8LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA01
4NGAH 1K2I1 1O2YA 2B9LA 3I77A 2CJIA 4TY6A 2BZ6H 5TCCA 4ABHA 1IQLA 1PPFE 1BDAA 1FJSA 1ESBA 4ABBA 4Q80A 3AW1A 1UVPA 3NPSA 1JRTA 2XYAA 4ZHAA 5C20A 5F8XA 2BX4A 1QR3E 2RDLA 1NY22 1E35B 4FVDA 2FIRH 1CQQA 1WCZA 4WVPE 1A0JA 5F8TA 1P05A 1AZ8A 1O2PA 1ZLRA 1MAXA 1D3TB 1GPZA 1WV7H 4R8TB 1ZSKA 1GJDB 3T26A 1O3KA 1GJAB 3E6PH 2DUCA 1H9LB 3KQBA 2Z9JA 1ZZZA 1UTLM 4ABGA 3F9GA 2B7DH 1RTFB 5DP6A 3U8OH 5A2MH 4AB8A 3KQDA 2QGRA 3Q3YA 1FY8E 1CE5A 1J8AA 1BTZA 1UCYH 1ARBA 2GKVE 4NA9H 4ZXXH 1IOEA 3A83A 1TX7A 4BNRA 5DP4A 3SNBA 4B75A 2ZGHA 4AYVB 4TWWA 1YCPM 2JETC 1QJ7B 3A7XA 3HK6B 1BB0B 4O3TA 1ABIH 3KL6A 5EGMA 2FP7B 1ZSJA 4Z0KA 1Z8IB 3PV4A 5HYOA 5C5OA 2H9TH 3PMHB 4AGJA 1GHYH 2VWMA 1LVBA 5GIBA 1C4U2 1TFXA 3C27B 3NZIA 1ELBA 3BTKE 2STAE 1NFXA 4F4OC 1OP2A 3FANA 4FUEA 4TPIZ 1C5RA 1GI2A 1BIOA 2PR3A 1TGBA 1L0ZA 3QZRA 3K2UA 1HAYB 4J2YB 4BTTB 1T8NA 2IOTA 3M3VA 1ZOMA 4MPUA 1GBHA 4LZ4B 2WPLS 4NZLA 4NIWA 4SGAE 1SHYA 1YF4A 1THPB 1V2ST 2QXHA 1C2HA 2A4QA 1XKBC 1GGDB 1XUGA 1LDTT 2P3TB 4MPWA 1B0EA 3KNXA 4MLFB 2GD4B 3TIUA 1V2VT 1CHOF 1A7SA 3OYPA 4UFGH 4B2BA 1LVYA 4X8UH 1EOJA 2G4TA 4IN2A 2JH5D 1TYNA 1DXPA 1T32A 1JRSA 3ITIA 3QTOH 4I8JA 1C1SA 3DT0H 1WAYB 3B9FH 4IGDA 1MBMA 2W7UA 1T4VH 1GBTA 1S85A 1EKBB 3ZZ3A 5JB9S 4YLQH 1BRAA 3RLWH 1T4UH 1NPMA 1EQ9A 1C1MA 1MKXH 3H7OA 1BTWA 1SOZA 6CHAC 3GDVA 2F9NA 2HPPH 4BAHB 1LMWB 4X1SU 2AMPA 1WQSA 2O8MA 2TGDA 3BTDE 1YKTA 1DXWA 1QTFA 4NCYA 4GPGA 1XXDA 1CO7E 5IYTA 3RXAA 3NXPA 2XXLA 1MAYA 2I6SA 2ANYA 4NSYA 1W2KH 2FXRA 4BXSA 1P2KA 3A8AA 1JXPA 1ELDE 5GCHG 3SO3A 1MQ5A 3RU4E 1Z1JA 5EG4A 1ZJDA 3ZVCA 3SNAA 2J95A 4NA8A 3ZZ8A 2D2DA 1S0RA 2BQ6B 2A2QH 1O3BA 2GDEH 4D9RA 3MU1A 1P01A 1UVUH 1GI5A 2XC0A 4Y6DA 4AGKA 3BTFE 1MTNC 1GHBF 2CHAC 3M36A 4AX9H 1NS3A 2VB0A 4BTIB 1F0TA 3SZNA 1MTUA 1TMUH 4U30A 5EW2H 1EZQA 1O3OA 2Q1JA 1TB6H 1AFQB 1GBCA 2CMYA 3RU4D 1MU8B 5GPIB 1MMJN 2PKAA 3SJIA 2GCHG 2LPRA 1Q31A 1GJCB 1NESE 3P6ZB 4OS5A 1V2TT 3P17H 3RXMA 2ZCLP 3ATIA 2SGEE 7KMEH 3QWCH 5DKMA 4ESTE 3S9AA 4MNXA 1P03A 3SUGA 3A8DA 1OWIA 2ULLA 4AFZA 4CRBA 3ODFA 1ESAA 4LZ1H 1G2LA 3SV2H 1BHXF 3EAJA 1D4PB 4GCHG 1XXFA 2PKAB 1TNKA 1O3AA 2PSYA 2BXTH 2GZ8A 2VGCC 3GYMA 3PROA 1EJNA 1MQ6A 1C5VA 2G52A 2GVFA 3E0PB 3RC6A 2PTCE 1B5GH 2AERH 4Y7BA 1AE8H 1DM4B 1QBVH 2SGQE 1H9HE 3ZZDA 5JYIA 5SGAE 2BVRH 2Z9GA 3ODDA 1HBTH 3QO6A 1O3GA 5H4IB 2VJ1A 1SPJA 5C3NA 5ESTE 1JIRA 4NG9H 1SQOA 3LGWA 1SL3A 9ESTA 1FUJA 3SOSA 2TGPZ 3PLPA 2ODQA 3F68H 4MNYA 1C9PA 2ILNA 5HM9A 1BRUP 5C1UA 2VIQA 4ABJA 1YYY1 2ZECA 2PGBB 1EAWA 1EJAA 1K1MA 3PTBA 2R3YA 3RC5A 3MFJA 1TX6A 3NCLA 3T29A 4H6SB 1TNHA 4LXBH 1V2WT 3LH1A 3O8RA 1C1VH 1TONA 7LPRA 1HAIH 1Y3YA 2XWAA 1BTHH 3UQOA 1GBFA 1G37A 1RIWC 2XBWA 1KTTB 1O2HA 4YT6H 5F03A 2EI6A 1WSSH 1SBWA 1GVLA 3N7OA 1GMHF 4WWYA 2FODA 2Y82A 1ANBA 1Y5BT 3K65B 1S6HA 1O3IA 3U98H 4FUCA 1C5UA 2ZKSA 3BTME 3MNCA 5BPEA 5A0CA 3UOUA 1SGDE 4LK4A 4DVAU 3RMMH 1TGNA 4K1EA 1H4WA 3RXDA 1EAUA 1ID5H 1YPMH 3ZZ4A 1GBMA 3Q00A 1D3DB 3LPRA 5TCAA 1KLJH 5DGJA 4DIIH 4X6NA 1VITG 1XUHA 1OWKA 1C2IA 3I29A 1SLXB 1NTPA 1VCWA 3VB4A 1EJMA 3OTJE 1S5SA 1C2LA 2QXGA 3GCOA 1EX3A 1ETTH 4UFEH 4VGCC 5EQQA 2P93A 3RXPA 2A7HA 8ESTE 2G55A 3UFAA 1ZTJA 1P2QA 5AFYH 3SJ9A 1GHAF 4Y76A 1ZMLA 4IS5A 7GCHF 1NRPH 4YOJA 3FZZA 1N8OB 1NN6A 1O37A 2H2ZA 2RG3A 2CV3A 4CRGA 2SNVA 2BD3A 2ASUB 1L1JA 2AMQA 5C2ZA 1ZPCA 3FP6E 2ZGJA 1DWBH 4FUJA 3TJNA 1FY1A 4ABDA 3ZZCA 3HPTB 3Q76A 4BXWA 4OS2A 3A7TA 5DO4H 2ZGBH 2SGFE 4ASHA 2FLRH 1C5QA 4GHQA 1GJBB 3MO9A 1C5ZB 1O3LA 3GISB 2B5TB 3LU9B 4ZUHA 1OYTH 3ZZBA 1QIXB 1ELTA 4B71A 2C3SA 3RXGA 4ABIA 1KXCA 3TNTA 5T3HA 1MUEB 4M7GA 3BSQA 1C1PA 1P3EA 2Z9KA 2ZHDA 4ABAA 1ABJH 4MVNA 1C1UH 4FUDA 2F9VA 3HKJB 1WOFA 3KQCA 1EAIA 3BIVH 2XC4A 2AYWA 2ZPSA 1TQ0B 2OC1A 1UJ1A 1HJ8A 2P3UB 2A4RA 3CP7A 1GJ5H 2QAAA 1GHXH 3RXFA 1BRCE 1TMBH 1TNGA 2XCFA 1GBLA 4AFUA 1V2QT 4X2XA 1HIAB 1LPGB 4AFSA 1PQ7A 1GBKA 3KIDU 4K60A 1C5YB 3LGIA 3KEEA 4JCNA 2WUBA 3QZQA 4IBLH 3ZZ9A 1ZMJA 1GDUA 1ZGIA 3E3TA 2VIOA 3HK3B 1A3EH 1ANDA 3Q3XA 4HTCH 2JH6D 2ZCHP 2HNTF 1PQAA 1GHVH 1YCPK 1O39A 2F9BH 3ZVDA 3UPEA 1TPOA 3A80A 1O3JA 1DFPA 4BAKB 4A1TA 2YNBA 2BQWB 1QBNA 1MZAA 2FYQA 2BD5A 4J1YA 3ZZ7A 1TWXB 1Q3XA 2EI8A 1C1NA 1FIZA 1NRQH 5JBAS 2EEKA 1GBAA 1NO9H 1GI6A 3MH4A 3ZV9A 1J17T 2SGAA 1O2UA 1P2NA 3LH3A 4U2WA 4XDEA 1SR5C 2C8ZB 3Q3KA 2QV1A 2OQ5A 3M5OA 4JYTA 3MH7A 3TH4H 1P8VC 3A7YA 4X6MA 2P59A 1RS0A 2AEIH 3S9CA 1GMDG 1L1GA 2QIQA 1IQFA 3S7HB 1GGDC 3GYLB 3LT3A 2RCEA 2VU8E 5T6GA 2Z3EA 3TH3H 1TBRH 1D6RA 3MYWA 2UUKB 5A8XA 1SGFA 2Y5GA 3FZDA 1FNIA 1O2JA 1SI5H 1DVAH 3SJ8A 3C1KA 4OS4A 1BUIA 1HAHH 1LPKB 2FDAA 4UEHH 1AB9B 2ALPA 1O2LA 4X8SH 1X7AC 2BDBA 2BLVA 2UWOA 1H1BA 1L4DA 2UUFB 3ELAH 4CBNA 4DT7B 5BRRE 1P57B 1GBIA 2ZQ2A 2GP9B 1AVWA 3JZ2B 3ZVBA 4KTUA 3TJOA 3STJA 1B0FA 2BQ7B 2FOEA 4H4FA 4OS1A 4NWKA 1O2IA 1ZR0A 4I8HA 1C2GA 1NU7B 1MU6B 2GGVB 3SU3A 1T31A 1FY4A 3ATMA 1F5KU 3O8DA 1V2LT 1S6FA 1CT0E 1EB2A 1HDTH 1C2KA 1NC6A 1YC0A 2QA9E 3P92A 3PO1C 2Y6TA 3QUMP 2EI7A 1BMLA 4YESB 4A92A 1EPTC 1T8OA 1AFEH 3P8GA 