8LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA01
2UWPA 1UK3A 4XBBA 2VB0A 1EXFA 4NCYA 5IDKA 2F9NA 1SLWB 2YOLA 1AE8H 3WY8A 2BDHA 1AVWA 5A0CA 1FPHH 1FAKH 1KTSB 1CBWB 1P2KA 4MLFB 3SV6A 1GHZA 1BT7A 1RRKA 2ZQ1A 1TGCA 3P8NA 3P70B 5EW1H 2FOGA 5FBEA 2A45B 2RA0A 3M36A 2Z9JA 3OY5U 2OCVB 2VIVA 5DP4A 1ZMLA 5ESBA 4Y71A 8ESTE 3R0FA 4Y6DA 1AIXH 1A2CH 1YYY1 1TWXB 3MU8A 2PGBB 1W12U 1F2SE 1SGTA 2ZG0H 3PLKA 1S82A 4OS2A 1E36B 2OBOA 1BDAA 1CVWH 2WPJS 1O3EA 1MKWH 2FOBA 5C2ZA 4Y0YE 1P57B 3M7UA 3MU0A 1AZ8A 1XM1A 2JH6D 1JWTA 3A85A 3E8LA 3RDZA 1Q3XA 2FWWA 3TNTA 5CMXH 2BVRH 2FOEA 1SLUB 3HPTB 3A7WA 3ATMA 3GCTG 1C2EA 4FVBA 2GZ9A 1AWHB 3Q00A 5AHGH 5EXLA 2A0QB 4AOQA 2R3UA 5EOKA 1ZSLA 4K1TA 1CSOE 2ZTYA 1D3QB 1O2XA 1B5GH 1GG6B 2R2WU 3BSQA 3HK3B 1EAWA 5FPYA 1PJPA 5GCHG 3TGKE 2FI3E 1V2MT 3MOCA 5DP6A 4YO9A 5I25A 3UREA 2ZDAH 1O3MA 1AHTH 5FXLA 1MTUA 1ANBA 1UTLM 4Y7AA 1ESBA 2QA9E 2TBSA 2UUFB 3BTDE 3NKKA 4VGCC 2QAAA 3ZVAA 1MU6B 2C93B 1O5FH 5B6OA 4CHAC 1SR5C 1P11E 3F9EA 2D26C 1GMDF 1ZRBA 5GWZA 1RS0A 2FTMA 3SHCH 1GI6A 1AB9C 1MKWK 1NFUA 3PV4A 3PO1C 1DY9A 1SHYA 1O2WA 2JETB 3SJ9A 2BDBA 4X8SH 4XOJA 1HJAC 2WUCA 3UIRA 4FUGA 5FCRA 1TNKA 1O2QA 4OGYA 1NROH 2TGDA 1SB1H 3RM0H 2YNAA 3F6UH 1DITH 1IQKA 1O2YA 2WYJA 4NWLA 1TMUH 2ZFQH 3KCGH 3UR9A 5PTPA 1GJ5H 2VIOA 1BIOA 1GHAF 2HRVA 1BMLA 1C1QA 1GI8B 3LGWA 3QO6A 3ZZ7A 3E3TA 1W11U 2A2QH 3RXEA 3B23B 4O9VA 1OWEA 3A88A 1CA8B 1D6WA 1AUJA 4UFDH 2AIPA 3ODFA 1SGFG 2BM2A 4BTIB 3EYDA 1C5UA 1W14U 3LGVA 5TCAA 3TK9A 3M61U 4TY6A 2O9QA 1OP8A 3FVFB 4NA9H 2ZDLA 2XXLA 2HPQH 2ZPRA 1WU1A 1DLKB 2SGPE 2PV9B 2Z9KA 3HGPA 3ELAH 4AN7A 4FUHA 5L2YH 1KXBA 1DUEA 4DGJA 7LPRA 2ZHFH 4ZUHA 3ATWA 2ZDVH 2ANKH 1MBQA 4X6NA 1FN6A 2WINI 2TIOA 5LGOA 3LIWA 5EU8A 2H5CA 1F5LA 3SHAH 2BY8X 3RXRA 3SI4H 2QV1A 5EODA 1TX8A 2J95A 4MNXA 1VITG 3W94A 1IAUA 4NA8A 3NZIA 2PGQB 1AE5A 2Z9LA 3A7TA 1QL9A 3AVZA 5T6FA 3SNCA 3SUEA 4WXVA 3EQ0H 3HGNA 3BIVH 1GBHA 4K1SA 4GUXA 1BA8B 4MNWA 