 3RXDA 6CHAC 2BDYA 1OYTH 2PHBA 1MKWK 2ZKSA 1S6FA 1J14A 1RRKA 3BEUA 1WV7H 3PO1C 3KIDU 4ABEA 3EA9A 2O8TA 1TRMA 3GY8A 3SGBE 1GDQA 1RTLA 5EOKA 5EODA 1GJDB 1ZMLA 3MU0A 1GBEA 1ANCA 1QBNA 1O2HA 1GHBG 4UONA 3IG6B 2SGEE 4IMQA 2F9BH 5F8ZA 1T7CA 3RU4D 4DW2U 5EXLA 1LTOA 4DURA 4SGBE 1NY22 2ESTE 1C1OA 1GG6C 1WUNH 1YPKH 3IWMA 1EZQA 2P95A 2OP9A 2QXIA 1Y3UA 1PPCE 3D49H 2EI8A 5C1YA 2ZCLP 1GMCG 3MO6A 4NCYA 1WCZA 1O3BA 4I33A 4LZ1H 3TNSA 5DP8A 5DO4H 4U01A 3SW2B 5EXMA 4A1VA 2ANWA 2HOBA 3RXIA 2BY6X 1O3FA 4CR9A 5J4QA 2Z94A 3DT0H 4WMDA 1MQ6A 1ZMNA 1DANH 3F6UH 3N7OA 4ZXYH 3TH2H 1WTGH 1ANEA 4AFQA 4XBDA 3RC5A 3GY5A 1NFWA 4JZFH 2FOCA 1NRRH 2P8OB 1LHCH 4IW4E 2OUAA 1FLEE 3TU7H 3T62A 1GBFA 1C1WH 1O2MA 2GTBA 2O8WA 3AAUA 3OYPA 3S7KB 1NFUA 4INKA 4KELA 4ZKSU 2GZ9A 3RC4A 1E37B 1GI7B 1QY6A 2JKHA 3VXFH 3M3TA 2Y6TA 5JBTA 1FPCH 3PV4A 3HK3B 4MNYA 5FBEA 5JB9S 1CO7E 1FN8A 1A0LA 1UJ1A 1O3NA 3U8OH 4GCHG 4YOJA 4GVUA 4ZUHA 2XYAA 2CHAC 1FY1A 2Q6FA 1ZJKA 4Y79A 4UEHH 4YO9A 4NWKA 1NS3A 2BY5X 2FIRH 2O8LA 1S83A 2BY9X 1SVPA 2R3YA 1AZ8A 2XCFA 2GKVE 3ZZCA 1D9IA 2WYGA 1E36B 5GIBA 5BRRE 5T6GA 7GCHG 1YPEH 3LGYA 1Y5UT 2VIQA 1MD8A 5GPIB 9LPRA 5FPTA 2A2XH 1O36A 4K2YA 1WSSH 3ENSB 2VIVA 2GD4B 2ZHQH 1YCPM 4OS5A 1QQ4A 3BTHE 1P01A 2B0FA 2ZFFH 4TYDA 3SNBA 1AI8H 3A80A 1BITA 5DJ7A 5JYIA 1G2MA 4D7FA 3SV9A 2WINI 1TBQH 1THPB 4H6TA 3STJA 5I25A 4XBBA 3SV8A 2IPHA 3T28A 3TPIZ 3A83A 1QHRB 3PO1B 2VJ1A 3RXPA 8LPRA 1C5PA 1N6XA 2CN0H 1C4Y2 1W12U 3VGCC 2CJIA 3DFJA 1D3DB 3OSYA 4NFFA 3TNTA 4I7YH 1XUJA 3M5MA 1V2MT 3TLOA 1S6HA 3CP7A 4F4OC 3TK6A 2FI5E 1XMNB 2FOGA 4U2WA 1BRBE 4X1SU 2BVSH 1O5FH 3ZZ7A 3A86A 1HAVB 1V2OT 5EW2H 1S84A 5JDUB 2Q1JA 2THFB 1YCPK 1KTTB 5LGOA 1BDAA 3PB1E 1H8IH 1OWDA 1W8BH 2H2ZA 2ZGCA 1RXPA 3ZYEA 1UK3A 2GX4A 1O37A 1Z1JA 3A85A 5GDSH 5AFZH 1GBBA 2C8YB 1U6QA 1Z8IB 5A8YA 1C2DA 2WV4A 1DX5M 2V0BA 4JYVH 4ZMAH 4GPGA 3S9AA 4ABBA 2O9QA 4Y8XA 1B0EA 1KY9A 3MH5A 1HUTH 1KTSB 2TGAA 3FZZA 2W3KA 1SGNE 3PLPA 1ETTH 3QN7A 3EA8A 1AIXH 1QJ7B 3ZZ9A 1QQUA 3TGKE 1MQ5A 3MI4A 1HAOH 5DG6A 3T25A 1KXDA 1ZSLA 1G9IE 1HFDA 5L2ZH 4X2VA 1SOZA 3DD2H 4X8UH 2BTCE 3M5LA 1P05A 