3MO3A 3IG6B 3ZVEA 1CT2E 4DURA 2CGAA 3F6UH 1JBUH 3G01A 2YOLA 1UTOA 4UE7H 4IW4E 1IQIA 2ZDLA 1WYKA 3SGAE 4H6TA 2PV9B 2ZDAH 1CA0C 1OWDA 1AFQC 2FWWA 1GI1A 1SGNE 2ZIQH 2Q6GA 1TNJA 6LPRA 2VVUA 1K1LA 5DJ7A 9LPRA 1C9TA 4I33A 5ETXA 1ZYOA 2FOGA 3GCHC 5F8ZA 4CRCA 4D7FA 3AASA 4JK6A 1DANH 3SJKA 1THRH 1HGTH 4GCHF 1O2WA 4X2VA 1O2OA 1F0SA 3UY9A 4DGJA 1O35A 1ORFA 1GL0E 2OXSA 1MD7A 2BLQA 2V35A 1P02A 2XCNA 1YPKH 2HGTH 2BD9A 1QFKH 4A7IB 1VZQH 1K22H 3M35A 4GUXA 5CHAB 4CRDA 8GCHG 3A7VA 1MH0A 4NFFA 1J14A 5J4QA 4NA7A 1OWHA 3L3TA 2ZDKA 1P11E 2ZU1A 4K8YA 2FZZA 4R0IA 2ZFFH 1LHFH 3HGNA 3UWJH 3LDXH 1BQYA 5EQSA 2ZFSA 3M37A 1RD3B 1UTQA 1BZXE 3VFEA 2BD7A 4IMQA 2GCTC 2ODPA 5K0HA 5ABWA 4ZKSU 3D62A 4OGXA 4KGAA 1EZSC 1C1RA 2A5AA 1A46H 5FPSA 3VGCC 4X1PU 3UNRA 4O9VA 3M3SA 1DLKB 1FN8A 1L4ZA 1NFUA 1Z6EA 3S69A 1IHTH 4JZ1A 5E0HA 1YPHC 2AIQA 2VIDA 2TRMA 2BDIA 5EPYA 3RXOA 1W12U 1BBRE 4IC5A 3M61U 2B8OH 4K3JA 1S83A 1T7CA 3GY2A 1HAOH 3RXJA 1DDJA 1IQNA 4XBCA 2J4IA 1YP9A 3GCNA 2NU3E 1S84A 4YO9A 1SGTA 4CH8B 4A5TS 2BYAX 4FU8A 2BDGA 4YLUA 2XWBI 1AI8H 2VH0A 3PMAB 2TGTA 4DG4A 1J15A 1F5LA 1PPBH 3H5CB 1Y5AT 4OS6A 4ISHH 5FCKA 1G3BA 4FXGH 2FOMB 3SI3H 2A5IA 4B2CA 2OCVB 3MI4A 1IQKA 2ZDMA 5AVDA 2ZFRH 2BVXH 4K8BA 2GDDA 2QF0A 1C5NH 1EASA 4GSOA 2TGAA 2FTLE 3QGNB 5GDSH 2BY9X 2SGDE 1BMNH 4HI3A 3U1JB 4ZAEA 2EC9H 1UMAH 2LNCA 2ZWLH 2F9OA 2WYJA 2ZQ1A 4FUHA 2UUJB 1HB0B 1OYQA 1T8LA 4YTAA 5LPEA 1O2MA 1ZJKA 3SBKA 1HJAC 1TPSA 1FMGA 1TALA 2O8WA 2BOHB 3VB6A 1P2MA 5DP3A 1TGCA 1QL9A 1VGCB 2W3IA 1O2VA 2BX3A 1QL7A 1OX1A 3BTEE 3T27A 2VH6A 2THFB 3TJUA 3QTVH 4WH6A 1N8OC 3MNXA 1AVGH 1F5RA 1Q2WA 5LPRA 4KELA 1DOJA 1QNJA 4IC6A 3BTHE 1O2SA 2C4FH 2V3HH 3O8CA 4AN7A 1MTSA 5GXPA 2XC5A 1FY3A 1ANEA 1VITH 3RMLH 3EA8A 1BITA 2HPQH 1W11U 1G36A 4ZKRU 4AG2A 4XFQA 1SGQE 2PUQH 4I7YH 2WV4A 5A8YA 1JWTA 1TIOA 2BHGA 1LKAA 5FBIA 1G30B 3U1IB 2P8OB 2WYGA 4E7RG 3QLPH 2ESTE 1C5LH 2BDHA 1FPCH 2ZU5A 3SU5A 2J34A 3BTQE 4WH8A 3FP8E 4I32A 3QX5H 5DPAA 1O32A 2JKHA 2BY8X 4U01A 2C8WB 2JH0D 1MCTA 2FI5E 3EQ0H 1PQ8A 2M5TA 2ZA5A 3U9AH 2D26C 3GY3A 3GOVB 2SGPE 1SGEE 3ENSB 1ETSH 1RJXB 3OX7U 5AFZH 4MDSA 2SFAA 1SLUB 1W0YH 4FUIA 1BBRH 1AHTH 1QA0A 3RXEA 1JMOH 2QC2A 1EOLA 3B23B 4XSKU 2V3OH 3RC4A 3NUMA 1VJ9U 1FI8A 4A1VA 3S9BA 4HZHA 3RDZA 1QRWA 2WPIS 1ZGVA 1XM1A 3M5LA 2J92A 1AKSA 1PPZA 3T28A 1PPHE 1O2ZA 2P16A 1Z6JH 4UFFH 2HWLB 1GCTB 1UCYK 3A7WA 1P0SH 1BJUA 5PTPA 2FESH 2OC0A 1LHCH 1TNLA 4I8GA 3RXBA 1BRBE 2O8UA 3ESTA 3LGTA 1GL1A 1K1OA 5A8ZA 5EXNA 1AKSB 1YM0A 1KXDA 2G5NA 3PLKA 2R0KA 5C67A 1KYNA 2F9PA 1Z8JB 1V2MT 1WQVH 1Z8GA 2PSXA 3LOXA 1XUJA 2PWXA 4BOHA 3E91A 1GG6C 1GMDF 5I46H 3A87A 1ELAA 3A84A 3UR6A 2Z3DA 3M7QA 1SFIA 3RXQA 4GVUA 1FIWA 1DT2A 1OP0A 3SNEA 1TABE 4GHTA 1UVTH 1C2MA 2ZTXA 2NU2E 5EQRA 2Z3CA 2XRCA 1Y3VA 1LVOA 4WMDA 2BB4A 1QY6A 4UONA 4RKOB 3O8BA 5FAHA 4INKA 1W14U 4CHAB 1UVOA 3M7TA 1O30A 2OUAA 1K9OE 4U32A 1IQMA 1NU9A 4ZHLU 4YOIA 2AGEX 1TNIA 3T62A 1WTGH 2BD8A 3RM2H 3UUZA 2AH4X 2VWLA 2IJOB 4X2WA 3KHVA 3UNSA 1MKWH 1IQJA 3AAVA 4Y8YA 2ODYB 3A88A 2WV5A 1AWFH 1PYTC 2TIOA 1SFQB 3GY4A 3BEUA 8LPRA 1EP5A 1SG8B 1CHOG 1F92A 3V0XA 4MNWA 2ZF0H 4XE4A 1UHBA 1MKXK 5DP8A 1O3DA 1EXFA 3SNCA 4DOQA 4IN1A 2F91A 3A86A 1QRXA 1S0QA 2QXJA 1XVOA 5F6MA 3OY6U 2OQUA 4D9QA 4JYVH 1DUAA 1LQDB 2PFEA 2ZCKP 2G00A 4WXVA 1C5XB 6CHAB 1C5WB 1CVWH 1T8MA 3V3MA 1O3MA 1UHBB 1SGIB 1UVSH 4DW2U 2FOBA 4WMFA 1TBQH 4AZ2B 5HMAA 1NRRH 2AMDA 2VIPA 1ARCA 3KF2A 2F83A 1YPLH 3SV6A 1O3FA 3D23A 3DUXH 1TRYA 2C8XB 3DD2H 5HXFA 2TBSA 3UWIA 3A85A 1P2IA 3FP7E 3LC5A 1A2CH 2D8WA 5FX5A 3RMOH 1GDNA 2ZP0H 1SVPA 3PTNA 4WF8A 2ZHQH 2PLXA 4ZH8A 1UK2A 3TH2H 4BTUB 1HFDA 1SGPE 1YLDA 1GI0A 4I31A 3QGJA 1O5AB 3NK8A 2FX4A 4FUGA 4K5ZA 3SHAH 1D3QB 2BDCA 1A5HA 2Y7ZA 4ZKNU 1HIAA 1P09A 4B1TA 3LGYA 3BTWE 8GCHF 2BXUH 2AFQB 2FS8A 3F1SB 2WPKS 5EODA 2PTNA 2Y80A 4KP0A 1O2XA 1TGTA 1QQ4A 3FFGA 2CHAB 2FS9A 4Y7AA 2CF9H 3TGKE 5L30H 2BOKA 2HLCA 4GLYA 4O3UA 1P2JA 5E0JA 1GHBG 1HNEE 3ZV8A 1IQEA 1O3NA 1MTWA 1SMFE 1TPAE 1C5OH 4YZUA 1BTPA 4KTCA 1TRNA 4E7NA 1HPGA 5EXLA 3SORA 1EZUC 1BTYA 1TOCB 5LPFA 2G5VA 1PPCE 2XW9A 3BG4B 1D3PB 4X8VH 4E05H 4X1QU 2HVXA 1O34A 2VGCB 1YPGH 1E34B 3AW0A 3GCTG 1GMCG 1RFNA 1TAWA 2CXVA 3RXVA 1UK4A 1CU1A 1ZSLA 2FPZA 2FOFA 1CBWB 1CT4E 1A1RA 5DP5A 1DY9A 2FEQH 1FY5A 2OBQA 2ZEBA 2HNTC 1SB1H 3VXFH 5E2OA 4NIYA 5FBEA 3NKKA 3U69H 1GVKB 1YGCH 1C5MD 1RRKA 2A45B 5FX6A 2RA3A 2H1UA 5K7RA 1ZMNA 2Y81A 2BVSH 5FPYA 3RM0H 3P8OA 2ZTYA 2QYIA 4Y8XA 3QN7A 2QCYA 2ZPRA 1H8IH 1RGQA 3DA9B 2VIVA 1KXEA 2W5EA 3M7UA 3BTTE 2Z7FE 3GY8A 3MTYA 1FZZA 4JZEH 1DPOA 1O2KA 3F9FA 5EW1H 4SGBE 1WU1A 1MD8A 4Y71A 4YM9A 1RTKA 1V2UT 5DP7A 5I25A 4NFEA 1SLVB 3SU0A 4NZQA 1CGJE 3MU4A 1C5PA 1V2OT 4X6OA 1A61H 1DX5M 2A7JA 1TPPA 4Y0ZE 1EZXC 2ZU4A 1J16A 3GDUA 1V2RT 4AB9A 2D1JA 1G2MA 3K6ZA 1DSUA 4I8KA 3LJOA 1GMHG 2A4OA 1Y3UA 1AQ7A 4H42U 1ZRKA 5FCRA 3K6YA 1A5GH 1UTJA 1HAVA 3RMNH 2GZ9A 3D65E 1W0ZU 2F3CE 2Q6DA 1GDQA 2G51A 2O8LA 4ISOA 2SNWA 1UK3A 4JZDH 2A5KA 2J94A 1BMAA 5HGGA 3RP2A 5C1XA 1NM6A 1OXGA 3CENA 1TMTH 1V6DA 4NWLA 4MPXA 5GCHF 4XBDA 