4E05H 2SFAA 3T62A 4D7FA 2Y5HA 3K6ZA 3TIUA 3MMGA 1A0LA 5DP8A 2G81E 4CREA 2ZFSA 4CRCA 4JZ1A 2A7HA 2OUAA 1CGJE 4RKOB 1CO7E 1BTZA 4MPVA 4WMEA 3UOPA 1G3DA 2PKSC 1TPAE 2PFEA 1ZRKA 5AFYH 5BRRE 3AW0A 1MU8B 1P2OA 2J38A 3UUZA 1WV7H 1YCPH 1H9IE 2GCTC 2B5TB 4NSVA 2FIRH 1IQGA 3RXMA 1HV7A 1YPGH 3SQEE 4KTSA 1THRH 1P12E 2WV4A 1FUJA 3GY2A 4FU7A 2BD4A 4CR5A 3SI3H 1TALA 1QNJA 5EGMA 4B74A 3RXHA 2GZ8A 2ZU1A 3SGAE 1BTXA 4TY7A 1SL3A 4HFPB 1XUFA 2XRCA 1LVBA 1NPMA 2ZI2H 3BTKE 4YOGA 3S7KB 4DW2U 2ZPSA 4E06H 2GMTC 5T6DA 1O38A 4K5ZA 1HIAB 3BTQE 2STBE 3MFJA 1CHOG 2BXUH 3VB6A 2QY0B 1ZOMA 2Q6GA 4JZDH 1HAYB 1CT4E 1DM4B 5J4QA 4D8NA 4AGKA 1EPTB 1TABE 5C5NA 1E34B 1G3CA 1TYNA 4GHTA 2VH0A 1GPZA 2A7JA 2ZHWH 3A7ZA 4KTCA 1DOJA 3BIUH 2BVSH 4JMYA 2HNTF 1UO6A 1O2RA 1VITF 5F8XA 1C2LA 1BBRK 2FS8A 1C5YB 3QWCH 1KLTA 1O2VA 2Q6DA 1SFQB 2BQ7B 3V13A 1H9HE 2ZP0H 1AO5A 1HAZB 4NIVA 3RXDA 3SUFA 3S9BA 4K1EA 3ZZAA 4GSOA 1GI7B 3ZZ4A 1ELVA 4UDWH 2FEQH 5GJ4B 1BITA 1GMHF 3GY4A 1C5PA 1YPEH 2IOTA 3TVJB 4BNRA 3LC3A 4NG9H 4Z0KA 6LPRA 1MCVA 2FTLE 3D62A 3Q3XA 4YLQH 4A7IB 1L1JA 4X1RU 2FI5E 3GY6A 1NRSH 1O3HA 1C5VA 2J92A 1SC8U 1QHRB 1EB1H 3A7VA 1IQLA 3MH6A 1C1WH 1K21H 1TPOA 2D2DA 1AD8H 1FN8A 1V2OT 1GVLA 1NU9A 2Y81A 1OXGA 1GI9B 4K69A 4NFFA 1FDPA 4Y0ZE 2Z3CA 4AORA 2QGRA 1Y3VA 3MHWU 4H6TA 2CF8H 1GI4A 3K6YA 2OTVA 2GMTB 2O8LA 1BMMH 3H5CB 1DSUA 1GG6C 4XSKU 1SGQE 1H1BA 5HMAA 2HNTC 3AASA 4B2BA 1MMJN 4X2YA 1TE0A 1QJ7B 1KXFA 2CF9H 3SU3A 1SVPA 1F5RA 1Y3WA 3LT3A 3K9XB 1HJAB 1A3BH 2XC5A 3ZVEA 1UTOA 5EXNA 3HKIB 4ZHLU 2UUYA 1K1JA 1XVOA 2VNTA 4AFQA 1RTFB 4Q80A 1FY3A 4CBNA 1S83A 4FVDA 2AFQB 1O5GH 2OLGA 3T2NA 2G5NA 2EI6A 2A1DB 1S85A 1DFPA 1QJ6B 1T32A 1GI3A 4IC6A 3BG4C 1UVUH 3MO3A 1QB9A 4KGAA 2A4RA 1W10U 4FUEA 4I8LA 1MKXK 3V0XA 2F91A 4K60A 4JZIA 2VWMA 1HAGE 4CR9A 1GJ6A 4XE4A 1GBLA 2O8UA 3SU0A 1AFEH 2SGAA 2ZHQH 2FOFA 1O33A 1XUJA 3MNCA 4B75A 1ANDA 3LJJA 1GMHG 2C8ZB 4R8TB 1MBMA 3A8DA 3I77A 1RFNA 3P8OA 3GOVB 5EQSA 