1FJSA 2GP9B 2QYIA 2PGBB 1D6WA 1O2UA 1VGCC 3GCTF 2ZNKH 3MTYA 2HLCA 4XFQA 1B7XB 1O3DA 4H4FA 1DLEA 1AKSA 1UTJA 3RMNH 4AG2A 1KSNA 4KGAA 2IJOB 1TMUH 2HVXA 1G36A 1HCGA 1O3HA 3PMBB 1C2FA 1UVUH 1FI8A 2J9NA 2PW8H 1AVWA 3P8FA 5AFYH 2OD3B 1AN1E 1W7XH 1O2RA 4JK6A 8GCHG 5FPYA 2OQUA 1TBRH 4AN7A 1GI3A 6ESTA 4WH6A 1SC8U 1ELVA 4XDEA 5JB8S 1BTZA 4HI3A 1TMBH 1HAZB 2ANKH 1NU7B 2A4QA 1J9CH 1HGTH 2XBVA 1GHWH 1ZHPA 1K1OA 4Y11E 2PSXA 1GI0A 3BTWE 2CF9H 1AFEH 2W5EA 4Q80A 1KLIH 5FHTA 4CRDA 1ZHMA 3M37A 1GJCB 1BMNH 3M5NA 3LH3A 1CA0C 2ZFQH 4X1QU 3VGCB 2ZPRA 1BHXF 1EZUC 3LJJA 3UNSA 4OS6A 2A2QH 1EJMA 4X1NU 5C5OA 1JMOH 3BTFE 1AUTC 1YPHE 2VVCA 3U98H 2ZFPH 3M5OA 1UTNA 2ZDLA 1DWCH 1C5UA 4FU9A 4U32A 1ZLRA 2JETB 1WU1A 2AMQA 5T6DA 4WJG2 1NC6A 3K6ZA 1PPZA 1O38A 2BDAA 2EA3A 2BD3A 1H9IE 4X2XA 5E2PA 2BDGA 4K3JA 2UWOA 1C1QA 5L2YH 4CBNA 1IQFA 2P94A 4CRGA 5GWZA 1C2JA 4NA9H 2PUXB 3RLYH 3A8CA 1BRCE 3BTQE 3VEQB 3M7TA 4LZ4B 3A7YA 1BJVA 1YPLH 3KQEA 2Z3CA 4H6SB 5DPAA 3T26A 1FY5A 1O32A 6GCHF 4AB9A 2F9NA 2V3OH 2ODYB 3A84A 1SL3A 4VGCB 5CMXH 1GVLA 2G81E 3AAVA 1ESTA 4TPIZ 4XBCA 3UNRA 1RIWB 1Z6JH 1V2KT 1E38B 3E3TA 4Y71A 3ZZDA 1HJAC 1UCYH 3GCOA 2IOTA 1NESE 4BAKB 1YGCH 1F0UA 1TQ0B 3TGIE 3RMMH 1NPMA 1C5XB 1AY6H 1CSOE 3RXEA 1WYKA 3ATIA 2TGPZ 5T3HA 1K1JA 4R8TB 4Y8YA 2ZP0H 3OTJE 3FZDA 1CGIE 2JH6D 2A5IA 1CBWB 5AF9H 1ZGVA 2BLWA 1VITF 2ALPA 2J2UA 4NG9H 2FTMA 4WH8A 1LQDB 1ZHRA 2VB0A 3NUMA 1L4ZA 3QZQA 1DOJA 1FMGA 5EGMA 3ELAH 3SV6A 1FDPA 1NO9H 5A0BA 2FP7B 4ABHA 2P93A 3E6PH 1KXAA 3RXTA 1ZTLA 3E1XB 4IN1A 4OS2A 1C2IA 1HAXB 4NGAH 1C5VA 1LVOA 2FI3E 1GJ9B 2XBYA 5E8EH 1XVOA 3DHKH 4XSKU 2BLOA 4X8TH 1A5HA 1Q31A 2ZDNA 1C1NA 2FYQA 2BQWB 1GI1A 2STAE 1HXEH 3NKKA 5AVDA 1IQHA 5K7RA 3TGJE 5DP9A 1EUFA 4A6LA 1GBMA 3PM3A 2BVXH 4B2AA 3F9EA 1EOLA 1KLJH 3NXPA 4MPVA 1HAPH 1NRPH 4ZHMU 1GDUA 1Z8RA 1MAYA 5FPSA 1RTKA 1MKXH 1VJAU 2HNTC 1DM4B 2Y7ZA 4A1XA 1TGCA 5C1XA 1P2IA 1O3EA 1IQGA 3VB6A 4JZEH 3OU0A 1C4U2 2FM2A 3ZVEA 3GCHC 1FIWA 1ZSJA 1GHVH 2BB4A 1PPGE 1C1TA 1P3CA 1QCPA 1O2LA 3ZZ3A 1HIAB 3MMGA 3BV9B 3RXFA 2C8WB 2R2WU 2XCNA 1MTSA 1T4VH 2CV3A 1GBJA 2XRCA 1DWEH 4BAMB 4UDWH