3V7TA 2Y5HA 3H7TA 3STIA 1CGIE 2Z9IA 1O5DH 2J38A 3IWMA 1HAVB 1YPHE 2FLBH 3E1XB 2UWLA 1O2TA 2ZFTA 1QA7A 4ABEA 3MH6A 2BTCE 2GV6A 1HLTH 1VJAU 1C1TA 1H9IE 3BG8A 5G4BA 3UTUH 3T2NA 1ZPBA 2H5CA 1AUTC 4BAMB 1DUEA 1L1NA 3ATLA 1OSSA 3OU0A 4XOJA 4JYUH 2ZNKH 1QJ6B 3FVFB 3SW2B 5E2PA 2NU0E 2VWNA 2GMTB 2XBXA 2IN2A 2FI3E 1BOQA 1GHAG 4ZXYH 3AVZA 2GCHF 5HM2A 3TNSA 2Q6FA 1QBOA 1ZHMA 3MOCA 5T6DA 1O36A 5JBBS 2K1QA 2FMJA 2A1DB 2P8OC 3PWBA 1C4Y2 1UTNA 1MBQA 1LVMA 4WJG2 3BV9B 2AS9A 1FLEE 2G4UA 3LIWA 1D9IA 1O5FH 1BT7A 4RN6A 4A1XA 1GBBA 2H9EH 1O2NA 3V13A 1PQ5A 2VWOA 2BMGB 1AY6H 3TPIZ 1O3HA 2OC8A 1FONA 3MNBA 3TITA 4NSVA 4FUFA 4D8NA 2PGQB 2PUXB 1DWDH 4BAQB 5JPMH 1Y5UT 3EA7A 4K1SA 2VIWA 1OWEA 1YPJH 3RLYH 3RXIA 6GCHG 1QRZA 5CMXH 3DFJA 3E16B 1BCUH 1P04A 3ATKA 3TLOA 4CRAA 3F9EA 5EXMA 1XMNB 1K1PA 1DSTA 3VXEH 1TA6A 1DWCH 1GCTC 2HOBA 1HCGA 1MCVA 1TX8A 3RXKA 4ZKOU 1WUNH 2R0LA 1N6XA 1O38A 1EUFA 5EU8A 2VNTA 2ANWA 3HKIB 2A4GA 3A7ZA 3A82A 2ZFQH 1G32B 2FOCA 1O33A 1O3CA 4A6LA 2PW8H 1EAXA 2A2XH 1PJPA 2BY5X 5GJ4B 1O3EA 1AU8A 2WPJS 2FTMA 2NU4E 2DE9A 2G8TA 3OY5U 3RXRA 1F0UA 1AMHA 2WPHS 1OWJA 3DHKH 1TE0A 4MQAA 1V2PT 4NIXA 1Y3WA 1TRMA 3GY7A 1A0HB 4CH2B 3SU6A 1CGHA 4TWYA 1Z71A 1PFXC 1A4WH 2CN0H 1NT1A 2Y5FA 1AO5A 1EP6A 2ZTZA 1ZTLA 1G3EA 3R0FA 1P2OA 2R3UA 6ESTA 1MTVA 3QK1A 1K21H 1K1IA 1C5SA 2PKSB 2BY7X 4INHA 4CR9A 4E06H 4JZFH 3RXLA 1VITF 4CHAC 1O0DH 3UQVA 2UWPA 4WMEA 3EYDA 1B7XB 1OKXA 1LHDH 5T6FA 4X6PA 1V2JT 1HXFH 4ISIH 4B76A 3VB5A 2ZGXH 4OGYA 4ZROA 1L2EA 2FOAA 3SV8A 1GI8B 3VB3A 1KXBA 1AN1E 1HAPH 3KGPA 4ISLA 4K69A 3TGJE 1QJ1B 1HRTH 1ETRH 1HAZB 1W7GH 5IDKA 1ELCA 3MHWU 2BDYA 1QGFA 1O2GH 1UTPA 4D7GA 1QCPA 3SQHE 3SUFA 4O97A 4OS7A 2OBOA 4BAOB 1C2DA 2YNAA 4Q7YA 3RU4T 2UUYA 1FAXA 2I6QA 1WBGB 1LO6A 1TLDA 1IAUA 4Y10E 1DWEH 1N6YA 1DY8A 1CA8B 2ZC9H 1GBJA 1EATA 2BD4A 3PM3A 1FXYA 2C93B 1EPTA 3ZVGA 1QL8A 4B74A 1Z1IA 1HXEH 3RXTA 5L2ZH 3EDXB 1V3XA 2ZG0H 2VINA 1C1OA 4UDWH 2BY6X 1GI9B 1RXPA 3NWUA 2XNIA 5EOKA 2V6NA 3PO1B 1AVXA 1C2EA 3I78A 1IQGA 2O9QA 3B8JA 4CR5A 1GBEA 4X2YA 1GI7B 1EPTB 3TK5A 3LGUA 4Y8ZA 1O2QA 3TK9A 4LOYH 3M3TA 3LKWA 4ABFA 3ZZAA 1P10A 2Z6BD 1W7XH 4UD9H 2G81E 5C1YA 1ZHRA 2NU1E 3EE0B 1BJVA 3BEFB 1H8DH 3S0NA 1CA0B 2HALA 1A3BH 2GV7A 1Z7KA 1O2RA 3SV9A 3KCGH 3W95A 1GWAA 3GCHB 3ZVAA 1GHZA 1E0FD 1MZDA 1FN6A 4B2AA 4MNVA 1NFWA 4AFQA 4Z6AH 3BIUH 2FI4E 4JK5A 2P95A 3RXCA 1N1LA 1S81A 3GCTF 1GMCF 2ZDNA 4FU7A 1V2NT 3BG4C 1YLCA 1SGYE 4K1TA 1Y3XA 1G3CA 2B0FA 5A09A 4Y0YE 1YPEH 2ZHWH 1OPHB 3L6PA 5JDUB 3ZZ6A 1GJ9B 1ELGA 1FV9A 3SV7A 1TBZH 1Y8TA 1ESTA 3RXHA 1YCPH 3SU1A 1CBWC 3MU5A 2FYRA 2ZZUH 2GZ7A 3SN8A 1GJ6A 1O31A 3MU0A 1Z8RA 3BF6H 2AIPA 4THNH 2GCTB 1LCYA 1PYTD 5A0AE 1P12E 5EPNA 2ZI2H 1G3DA 1QQUA 1SOTA 2JETB 3VGCB 5CE1A 3LGVA 3HATH 2OINA 1HJ9A 2W3KA 3ZVFA 1KXAA 1KSNA 1NROH 3IITA 1ZPZA 1W8BH 2A31A 1C2FA 5DK1A 3S7KB 4UFDH 3D49H 4HFPB 1QHRB 2QXIA 1LPZB 2FM2A 4X1NU 3EA9A 4CBOA 1S82A 1K1NA 1P3CA 1A0LA 1QURH 1GVZA 1LTOA 5L6NH 4CRFA 4FUBA 1WTHD 1ZTKA 1SC8U 3BTGE 4Q7XA 3M5NA 4AORA 1ELFA 1CHGA 1AB9C 1A5IA 4X0WU 3MNSA 3ZZ5A 3PB1E 4Y79A 2P3FH 3P8FA 4GAWA 3Q77A 3E90B 1AE5A 1SGRE 2ALVA 2OLGA 1HAGE 2BDAA 4QT8C 2OC7A 3RUOA 1NRSH 1Y59T 3GY5A 3QDZB 3SU2A 4YT7H 1DE7H 2GX4A 1GBDA 1DITH 4TPYA 4I8LA 5AF9H 1NRNH 1C4V2 1C5TA 3ZYDA 1IQHA 2OD3B 2NWNA 2DE8A 1LQEA 3P8NA 1O5BB 2RA0A 1KIGH 3T5FH 1P9UA 3E8LA 3U8RH 4AYYB 5JBCS 2WPMS 1HJAB 4AG1A 2GT7A 3A89A 3UNQA 1SLWB 1GCDA 3GICB 1IHSH 2STBE 1OS8A 1QB1A 2ZHEH 4MTBA 3SUEA 1G9IE 4MPVA 1P06A 2ZFPH 2HNTE 4KKDA 2ANKH 2VVVA 3SUDA 2BM2A 1ACBE 1TA2A 3VB7A 1NZQH 3UR9A 2ZDVH 1W10U 3CS7A 1BTXA 5FPTA 1BTUA 1GJ4H 5C5NA 2QN5T 5LH8A 1TOMH 1PPEE 5LGOA 5E0GA 1ZHPA 2GMTC 4MG3A 2P94A 2GTBA 5DP9A 2C8YB 1GI3A 1O5EH 3TJVA 1C1WH 1LHEH 1O3PB 4DJZB 1KTSB 4B73A 1DS2E 1RTLA 2IPHA 2AGGX 1INCA 1KLTA 3KQEA 3SGQE 1K28D 1XX9A 1J9CH 2FX6A 4RSPA 4Q2KA 1XVMA 3E0NB 2WUCA 3RXUA 1SGCA 4KTSA 4JZIA 1D6WA 1MTNB 3OSYA 4Q7ZA 2R2MB 3BEIB 1XUKA 5AHGH 1BMMH 5CHAC 3AAUA 1AZZA 1LKBA 2H9HA 1SQTA 2R2WU 4FVBA 6GCHF 2EA3A 1XUFA 2GT8A 2HRVA 3MU8A 3SHCH 1FAKH 2Y7XA 3F9HA 3GDSA 4ZHMU 1THSH 1FDPA 1KXFA 1ELEE 1OP8A 2A7CA 1K1JA 3A8BA 2O8TA 2ZU3A 2R9PA 1BBRK 2A0QB 4WY3A 5TJXA 2F9UA 3SJOA 1DICA 2QF3A 1SSXA 3LJJA 1AGJA 3SI4H 1PPGE 4FU9A 2C90B 4NIVA 1AIXH 1M9UA 3A8CA 2ZHFH 3UOPA 5J4SA 4K2YA 3URDA 2V0BA 1XKAC 2WINI 4ISNA 5JBTA 4D76A 4CREA 3URCA 1E37B 1SQAA 3KN2A 4X1RU 4TYDA 2H5DA 3MH5A 2KAIA 1BHXB 5E8EH 4YOGA 3SGBE 1HUTH 1HV7A 1LHGH 4F49A 2AGIX 1JIMA 2KAIB 3FAOA 2CF8H 3TVJB 3P70B 3ZYEA 3R3GB 1UCYE 1EB1H 3MWIU 1C2JA 3P95A 5B6OA 1YBWA 2BLWA 4HGCA 3HGPA 2PKSC 1GJ7B 3DFLA 1UO6A 1GJ8B 5GWZA 2J2UA 1C1QA 3EGKH 4O03A 5JB8S 3PWCA 2W26A 1GG6B 4DY7B 1U6QA 4PROA 1SHHB 8KME2 2BZAA 4ZMAH 1QB9A 3LC3A 7ESTE 1UTMA 2XTTB 1E38B 3PYHA 4RKJB 3RXSA 1RIWB 2OTVA 4AOQA 1AD8H 3M5MA 3GY6A 3UIRA 3A81A 3U8TH 3BN9A 1DLEA 5A0BA 3TGIE 2XBYA 3ATWA 3PLBA 4XBBA 3JZ1B 2J9NA 2Z94A 3MMGA 1KLIH 4IMZA 4WXIA 1SGFG 1HAXB 2FOHA 3VPKA 1VGCC 1KDQA 1E36B 1CSOE 1JOUB 3K9XB 3SQEE 1MKWK 2PHBA 1V2KT 1VCPA 3UREA 3VEQB 2VVCA 3TK6A 2ZU2A 4BANB 1F2SE 1W13U 1ZRBA 1KY9A 1VCQA 2QY0B 4TY7A 5FXLA 2BLOA 2A32A 4DCDA 1P9SA 1XUIA 1ELVA 4JMYA 1TGSZ 3TU7H 5DG6A 1F0RA 1UTKA 1GI4A 3SNDA 2ZO3H 3MO6A 2TPIZ 2H6MA 1KDQB 1AUJA 3L33A 3LONA 3PMJA 4DIHH 2ANMH 4VGCB 1BA8B 3PMBB 5L2YH 3WY8A 1AWHB 1O5GH 1HYLA 1QB6A 4INLA 4X8TH 2W7SA 3W94A 1F7ZA 1FQ3A 1ANCA 2Z9LA 2ZPQA 1FPHH 3V12A 4Y11E 1GHWH 2BD2A 2FO9A 1TQ7B 7GCHG 5FHTA 1W3CA 2XBVA 1OOKB 1VR1H 2OP9A 1O5CB 3T25A 2ZGCA 3CS0A 3SU4A 5ESBA 1NFYA
chains in the Genus database with same CATH superfamily
2AHME 4NGAH 1K2I1 1O2YA 2B9LA 3I77A 3GS9A 2CJIA 4TY6A 2BZ6H 5TCCA 4ABHA 1IQLA 1PPFE 1BDAA 1FJSA 1ESBA 4ABBA 4Q80A 2HLDD 3AW1A 1UVPA 3NPSA 1JRTA 2XYAA 5EJ1A 4ZHAA 5C20A 5F8XA 2BX4A 1QR3E 2RDLA 1NY22 1E35B 4FVDA 2FIRH 1CQQA 1WCZA 4WVPE 1A0JA 5F8TA 1P05A 1AZ8A 5C17A 1O2PA 1ZLRA 1MAXA 1D3TB 1GPZA 1WV7H 4R8TB 1ZSKA 1GJDB 3T26A 1O3KA 1GJAB 3E6PH 2DUCA 1H9LB 3KQBA 2Z9JA 1ZZZA 1UTLM 4ABGA 4Q4LA 3F9GA 2B7DH 1RTFB 5DP6A 3U8OH 5A2MH 4AB8A 1UW7A 5KEDA 3KQDA 2QGRA 3Q3YA 1FY8E 1CE5A 1J8AA 1BTZA 1UCYH 1ARBA 2GKVE 4NA9H 4ZXXH 1IOEA 3A83A 1TX7A 4BNRA 5DP4A 3F3BA 3SNBA 4B75A 2ZGHA 4AYVB 4TWWA 1YCPM 2JETC 1QJ7B 3A7XA 3HK6B 1BB0B 4O3TA 1ABIH 3KL6A 5EGMA 2FP7B 3VG8A 1ZSJA 4Z0KA 1Z8IB 3PV4A 5HYOA 5C5OA 2H9TH 3PMHB 4AGJA 1GHYH 2VWMA 1LVBA 5GIBA 1C4U2 1TFXA 3C27B 3NZIA 1ELBA 3BTKE 2STAE 3FOAA 1NFXA 4F4OC 1OP2A 3FANA 4FUEA 4TPIZ 2KX4A 4M9FA 1C5RA 1GI2A 1BIOA 2PR3A 1TGBA 1L0ZA 3QZRA 2WZQA 3K2UA 4F55A 1HAYB 4J2YB 4BTTB 1T8NA 2IOTA 2F4LA 1ZOMA 3M3VA 1GBHA 4MPUA 4LZ4B 2WPLS 4NZLA 4NIWA 4SGAE 1SHYA 1YF4A 1THPB 1V2ST 2QXHA 1C2HA 2A4QA 1XKBC 5HKKD 1GGDB 3FO8D 4ZCNA 1XUGA 1LDTT 2P3TB 4MPWA 1B0EA 3KNXA 4MLFB 2GD4B 4I86A 3TIUA 1V2VT 1CHOF 1A7SA 3OYPA 4UFGH 4B2BA 1LVYA 4X8UH 1EOJA 2G4TA 3F2GA 4IN2A 2JH5D 1TYNA 1DXPA 1T32A 1JRSA 3ITIA 3QTOH 4I8JA 1C1SA 3DT0H 1WAYB 3B9FH 3OE7D 4IGDA 1MBMA 2W7UA 1T4VH 1GBTA 1S85A 1EKBB 3ZZ3A 5JB9S 4YLQH 1BRAA 3RLWH 1T4UH 1NPMA 1EQ9A 1C1MA 1MKXH 3H7OA 1BTWA 1SOZA 6CHAC 3GDVA 2F9NA 2HPPH 4BAHB 1LMWB 4X1SU 2AMPA 1WQSA 2O8MA 3EE7A 2YMSC 2TGDA 3BTDE 1YKTA 1DXWA 1QTFA 4NCYA 4GPGA 1XXDA 1CO7E 5IYTA 3RXAA 3NXPA 2XXLA 1MAYA 2I6SA 2ANYA 2J97A 4NSYA 1W2KH 2FXRA 4BXSA 1P2KA 2QF5A 5EJZA 3A8AA 1JXPA 1ELDE 5GCHG 3SO3A 1MQ5A 3RU4E 1Z1JA 5EG4A 1ZJDA 3ZVCA 3SNAA 2J95A 4NA8A 3ZZ8A 2D2DA 1S0RA 2BQ6B 2A2QH 1O3BA 2GDEH 4D9RA 3MU1A 1P01A 1UVUH 1GI5A 2XC0A 4Y6DA 2V3MA 4AGKA 3BTFE 2IJD1 1MTNC 1GHBF 2CHAC 3M36A 4AX9H 1NS3A 2VB0A 4BTIB 1F0TA 3SZNA 1MTUA 1TMUH 4U30A 5EW2H 1EZQA 1O3OA 2Q1JA 1TB6H 1AFQB 1GBCA 2CMYA 3RU4D 1MU8B 5GPIB 1MMJN 2PKAA 5GNDA 3SJIA 2GCHG 2LPRA 1Q31A 1GJCB 3DSPA 1NESE 3P6ZB 4OS5A 1V2TT 3P17H 3RXMA 2ZCLP 3ATIA 2SGEE 7KMEH 3QWCH 5DKMA 4ESTE 3S9AA 4MNXA 1P03A 3SUGA 3A8DA 1OWIA 2ULLA 4AFZA 4CRBA 3ODFA 1ESAA 4LZ1H 3DCLA 1G2LA 3SV2H 1BHXF 3EAJA 1D4PB 4GCHG 1XXFA 2PKAB 1TNKA 1O3AA 2PSYA 2BXTH 2GZ8A 3WWFA 2VGCC 3GYMA 3PROA 1EJNA 1MQ6A 1C5VA 2G52A 2GVFA 2XNDD 3E0PB 3RC6A 2PTCE 1B5GH 2AERH 5DSFA 4Y7BA 1AE8H 1DM4B 1QBVH 2SGQE 1H9HE 3ZZDA 5JYIA 5SGAE 2BVRH 2Z9GA 3ODDA 2JIZD 1HBTH 3QO6A 1O3GA 5H4IB 3OEHD 2VJ1A 1SPJA 5C3NA 5ESTE 4Z1MD 1JIRA 4NG9H 1SQOA 3LGWA 1SL3A 9ESTA 1FUJA 3SOSA 2TGPZ 3PLPA 2ODQA 3F68H 4MNYA 1C9PA 2ILNA 5HM9A 1BRUP 5C1UA 2VIQA 4ABJA 1YYY1 2ZECA 2PGBB 1EAWA 1EJAA 1K1MA 3PTBA 2R3YA 3RC5A 3MFJA 1TX6A 3NCLA 3T29A 4H6SB 4FOUC 1TNHA 4LXBH 1V2WT 3LH1A 3O8RA 1C1VH 1TONA 7LPRA 5C0TA 1HAIH 1Y3YA 2XWAA 3DSGA 1BTHH 3UQOA 1GBFA 1G37A 1RIWC 2XBWA 1KTTB 1O2HA 4RT0A 3UAIC 4YT6H 5F03A 2EI6A 1WSSH 1SBWA 1GVLA 3N7OA 1GMHF 4WWYA 2FODA 2Y82A 1ANBA 1Y5BT 3K65B 1K0HA 1S6HA 1O3IA 3U98H 4FUCA 1C5UA 2ZKSA 3BTME 3MNCA 5BPEA 5A0CA 3UOUA 1SGDE 4LK4A 4DVAU 3RMMH 1TGNA 4K1EA 1H4WA 3RXDA 1EAUA 1ID5H 1YPMH 3ZZ4A 1GBMA 3Q00A 1D3DB 3LPRA 5TCAA 1KLJH 5DGJA 4DIIH 4X6NA 1VITG 1XUHA 1OWKA 1C2IA 3I29A 1SLXB 1NTPA 1VCWA 3VB4A 1EJMA 3OTJE 1S5SA 1C2LA 2QXGA 3GCOA 2K8IA 1EX3A 1ETTH 4UFEH 4VGCC 5EQQA 2P93A 3RXPA 2A7HA 1YWUA 8ESTE 2G55A 3UFAA 1ZTJA 1P2QA 5AFYH 3SJ9A 1GHAF 4Y76A 1ZMLA 4IS5A 7GCHF 1NRPH 4YOJA 3FZZA 1N8OB 1NN6A 1O37A 2H2ZA 2RG3A 2CV3A 4CRGA 1WXRA 2SNVA 2BD3A 2ASUB 3OEED 1L1JA 2AMQA 5C2ZA 1ZPCA 1SKYE 3FP6E 2ZGJA 1DWBH 4FUJA 3TJNA 1FY1A 4ABDA 2EQNA 3ZZCA 3HPTB 3Q76A 4BXWA 4OS2A 3A7TA 5DO4H 2ZGBH 2SGFE 4ACAA 2HVYB 4ASHA 2FLRH 1C5QA 4GHQA 1E79D 1GJBB 3MO9A 1C5ZB 1O3LA 3N99A 3GISB 2B5TB 3LU9B 4TT3D 4ZUHA 1OYTH 3ZZBA 1QIXB 1ELTA 4B71A 2C3SA 3RXGA 4ABIA 1KXCA 3TNTA 5T3HA 1MUEB 4M7GA 3BSQA 1C1PA 1P3EA 2Z9KA 2ZHDA 4ABAA 1ABJH 4MVNA 1C1UH 4FUDA 2F9VA 3HKJB 1WOFA 3KQCA 1EAIA 1E1RD 1S6LA 3BIVH 2XC4A 2AYWA 2ZPSA 1TQ0B 2OC1A 1UJ1A 1HJ8A 2P3UB 2A4RA 3CP7A 1GJ5H 2QAAA 1GHXH 3RXFA 1BRCE 1TMBH 1TNGA 2XCFA 1GBLA 4AFUA 3U28C 1V2QT 4X2XA 1HIAB 1LPGB 4AFSA 1PQ7A 1GBKA 3KIDU 4K60A 1C5YB 3LGIA 3KEEA 4JCNA 2WUBA 3QZQA 4IBLH 3ZZ9A 1ZMJA 1GDUA 1ZGIA 3E3TA 2VIOA 3HK3B 1A3EH 1ANDA 3Q3XA 4HTCH 2JH6D 2ZCHP 2HNTF 1PQAA 1GHVH 1YCPK 1O39A 2F9BH 3ZVDA 3UPEA 1TPOA 3A80A 1O3JA 1DFPA 4BAKB 4A1TA 3N7EA 2YNBA 2BQWB 1QBNA 1MZAA 2FYQA 2BD5A 4J1YA 3ZZ7A 1TWXB 1Q3XA 2EI8A 1C1NA 1FIZA 1NRQH 5JBAS 2EEKA 1H8ED 1GBAA 1NO9H 1GI6A 3MH4A 3ZV9A 1J17T 2SGAA 1O2UA 1P2NA 3LH3A 4U2WA 4XDEA 1BMFD 1SR5C 2C8ZB 3Q3KA 2QV1A 2OQ5A 3M5OA 4JYTA 3MH7A 3TH4H 1P8VC 4B6FA 3A7YA 4X6MA 2P59A 1RS0A 2AEIH 3S9CA 1GMDG 1L1GA 2QIQA 1IQFA 3S7HB 1GGDC 3GYLB 3LT3A 2RCEA 2VU8E 5T6GA 2Z3EA 3TH3H 1TBRH 1D6RA 3MYWA 2UUKB 5A8XA 1SGFA 2W6ID 2Y5GA 3FZDA 1FNIA 1O2JA 1SI5H 1DVAH 3SJ8A 3C1KA 4OS4A 1BUIA 1HAHH 1LPKB 2FDAA 4UEHH 1AB9B 2ALPA 1O2LA 4X8SH 1X7AC 2BDBA 2BLVA 2UWOA 1H1BA 1L4DA 2UUFB 3ELAH 4CBNA 4DT7B 5BRRE 2JJ2D 1P57B 1GBIA 2ZQ2A 2GP9B 1AVWA 3JZ2B 3ZVBA 4KTUA 3TJOA 3STJA 1B0FA 2BQ7B 2FOEA 4H4FA 4OS1A 4NWKA 1O2IA 1ZR0A 4I8HA 3WWBA 1C2GA 1NU7B 1MU6B 2GGVB 3SU3A 1T31A 1FY4A 3ATMA 1F5KU 5C94A 3O8DA 1V2LT 1S6FA 1CT0E 1EB2A 1HDTH 1C2KA 1NC6A 1YC0A 2QA9E 3P92A 3PO1C 2Y6TA 3QUMP 2EI7A 1BMLA 2J98A 4YESB 4A92A 1EPTC 1T8OA 1AFEH 3P8GA 3MO3A 3IG6B 3ZVEA 1CT2E 4DURA 2CGAA 3F6UH 1JBUH 3G01A 2YOLA 1UTOA 4UE7H 4IW4E 2J98B 1IQIA 2ZDLA 1WYKA 3SGAE 4H6TA 2PV9B 2ZDAH 1CA0C 1OWDA 2PP6A 1AFQC 2FWWA 1GI1A 1SGNE 2ZIQH 2Q6GA 1TNJA 6LPRA 2VVUA 1K1LA 5DJ7A 9LPRA 1C9TA 4I33A 5ETXA 1ZYOA 2FOGA 3GCHC 5F8ZA 4CRCA 4D7FA 3AASA 4JK6A 1DANH 3SJKA 1THRH 1HGTH 4GCHF 1O2WA 4X2VA 1O2OA 1F0SA 3UY9A 4DGJA 1O35A 1ORFA 1GL0E 2OXSA 1MD7A 2BLQA 2V35A 1P02A 2XCNA 1YPKH 2HGTH 2BD9A 1QFKH 4A7IB 1VZQH 1K22H 3M35A 4GUXA 5CHAB 4CRDA 8GCHG 3A7VA 1MH0A 4NFFA 1J14A 5J4QA 4NA7A 1NBME 1OWHA 3L3TA 2ZDKA 1P11E 2ZU1A 4K8YA 2FZZA 4R0IA 2ZFFH 1LHFH 3HGNA 3UWJH 3LDXH 1BQYA 5EQSA 3CNRA 2ZFSA 3M37A 1RD3B 1UTQA 1BZXE 3VFEA 2BD7A 4IMQA 2GCTC 2ODPA 5K0HA 5ABWA 1QZ8A 4ZKSU 3D62A 4OGXA 4KGAA 5KGOA 1EZSC 1C1RA 2A5AA 1A46H 5FPSA 3VGCC 4X1PU 3UNRA 4O9VA 3M3SA 1DLKB 1FN8A 1L4ZA 1NFUA 1Z6EA 3S69A 3DSOA 1IHTH 4JZ1A 5E0HA 1YPHC 2K0QA 2AIQA 2VIDA 2TRMA 4P02A 2BDIA 5EPYA 3RXOA 1W12U 1BBRE 4IC5A 3M61U 2B8OH 4K3JA 1S83A 1T7CA 3KYGA 3GY2A 1HAOH 3RXJA 1DDJA 1IQNA 4XBCA 2J4IA 1YP9A 3GCNA 4AC9A 2NU3E 1S84A 4YO9A 1SGTA 4CH8B 3AK5A 4A5TS 2BYAX 4FU8A 2BDGA 4YLUA 2XWBI 1AI8H 2YMSD 2VH0A 3PMAB 2TGTA 1OHHD 4DG4A 3W1EA 1J15A 1F5LA 1PPBH 3H5CB 1Y5AT 4OS6A 4ISHH 5FCKA 1G3BA 4FXGH 2FOMB 3SI3H 2A5IA 4B2CA 2OCVB 3MI4A 1IQKA 2ZDMA 5AVDA 2ZFRH 2BVXH 4K8BA 2GDDA 2QF0A 1C5NH 1EASA 4GSOA 2TGAA 2FTLE 3QGNB 5GDSH 2BY9X 2SGDE 1BMNH 4HI3A 3U1JB 4ZAEA 2EC9H 1UMAH 2LNCA 2ZWLH 2F9OA 2WYJA 2ZQ1A 4FUHA 2UUJB 1HB0B 1OYQA 1T8LA 4YTAA 5LPEA 1O2MA 1ZJKA 3SBKA 4FETA 3MQKC 1HJAC 5HIYA 1TPSA 1FMGA 1TALA 2O8WA 2BOHB 3VB6A 1P2MA 5DP3A 1TGCA 1QL9A 1VGCB 2W6JD 2W3IA 1O2VA 2BX3A 1QL7A 1OX1A 1WDIA 3BTEE 3T27A 2VH6A 2THFB 3TJUA 3QTVH 4WH6A 1N8OC 3MNXA 1AVGH 1F5RA 1Q2WA 5LPRA 5HIZA 4KELA 1DOJA 1QNJA 4IC6A 3BTHE 1O2SA 5B6LA 2C4FH 2V3HH 3O8CA 4AN7A 1MTSA 5GXPA 2XC5A 1FY3A 1ANEA 1VITH 3RMLH 3EA8A 1BITA 2HPQH 1W11U 1G36A 4ZKRU 4AG2A 5C0UA 4XFQA 1SGQE 2PUQH 4I7YH 2WV4A 5A8YA 1JWTA 1TIOA 3PV2A 2BHGA 3H09A 1LKAA 5FBIA 1G30B 3U1IB 2P8OB 2WYGA 4E7RG 3QLPH 2KCPA 2ESTE 1C5LH 2BDHA 1FPCH 2ZU5A 3SU5A 2J34A 3BTQE 4WH8A 3FP8E 4I32A 3QX5H 5DPAA 1O32A 2OK5A 2JKHA 2BY8X 4U01A 2C8WB 2JH0D 1MCTA 2FI5E 3EQ0H 1PQ8A 1SQRA 2M5TA 2ZA5A 3U9AH 2D26C 3GY3A 3GOVB 2SGPE 1SGEE 3ENSB 1ETSH 1RJXB 3OX7U 5AFZH 4MDSA 2SFAA 1SLUB 1W0YH 4FUIA 1BBRH 1AHTH 1QA0A 3RXEA 1JMOH 2QC2A 1EOLA 3B23B 4XSKU 2V3OH 3RC4A 3NUMA 1VJ9U 1FI8A 4A1VA 3S9BA 4HZHA 3RDZA 1QRWA 2KZ4A 2WPIS 1ZGVA 1XM1A 3M5LA 2J92A 1AKSA 1PPZA 3T28A 1PPHE 1O2ZA 2P16A 2WV9A 1Z6JH 4UFFH 2HWLB 1GCTB 1UCYK 3A7WA 1P0SH 1BJUA 5PTPA 2FESH 2OC0A 1LHCH 1TNLA 4I8GA 3RXBA 1BRBE 2O8UA 3ESTA 3LGTA 1GL1A 1K1OA 5A8ZA 5EXNA 1AKSB 1YM0A 1KXDA 2G5NA 3PLKA 2R0KA 5C67A 1KYNA 2F9PA 1Z8JB 1V2MT 1WQVH 1Z8GA 2PSXA 3LOXA 1XUJA 2PWXA 4BOHA 3E91A 1GG6C 1GMDF 5I46H 3A87A 1ELAA 3A84A 3UR6A 2Z3DA 3M7QA 1SFIA 3RXQA 4GVUA 1FIWA 1DT2A 1OP0A 3SNEA 1TABE 4GHTA 1UVTH 1C2MA 2ZTXA 2NU2E 5EQRA 2Z3CA 2XRCA 1Y3VA 1LVOA 4WMDA 2BB4A 1QY6A 4UONA 4RKOB 2GJGA 3O8BA 5FAHA 4INKA 1W14U 4CHAB 1UVOA 3M7TA 1O30A 2OUAA 3SZEA 1K9OE 4U32A 1IQMA 1NU9A 4ZHLU 4YOIA 2AGEX 1TNIA 3T62A 1WTGH 2BD8A 3RM2H 3UUZA 2AH4X 2VWLA 2IJOB 4X2WA 3KHVA 3UNSA 1MKWH 1IQJA 3AAVA 4Y8YA 2ODYB 3A88A 2WV5A 1AWFH 1PYTC 2KR7A 2TIOA 2LELA 1SFQB 3GY4A 3BEUA 8LPRA 1EP5A 1SG8B 1CHOG 1F92A 3V0XA 4MNWA 2ZF0H 4XE4A 1UHBA 1MKXK 5DP8A 1O3DA 1EXFA 3SNCA 4DOQA 4IN1A 2F91A 3A86A 1QRXA 1S0QA 2QXJA 1XVOA 5F6MA 3OY6U 2OQUA 4D9QA 4JYVH 1DUAA 1LQDB 2PFEA 2ZCKP 2G00A 4WXVA 1C5XB 6CHAB 1C5WB 1CVWH 1T8MA 3V3MA 1O3MA 1UHBB 1SGIB 1UVSH 4DW2U 2FOBA 4WMFA 1TBQH 4AZ2B 2YMSB 5HMAA 5T1VA 1NRRH 1YY3A 2AMDA 2VIPA 1ARCA 3KF2A 2F83A 1YPLH 3SV6A 1O3FA 3D23A 3DUXH 1TRYA 2C8XB 3DD2H 5HXFA 2TBSA 3UWIA 3A85A 1P2IA 3FP7E 2EY4C 2J5UA 1A2CH 3LC5A 2D8WA 5FX5A 3RMOH 3ZIAD 1GDNA 2ZP0H 1SVPA 3PTNA 4WF8A 3PRBA 2ZHQH 2PLXA 5F53A 4ZH8A 1UK2A 3TH2H 4BTUB 1HFDA 1SGPE 1YLDA 1GI0A 4I31A 3QGJA 1O5AB 2CK3D 3NK8A 2FX4A 4FUGA 4K5ZA 3SHAH 1D3QB 2BDCA 1A5HA 2Y7ZA 2JDID 1HIAA 4ZKNU 1P09A 4B1TA 3LGYA 3BTWE 8GCHF 2BXUH 3WW7A 2AFQB 2FS8A 4DT4A 3F1SB 2WPKS 5EODA 2PTNA 2Y80A 4KP0A 1O2XA 1TGTA 1QQ4A 3FFGA 2CHAB 2FS9A 4Y7AA 2CF9H 3TGKE 5L30H 2BOKA 2HLCA 4GLYA 4O3UA 1P2JA 1W0JD 5E0JA 1GHBG 1MABB 1HNEE 3ZV8A 1IQEA 1O3NA 1MTWA 1SMFE 1TPAE 1C5OH 4YZUA 1BTPA 4KTCA 1TRNA 4E7NA 1HPGA 5EXLA 3SORA 1EZUC 1BTYA 1TOCB 5LPFA 2G5VA 1PPCE 3UB0A 2XW9A 2V7QD 1D3PB 3BG4B 4X8VH 4E05H 4X1QU 2HVXA 1O34A 2VGCB 1YPGH 1E34B 3AW0A 3GCTG 1GMCG 1RFNA 1TAWA 2CXVA 3RXVA 1UK4A 1CU1A 1ZSLA 2FPZA 2FOFA 1CBWB 1CT4E 1A1RA 5DP5A 1DY9A 2FEQH 1FY5A 2OBQA 2ZEBA 2HNTC 1SB1H 3VXFH 5E2OA 4NIYA 5FBEA 3NKKA 5CDFE 3U69H 1GVKB 1YGCH 1C5MD 1RRKA 2A45B 5FX6A 2RA3A 2H1UA 5K7RA 1ZMNA 2Y81A 2BVSH 5FPYA 3RM0H 3P8OA 2ZTYA 2QYIA 4Y8XA 1COWD 3QN7A 2QCYA 2ZPRA 1H8IH 1RGQA 3DA9B 2VIVA 1KXEA 2W5EA 3M7UA 3BTTE 2Z7FE 3GY8A 3MTYA 1FZZA 4JZEH 1DPOA 1O2KA 3F9FA 5EW1H 4SGBE 1WU1A 2JJ1D 1MD8A 4Y71A 4YM9A 1RTKA 1V2UT 2KM0A 5DP7A 5I25A 4NFEA 1SLVB 3SU0A 4NZQA 1CGJE 2KFWA 3MU4A 1C5PA 1V2OT 2VBCA 4X6OA 1A61H 1DX5M 2A7JA 1TPPA 4Y0ZE 1EZXC 2ZU4A 1J16A 3GDUA 1V2RT 4AB9A 2D1JA 1G2MA 3K6ZA 1DSUA 4I8KA 3LJOA 1GMHG 2A4OA 1Y3UA 1AQ7A 4H42U 1ZRKA 5FCRA 3F2FA 3K6YA 5IK2D 1A5GH 1UTJA 1HAVA 3RMNH 2GZ9A 3D65E 1W0ZU 2F3CE 2Q6DA 1GDQA 2G51A 2O8LA 4ISOA 2SNWA 1KMHB 1UK3A 4JZDH 2A5KA 2J94A 1BMAA 5HGGA 3RP2A 5C1XA 1NM6A 1OXGA 3CENA 1TMTH 1V6DA 4NWLA 4MPXA 5GCHF 4XBDA 3V7TA 2Y5HA 3H7TA 3STIA 2L74A 2F43B 1CGIE 2Z9IA 1O5DH 2J38A 3IWMA 1HAVB 1YPHE 2FLBH 3E1XB 2UWLA 1O2TA 2ZFTA 1QA7A 4ABEA 3MH6A 2BTCE 2GV6A 1HLTH 1VJAU 1C1TA 1H9IE 2XOKD 3BG8A 5G4BA 3UTUH 3T2NA 1ZPBA 2H5CA 1AUTC 4BAMB 1DUEA 1L1NA 3ATLA 1OSSA 3OU0A 4XOJA 4JYUH 2ZNKH 1QJ6B 3FVFB 3SW2B 5E2PA 2NU0E 5EJLA 2VWNA 2GMTB 2XBXA 2IN2A 2FI3E 1BOQA 1GHAG 4ZXYH 5EIYA 3AVZA 2GCHF 5HM2A 3TNSA 2Q6FA 1QBOA 1ZHMA 3MOCA 5T6DA 1O36A 5JBBS 2K1QA 2FMJA 2A1DB 2P8OC 3PWBA 1C4Y2 1UTNA 1MBQA 1LVMA 4WJG2 3BV9B 2AS9A 1FLEE 2G4UA 3LIWA 1D9IA 1O5FH 1BT7A 4RN6A 4A1XA 1GBBA 2H9EH 1O2NA 3V13A 1PQ5A 2VWOA 2BMGB 1AY6H 3TPIZ 1O3HA 2OC8A 1FONA 3MNBA 3TITA 4NSVA 4FUFA 4D8NA 2PGQB 2PUXB 1DWDH 4BAQB 5JPMH 1Y5UT 3EA7A 3PRDA 2VIWA 4K1SA 1OWEA 1YPJH 1H8HD 3RLYH 3RXIA 6GCHG 1QRZA 5CMXH 3DFJA 3E16B 1BCUH 1P04A 3ATKA 3TLOA 4CRAA 3F9EA 5EXMA 1XMNB 1K1PA 1DSTA 3VXEH 4HG6A 1TA6A 1DWCH 1GCTC 2HOBA 1HCGA 1MCVA 1TX8A 3RXKA 4ZKOU 1WUNH 2R0LA 1N6XA 1O38A 1EUFA 5EU8A 1NBMD 2VNTA 2ANWA 3HKIB 2A4GA 3A7ZA 3A82A 2ZFQH 1G32B 2FOCA 1O33A 1O3CA 4A6LA 2PW8H 1EAXA 2A2XH 1PJPA 2BY5X 5GJ4B 1O3EA 1AU8A 2WPJS 2FTMA 2NU4E 2DE9A 2G8TA 3OY5U 3RXRA 1F0UA 1AMHA 2WPHS 1OWJA 3DHKH 1TE0A 4MQAA 1V2PT 4NIXA 1Y3WA 1TRMA 3GY7A 1A0HB 4CH2B 3SU6A 1CGHA 4TWYA 1Z71A 1PFXC 1A4WH 2CN0H 1NT1A 2Y5FA 1AO5A 1EP6A 2ZTZA 1ZTLA 1G3EA 3R0FA 1P2OA 2R3UA 6ESTA 1MTVA 3QK1A 1K21H 1K1IA 1C5SA 2PKSB 2BY7X 4INHA 4YXWD 4CR9A 4E06H 4JZFH 3RXLA 1VITF 4CHAC 1O0DH 3UQVA 2UWPA 4WMEA 3EYDA 1B7XB 1OKXA 3SYJA 1LHDH 5T6FA 4X6PA 1V2JT 1HXFH 4ISIH 4B76A 3VB5A 2ZGXH 4OGYA 4ZROA 1L2EA 2FOAA 3SV8A 1GI8B 3VB3A 1KXBA 1AN1E 3N7DA 3KGPA 1HAPH 4ISLA 4K69A 3TGJE 1QJ1B 1HRTH 1ETRH 1HAZB 1W7GH 2RDEA 5IDKA 1ELCA 1W0KD 3MHWU 2BDYA 1QGFA 1O2GH 1UTPA 4D7GA 1QCPA 2RFKC 3SQHE 4RT1A 3SUFA 4O97A 4OS7A 1E1QD 2OBOA 4BAOB 1C2DA 2YNAA 4Q7YA 3RU4T 2UUYA 1FAXA 2I6QA 2QE7D 1WBGB 1LO6A 1TLDA 1IAUA 3NRLA 4Y10E 1DWEH 1N6YA 1DY8A 1CA8B 2ZC9H 1GBJA 1EATA 2BD4A 3PM3A 1FXYA 2C93B 1EPTA 3ZVGA 1QL8A 4B74A 1Z1IA 1HXEH 3RXTA 5L2ZH 3EDXB 1V3XA 2ZG0H 2VINA 1C1OA 4UDWH 2BY6X 1GI9B 4XD7D 1RXPA 5CHBA 3NWUA 2XNIA 5EOKA 2V6NA 3PO1B 1AVXA 1C2EA 3I78A 1IQGA 2O9QA 3B8JA 4CR5A 1GBEA 4X2YA 1GI7B 5DN6D 1EPTB 3TK5A 3LGUA 4Y8ZA 1O2QA 3TK9A 4LOYH 3M3TA 3LKWA 4ABFA 3ZZAA 4XRNA 1P10A 2Z6BD 1W7XH 4UD9H 2G81E 5KECA 5C1YA 1ZHRA 2NU1E 3EE0B 1FX0B 1BJVA 3BEFB 1H8DH 3S0NA 1CA0B 2HALA 1A3BH 3KYFA 2GV7A 1Z7KA 1O2RA 3SV9A 3KCGH 3W95A 1GWAA 3GCHB 3ZVAA 1GHZA 4TSFD 1E0FD 1MZDA 1FN6A 4B2AA 4MNVA 1NFWA 4AFQA 4Z6AH 3BIUH 2FI4E 4JK5A 2P95A 3RXCA 1N1LA 1S81A 3FKSD 3GCTF 1GMCF 2ZDNA 4FU7A 1V2NT 2KCAA 3BG4C 1YLCA 1SGYE 4K1TA 1Y3XA 2KCOA 1G3CA 2B0FA 5A09A 4Y0YE 1YPEH 2ZHWH 3F2HA 1OPHB 3L6PA 5JDUB 3ZZ6A 1GJ9B 1ELGA 1FV9A 3SV7A 1TBZH 1Y8TA 1ESTA 3RXHA 1YCPH 3SU1A 1CBWC 3MU5A 2FYRA 2ZZUH 2GZ7A 3SN8A 1GJ6A 1O31A 3MU0A 3OTPA 1Z8RA 3BF6H 2AIPA 4THNH 2GCTB 1LCYA 1PYTD 5A0AE 1P12E 5EPNA 2ZI2H 1G3DA 1QQUA 1SOTA 2JETB 3VGCB 5CE1A 3LGVA 3HATH 2OINA 1HJ9A 2W3KA 3ZVFA 1KXAA 1KSNA 1NROH 3IITA 1ZPZA 1W8BH 2A31A 1C2FA 5DK1A 3S7KB 4UFDH 3D49H 4HFPB 1QHRB 2QXIA 1LPZB 3OAAD 3FN8A 2FM2A 4X1NU 3KQ5A 3EA9A 1YLNA 4CBOA 1S82A 1K1NA 1P3CA 1A0LA 1QURH 1GVZA 1LTOA 5L6NH 4CRFA 4FUBA 1WTHD 1ZTKA 1SC8U 3BTGE 4Q7XA 3M5NA 4AORA 1ELFA 1CHGA 1AB9C 1A5IA 4X0WU 3MNSA 3ZZ5A 3PB1E 1VKYA 4Y79A 2P3FH 3P8FA 3F0OA 4GAWA 3Q77A 3E90B 1AE5A 1SGRE 2ALVA 2OLGA 1HAGE 2BDAA 4QT8C 4RI0A 2OC7A 3RUOA 1NRSH 1Y59T 3GY5A 3QDZB 3SU2A 4YT7H 1DE7H 2GX4A 1GBDA 1DITH 4TPYA 4I8LA 5AF9H 1NRNH 2L6OA 1C4V2 1C5TA 3ZYDA 1IQHA 2OD3B 2NWNA 2DE8A 1LQEA 3P8NA 1O5BB 2RA0A 1KIGH 3T5FH 1P9UA 3E8LA 3U8RH 4AYYB 5JBCS 2WPMS 1HJAB 4AG1A 2GT7A 3A89A 3UNQA 1SLWB 1GCDA 3GICB 1IHSH 2STBE 1OS8A 1QB1A 2ZHEH 4MTBA 3SUEA 1G9IE 4MPVA 1P06A 2ZFPH 2HNTE 4KKDA 2ANKH 2VVVA 3SUDA 2BM2A 1ACBE 1TA2A 3VB7A 1NZQH 3UR9A 2ZDVH 1W10U 3CS7A 1BTXA 5FPTA 1BTUA 1GJ4H 2WHXA 5C5NA 2QN5T 5LH8A 1TOMH 1PPEE 5LGOA 4Q63A 5E0GA 1ZHPA 2GMTC 4MG3A 3F0PA 2P94A 2GTBA 5DP9A 2C8YB 1GI3A 1O5EH 3TJVA 1C1WH 1LHEH 1O3PB 4DJZB 1KTSB 4B73A 1DS2E 1RTLA 2IPHA 2AGGX 1INCA 1KLTA 3KQEA 3SGQE 1K28D 1XX9A 1J9CH 2FX6A 4RSPA 4Q2KA 1XVMA 3E0NB 2WUCA 4F48B 2QF4A 3RXUA 1SGCA 4KTSA 4JZIA 3OFND 1D6WA 1MTNB 3OSYA 4Q7ZA 2R2MB 3BEIB 1XUKA 5AHGH 2WPDD 1BMMH 3PV5A 5CHAC 3AAUA 1AZZA 1LKBA 2H9HA 1SQTA 2R2WU 4FVBA 6GCHF 2EA3A 1XUFA 2GT8A 2HRVA 3MU8A 3SHCH 1FAKH 2Y7XA 3F9HA 3GDSA 4ZHMU 1THSH 1FDPA 1KXFA 1ELEE 1OP8A 2A7CA 1K1JA 3A8BA 2O8TA 2ZU3A 2R9PA 1BBRK 2A0QB 4WY3A 5TJXA 2F9UA 2WSSD 3SJOA 1DICA 2QF3A 1SSXA 3LJJA 1AGJA 3SI4H 1PPGE 4FU9A 2C90B 4NIVA 1AIXH 1M9UA 3A8CA 2ZHFH 3UOPA 5J4SA 4K2YA 3URDA 2V0BA 1XKAC 2WINI 4ISNA 5JBTA 4D76A 4CREA 3URCA 1E37B 1SQAA 3KN2A 4X1RU 4TYDA 2H5DA 3MH5A 2KAIA 1BHXB 5E8EH 4P00A 4YOGA 3SGBE 1HUTH 1HV7A 1LHGH 4F49A 2AGIX 2IPQX 1JIMA 2KAIB 3FAOA 2CF8H 3TVJB 3P70B 3ZYEA 3R3GB 1UCYE 1EB1H 3MWIU 1EFRD 1C2JA 3P95A 5B6OA 1YBWA 2BLWA 4HGCA 3HGPA 2PKSC 1GJ7B 3DFLA 1UO6A 1GJ8B 5GWZA 2J2UA 1C1QA 3EGKH 4O03A 5JB8S 3PWCA 2W26A 1GG6B 4DY7B 1U6QA 4PROA 1SHHB 2M2AA 8KME2 2BZAA 4ZMAH 1QB9A 3LC3A 7ESTE 1UTMA 2XTTB 1E38B 3PYHA 4RKJB 3RXSA 1RIWB 2OTVA 4AOQA 1AD8H 3M5MA 3GY6A 3UIRA 2KCYA 3A81A 3U8TH 3BN9A 1DLEA 2LP6A 5A0BA 3TGIE 2XBYA 3ATWA 3PLBA 4XBBA 3JZ1B 2J9NA 4ASUD 2Z94A 3MMGA 1KLIH 4IMZA 4WXIA 1SGFG 4ACBA 1HAXB 2FOHA 3VPKA 1VGCC 1KDQA 1E36B 1CSOE 1JOUB 3K9XB 3SQEE 1MKWK 2PHBA 1V2KT 1VCPA 3UREA 3VEQB 2VVCA 3TK6A 2ZU2A 4BANB 1F2SE 1W13U 1ZRBA 1KY9A 1VCQA 2QY0B 4TY7A 5FXLA 2BLOA 2A32A 4DCDA 1P9SA 1XUIA 1ELVA 4JMYA 1TGSZ 3TU7H 5DG6A 1F0RA 1UTKA 1GI4A 3SNDA 2ZO3H 3MO6A 2TPIZ 2H6MA 1KDQB 1AUJA 3L33A 3LONA 3PMJA 4DIHH 2ANMH 4VGCB 1BA8B 3PMBB 5L2YH 4OM9A 3WY8A 1AWHB 1O5GH 1HYLA 1QB6A 4INLA 4X8TH 5FL7D 2W7SA 3W94A 1F7ZA 1FQ3A 1ANCA 2Z9LA 2ZPQA 1FPHH 3V12A 4Y11E 1GHWH 2BD2A 2FO9A 1TQ7B 7GCHG 5FHTA 1W3CA 4B6EA 2XBVA 1OOKB 1VR1H 2OP9A 1O5CB 3T25A 2ZGCA 3CS0A 3SU4A 5ESBA 1NFYA
chains in the Genus database with same CATH topology
4NGAH 1K2I1 1O2YA 2B9LA 3I77A 2CJIA 4TY6A 2BZ6H 5TCCA 4ABHA 1IQLA 1PPFE 1BDAA 1FJSA 1ESBA 4ABBA 4Q80A 3AW1A 1UVPA 3NPSA 1JRTA 2XYAA 4ZHAA 5C20A 5F8XA 2BX4A 1QR3E 2RDLA 1NY22 1E35B 4FVDA 2FIRH 1CQQA 1WCZA 4WVPE 1A0JA 5F8TA 1P05A 1AZ8A 1O2PA 1ZLRA 1MAXA 1D3TB 1GPZA 1WV7H 4R8TB 1ZSKA 1GJDB 3T26A 1O3KA 1GJAB 3E6PH 2DUCA 1H9LB 3KQBA 2Z9JA 1ZZZA 1UTLM 4ABGA 3F9GA 2B7DH 1RTFB 5DP6A 3U8OH 5A2MH 4AB8A 3KQDA 2QGRA 3Q3YA 1FY8E 1CE5A 1J8AA 1BTZA 1UCYH 1ARBA 2GKVE 4NA9H 4ZXXH 1IOEA 3A83A 1TX7A 4BNRA 5DP4A 3SNBA 4B75A 2ZGHA 4AYVB 4TWWA 1YCPM 2JETC 1QJ7B 3A7XA 3HK6B 1BB0B 4O3TA 1ABIH 3KL6A 5EGMA 2FP7B 1ZSJA 4Z0KA 1Z8IB 3PV4A 5HYOA 5C5OA 2H9TH 3PMHB 4AGJA 1GHYH 2VWMA 1LVBA 5GIBA 1C4U2 1TFXA 3C27B 3NZIA 1ELBA 3BTKE 2STAE 1NFXA 4F4OC 1OP2A 3FANA 4FUEA 4TPIZ 1C5RA 1GI2A 1BIOA 2PR3A 1TGBA 1L0ZA 3QZRA 3K2UA 1HAYB 4J2YB 4BTTB 1T8NA 2IOTA 3M3VA 1ZOMA 4MPUA 1GBHA 4LZ4B 2WPLS 4NZLA 4NIWA 4SGAE 1SHYA 1YF4A 1THPB 1V2ST 2QXHA 1C2HA 2A4QA 1XKBC 1GGDB 1XUGA 1LDTT 2P3TB 4MPWA 1B0EA 3KNXA 4MLFB 2GD4B 3TIUA 1V2VT 1CHOF 1A7SA 3OYPA 4UFGH 4B2BA 1LVYA 4X8UH 1EOJA 2G4TA 4IN2A 2JH5D 1TYNA 1DXPA 1T32A 1JRSA 3ITIA 3QTOH 4I8JA 1C1SA 3DT0H 1WAYB 3B9FH 4IGDA 1MBMA 2W7UA 1T4VH 1GBTA 1S85A 1EKBB 3ZZ3A 5JB9S 4YLQH 1BRAA 3RLWH 1T4UH 1NPMA 1EQ9A 1C1MA 1MKXH 3H7OA 1BTWA 1SOZA 6CHAC 3GDVA 2F9NA 2HPPH 4BAHB 1LMWB 4X1SU 2AMPA 1WQSA 2O8MA 2TGDA 3BTDE 1YKTA 1DXWA 1QTFA 4NCYA 4GPGA 1XXDA 1CO7E 5IYTA 3RXAA 3NXPA 2XXLA 1MAYA 2I6SA 2ANYA 4NSYA 1W2KH 2FXRA 4BXSA 1P2KA 3A8AA 1JXPA 1ELDE 5GCHG 3SO3A 1MQ5A 3RU4E 1Z1JA 5EG4A 1ZJDA 3ZVCA 3SNAA 2J95A 4NA8A 3ZZ8A 2D2DA 1S0RA 2BQ6B 2A2QH 1O3BA 2GDEH 4D9RA 3MU1A 1P01A 1UVUH 1GI5A 2XC0A 4Y6DA 4AGKA 3BTFE 1MTNC 1GHBF 2CHAC 3M36A 4AX9H 1NS3A 2VB0A 4BTIB 1F0TA 3SZNA 1MTUA 1TMUH 4U30A 5EW2H 1EZQA 1O3OA 2Q1JA 1TB6H 1AFQB 1GBCA 2CMYA 3RU4D 1MU8B 5GPIB 1MMJN 2PKAA 3SJIA 2GCHG 2LPRA 1Q31A 1GJCB 1NESE 3P6ZB 4OS5A 1V2TT 3P17H 3RXMA 2ZCLP 3ATIA 2SGEE 7KMEH 3QWCH 5DKMA 4ESTE 3S9AA 4MNXA 1P03A 3SUGA 3A8DA 1OWIA 2ULLA 4AFZA 4CRBA 3ODFA 1ESAA 4LZ1H 1G2LA 3SV2H 1BHXF 3EAJA 1D4PB 4GCHG 1XXFA 2PKAB 1TNKA 1O3AA 2PSYA 2BXTH 2GZ8A 2VGCC 3GYMA 3PROA 1EJNA 1MQ6A 1C5VA 2G52A 2GVFA 3E0PB 3RC6A 2PTCE 1B5GH 2AERH 4Y7BA 1AE8H 1DM4B 1QBVH 2SGQE 1H9HE 3ZZDA 5JYIA 5SGAE 2BVRH 2Z9GA 3ODDA 1HBTH 3QO6A 1O3GA 5H4IB 2VJ1A 1SPJA 5C3NA 5ESTE 1JIRA 4NG9H 1SQOA 3LGWA 1SL3A 9ESTA 1FUJA 3SOSA 2TGPZ 3PLPA 2ODQA 3F68H 4MNYA 1C9PA 2ILNA 5HM9A 1BRUP 5C1UA 2VIQA 4ABJA 1YYY1 2ZECA 2PGBB 1EAWA 1EJAA 1K1MA 3PTBA 2R3YA 3RC5A 3MFJA 1TX6A 3NCLA 3T29A 4H6SB 1TNHA 4LXBH 1V2WT 3LH1A 3O8RA 1C1VH 1TONA 7LPRA 1HAIH 1Y3YA 2XWAA 1BTHH 3UQOA 1GBFA 1G37A 1RIWC 2XBWA 1KTTB 1O2HA 4YT6H 5F03A 2EI6A 1WSSH 1SBWA 1GVLA 3N7OA 1GMHF 4WWYA 2FODA 2Y82A 1ANBA 1Y5BT 3K65B 1S6HA 1O3IA 3U98H 4FUCA 1C5UA 2ZKSA 3BTME 3MNCA 5BPEA 5A0CA 3UOUA 1SGDE 4LK4A 4DVAU 3RMMH 1TGNA 4K1EA 1H4WA 3RXDA 1EAUA 1ID5H 1YPMH 3ZZ4A 1GBMA 3Q00A 1D3DB 3LPRA 5TCAA 1KLJH 5DGJA 4DIIH 4X6NA 1VITG 1XUHA 1OWKA 1C2IA 3I29A 1SLXB 1NTPA 1VCWA 3VB4A 1EJMA 3OTJE 1S5SA 1C2LA 2QXGA 3GCOA 1EX3A 1ETTH 4UFEH 4VGCC 5EQQA 2P93A 3RXPA 2A7HA 8ESTE 2G55A 3UFAA 1ZTJA 1P2QA 5AFYH 3SJ9A 1GHAF 4Y76A 1ZMLA 4IS5A 7GCHF 1NRPH 4YOJA 3FZZA 1N8OB 1NN6A 1O37A 2H2ZA 2RG3A 2CV3A 4CRGA 2SNVA 2BD3A 2ASUB 1L1JA 2AMQA 5C2ZA 1ZPCA 3FP6E 2ZGJA 1DWBH 4FUJA 3TJNA 1FY1A 4ABDA 3ZZCA 3HPTB 3Q76A 4BXWA 4OS2A 3A7TA 5DO4H 2ZGBH 2SGFE 4ASHA 2FLRH 1C5QA 4GHQA 1GJBB 3MO9A 1C5ZB 1O3LA 3GISB 2B5TB 3LU9B 4ZUHA 1OYTH 3ZZBA 1QIXB 1ELTA 4B71A 2C3SA 3RXGA 4ABIA 1KXCA 3TNTA 5T3HA 1MUEB 4M7GA 3BSQA 1C1PA 1P3EA 2Z9KA 2ZHDA 4ABAA 1ABJH 4MVNA 1C1UH 4FUDA 2F9VA 3HKJB 1WOFA 3KQCA 1EAIA 3BIVH 2XC4A 2AYWA 2ZPSA 1TQ0B 2OC1A 1UJ1A 1HJ8A 2P3UB 2A4RA 3CP7A 1GJ5H 2QAAA 1GHXH 3RXFA 1BRCE 1TMBH 1TNGA 2XCFA 1GBLA 4AFUA 1V2QT 4X2XA 1HIAB 1LPGB 4AFSA 1PQ7A 1GBKA 3KIDU 4K60A 1C5YB 3LGIA 3KEEA 4JCNA 2WUBA 3QZQA 4IBLH 3ZZ9A 1ZMJA 1GDUA 1ZGIA 3E3TA 2VIOA 3HK3B 1A3EH 1ANDA 3Q3XA 4HTCH 2JH6D 2ZCHP 2HNTF 1PQAA 1GHVH 1YCPK 1O39A 2F9BH 3ZVDA 3UPEA 1TPOA 3A80A 1O3JA 1DFPA 4BAKB 4A1TA 2YNBA 2BQWB 1QBNA 1MZAA 2FYQA 2BD5A 4J1YA 3ZZ7A 1TWXB 1Q3XA 2EI8A 1C1NA 1FIZA 1NRQH 5JBAS 2EEKA 1GBAA 1NO9H 1GI6A 3MH4A 3ZV9A 1J17T 2SGAA 1O2UA 1P2NA 3LH3A 4U2WA 4XDEA 1SR5C 2C8ZB 3Q3KA 2QV1A 2OQ5A 3M5OA 4JYTA 3MH7A 3TH4H 1P8VC 3A7YA 4X6MA 2P59A 1RS0A 2AEIH 3S9CA 1GMDG 1L1GA 2QIQA 1IQFA 3S7HB 1GGDC 3GYLB 3LT3A 2RCEA 2VU8E 5T6GA 2Z3EA 3TH3H 1TBRH 1D6RA 3MYWA 2UUKB 5A8XA 1SGFA 2Y5GA 3FZDA 1FNIA 1O2JA 1SI5H 1DVAH 3SJ8A 3C1KA 4OS4A 1BUIA 1HAHH 1LPKB 2FDAA 4UEHH 1AB9B 2ALPA 1O2LA 4X8SH 1X7AC 2BDBA 2BLVA 2UWOA 1H1BA 1L4DA 2UUFB 3ELAH 4CBNA 4DT7B 5BRRE 1P57B 1GBIA 2ZQ2A 2GP9B 1AVWA 3JZ2B 3ZVBA 4KTUA 3TJOA 3STJA 1B0FA 2BQ7B 2FOEA 4H4FA 4OS1A 4NWKA 1O2IA 1ZR0A 4I8HA 1C2GA 1NU7B 1MU6B 2GGVB 3SU3A 1T31A 1FY4A 3ATMA 1F5KU 3O8DA 1V2LT 1S6FA 1CT0E 1EB2A 1HDTH 1C2KA 1NC6A 1YC0A 2QA9E 3P92A 3PO1C 2Y6TA 3QUMP 2EI7A 1BMLA 4YESB 4A92A 1EPTC 1T8OA 1AFEH 3P8GA 3MO3A 3IG6B 3ZVEA 1CT2E 4DURA 2CGAA 3F6UH 1JBUH 3G01A 2YOLA 1UTOA 4UE7H 4IW4E 1IQIA 2ZDLA 1WYKA 3SGAE 4H6TA 2PV9B 2ZDAH 1CA0C 1OWDA 1AFQC 2FWWA 1GI1A 1SGNE 2ZIQH 2Q6GA 1TNJA 6LPRA 2VVUA 1K1LA 5DJ7A 9LPRA 1C9TA 4I33A 5ETXA 1ZYOA 2FOGA 3GCHC 5F8ZA 4CRCA 4D7FA 3AASA 4JK6A 1DANH 3SJKA 1THRH 1HGTH 4GCHF 1O2WA 4X2VA 1O2OA 1F0SA 3UY9A 4DGJA 1O35A 1ORFA 1GL0E 2OXSA 1MD7A 2BLQA 2V35A 1P02A 2XCNA 1YPKH 2HGTH 2BD9A 1QFKH 4A7IB 1VZQH 1K22H 3M35A 4GUXA 5CHAB 4CRDA 8GCHG 3A7VA 1MH0A 4NFFA 1J14A 5J4QA 4NA7A 1OWHA 3L3TA 2ZDKA 1P11E 2ZU1A 4K8YA 2FZZA 4R0IA 2ZFFH 1LHFH 3HGNA 3UWJH 3LDXH 1BQYA 5EQSA 2ZFSA 3M37A 1RD3B 1UTQA 1BZXE 3VFEA 2BD7A 4IMQA 2GCTC 2ODPA 5K0HA 5ABWA 4ZKSU 3D62A 4OGXA 4KGAA 1EZSC 1C1RA 2A5AA 1A46H 5FPSA 3VGCC 4X1PU 3UNRA 4O9VA 3M3SA 1DLKB 1FN8A 1L4ZA 1NFUA 1Z6EA 3S69A 1IHTH 4JZ1A 5E0HA 1YPHC 2AIQA 2VIDA 2TRMA 2BDIA 5EPYA 3RXOA 1W12U 1BBRE 4IC5A 3M61U 2B8OH 4K3JA 1S83A 1T7CA 3GY2A 1HAOH 3RXJA 1DDJA 1IQNA 4XBCA 2J4IA 1YP9A 3GCNA 2NU3E 1S84A 4YO9A 1SGTA 4CH8B 4A5TS 2BYAX 4FU8A 2BDGA 4YLUA 2XWBI 1AI8H 2VH0A 3PMAB 2TGTA 4DG4A 1J15A 1F5LA 1PPBH 3H5CB 1Y5AT 4OS6A 4ISHH 5FCKA 1G3BA 4FXGH 2FOMB 3SI3H 2A5IA 4B2CA 2OCVB 3MI4A 1IQKA 2ZDMA 5AVDA 2ZFRH 2BVXH 4K8BA 2GDDA 2QF0A 1C5NH 1EASA 4GSOA 2TGAA 2FTLE 3QGNB 5GDSH 2BY9X 2SGDE 1BMNH 4HI3A 3U1JB 4ZAEA 2EC9H 1UMAH 2LNCA 2ZWLH 2F9OA 2WYJA 2ZQ1A 4FUHA 2UUJB 1HB0B 1OYQA 1T8LA 4YTAA 5LPEA 1O2MA 1ZJKA 3SBKA 1HJAC 1TPSA 1FMGA 1TALA 2O8WA 2BOHB 3VB6A 1P2MA 5DP3A 1TGCA 1QL9A 1VGCB 2W3IA 1O2VA 2BX3A 1QL7A 1OX1A 3BTEE 3T27A 2VH6A 2THFB 3TJUA 3QTVH 4WH6A 1N8OC 3MNXA 1AVGH 1F5RA 1Q2WA 5LPRA 4KELA 1DOJA 1QNJA 4IC6A 3BTHE 1O2SA 2C4FH 2V3HH 3O8CA 4AN7A 1MTSA 5GXPA 2XC5A 1FY3A 1ANEA 1VITH 3RMLH 3EA8A 1BITA 2HPQH 1W11U 1G36A 4ZKRU 4AG2A 4XFQA 1SGQE 2PUQH 4I7YH 2WV4A 5A8YA 1JWTA 1TIOA 2BHGA 1LKAA 5FBIA 1G30B 3U1IB 2P8OB 2WYGA 4E7RG 3QLPH 2ESTE 1C5LH 2BDHA 1FPCH 2ZU5A 3SU5A 2J34A 3BTQE 4WH8A 3FP8E 4I32A 3QX5H 5DPAA 1O32A 2JKHA 2BY8X 4U01A 2C8WB 2JH0D 1MCTA 2FI5E 3EQ0H 1PQ8A 2M5TA 2ZA5A 3U9AH 2D26C 3GY3A 3GOVB 2SGPE 1SGEE 3ENSB 1ETSH 1RJXB 3OX7U 5AFZH 4MDSA 2SFAA 1SLUB 1W0YH 4FUIA 1BBRH 1AHTH 1QA0A 3RXEA 1JMOH 2QC2A 1EOLA 3B23B 4XSKU 2V3OH 3RC4A 3NUMA 1VJ9U 1FI8A 4A1VA 3S9BA 4HZHA 3RDZA 1QRWA 2WPIS 1ZGVA 1XM1A 3M5LA 2J92A 1AKSA 1PPZA 3T28A 1PPHE 1O2ZA 2P16A 1Z6JH 4UFFH 2HWLB 1GCTB 1UCYK 3A7WA 1P0SH 1BJUA 5PTPA 2FESH 2OC0A 1LHCH 1TNLA 4I8GA 3RXBA 1BRBE 2O8UA 3ESTA 3LGTA 1GL1A 1K1OA 5A8ZA 5EXNA 1AKSB 1YM0A 1KXDA 2G5NA 3PLKA 2R0KA 5C67A 1KYNA 2F9PA 1Z8JB 1V2MT 1WQVH 1Z8GA 2PSXA 3LOXA 1XUJA 2PWXA 4BOHA 3E91A 1GG6C 1GMDF 5I46H 3A87A 1ELAA 3A84A 3UR6A 2Z3DA 3M7QA 1SFIA 3RXQA 4GVUA 1FIWA 1DT2A 1OP0A 3SNEA 1TABE 4GHTA 1UVTH 1C2MA 2ZTXA 2NU2E 5EQRA 2Z3CA 2XRCA 1Y3VA 1LVOA 4WMDA 2BB4A 1QY6A 4UONA 4RKOB 3O8BA 5FAHA 4INKA 1W14U 4CHAB 1UVOA 3M7TA 1O30A 2OUAA 1K9OE 4U32A 1IQMA 1NU9A 4ZHLU 4YOIA 2AGEX 1TNIA 3T62A 1WTGH 2BD8A 3RM2H 3UUZA