8KME2 1C5WB 4X0WU 1SOTA 1QCPA 1P2JA 2VU8E 3STJA 4Q7ZA 1QL7A 1QY6A 1EPTA 1G3EA 2R3YA 2GGVB 1CHOF 1Y59T 4M7GA 4QT8C 1NRPH 4H4FA 2FX6A 4YOIA 7KMEH 1V3XA 5I46H 1LO6A 1FONA 3A83A 2FMJA 1ELDE 1C2FA 3LH3A 2WYGA 1DXPA 1P05A 2BHGA 1V2WT 2TGTA 1GL1A 2PSXA 1SG8B 5EQRA 2ZCLP 3V12A 4UD9H 4TPIZ 2BZ6H 3PTNA 2AMPA 3MNSA 1LMWB 1NZQH 1TIOA 1EB2A 1QB1A 1FIWA 1C5TA 3RXAA 3STIA 1DT2A 5JB9S 2ZCKP 1TNGA 1ZGIA 2ZGJA 4JK6A 1O2KA 1EZSC 1W7XH 3SU5A 1K22H 1F0RA 1NESE 1SGRE 1MH0A 2G55A 2CV3A 3O8CA 1TGBA 2BLVA 2V3OH 1P04A 1AKSA 2BDGA 2BTCE 1UVTH 2A4QA 5DP5A 1CBWC 2XCNA 2FYQA 4Q7XA 3SW2B 1B7XB 1C5XB 1LVYA 2Q6FA 1TMBH 2OC8A 1C9PA 3LGIA 1K1NA 3RXOA 3RU4T 2FPZA 5EPNA 2EC9H 2BD5A 1UJ1A 6GCHF 4Y10E 1G2LA 4MNYA 4XDEA 3ZZCA 1O31A 2GDEH 1ID5H 1Z8JB 2F3CE 2ODQA 1RGQA 5JDUB 2F9PA 4Y8ZA 4IGDA 4NA7A 1HCGA 1PQ8A 1UCYE 3UWIA 4ABHA 1VCQA 1SLXB 7ESTE 4ISNA 2BQ6B 1LQEA 2GT7A 3S9CA 4O97A 5F03A 3M5MA 1GBTA 1KY9A 1MTVA 1T4UH 1V2QT 2FDAA 1J8AA 5HGGA 1PQ5A 4IMQA 4AB8A 3D49H 3GY3A 3RXTA 1F0UA 4X1SU 4YM9A 3UR6A 3KEEA 2BD2A 1VITH 1JIMA 1O32A 3RXPA 1FY8E 2ZGHA 5FAHA 5FHTA 2ANWA 2ZDMA 4TWYA 3GCNA 3Q76A 3LC5A 1TOCB 2ZWLH 1C2IA 1TNJA 1H8DH 2CHAB 4HGCA 5A0AE 1EAUA 5FPSA 5A8YA 1T8NA 2Z3DA 1IQMA 4LZ1H 2PW8H 4YZUA 5EPYA 2VJ1A 2OINA 1GHBF 1U6QA 1UTKA 2D8WA 1UVPA 2A31A 1PPCE 2NU2E 4B2CA 1HNEE 1YPMH 1C1RA 4I8KA 3T25A 2XC4A 3T29A 1FPCH 2GP9B 3ZZ9A 3SQHE 5HYOA 3DHKH 3GDUA 2G8TA 5H4IB 4J1YA 3JZ2B 2EA3A 2VWNA 2C3SA 1XX9A 4B76A 1C4U2 1C1MA 1S6HA 1P2IA 2BY5X 2XC0A 1N8OC 3GYMA 2GTBA 3PTBA 1TGSZ 2SNWA 3P95A 4U30A 3U8RH 2BD7A 1O2HA 2VIDA 2ZF0H 4IW4E 3SJ8A 1ELEE 1S84A 3SJOA 1HLTH 4WY3A 3RMOH 4MQAA 2H1UA 1GJ9B 2FS9A 3ZYDA 1ELBA 1SGFA 4Y8YA 4XBDA 2F83A 1BJVA 3OTJE 4H42U 2ZZUH 1A0HB 1LHGH 4O3TA 4OS5A 4AFZA 1TQ0B 2ZNKH 2XBYA 4Y8XA 3ZZ8A 1G30B 1EJMA 1C2GA 4WXIA 3ZVBA 4ABJA 2FOMB 1DX5M 1K1MA 1A61H 4YLUA 2NU0E 2G51A 4DVAU 2FODA 1IQIA 4GPGA 3BG4B 4F4OC 3UQOA 1LQDB 4U01A 3F1SB 3TGIE 1YLDA 4CBOA 5GPIB 1W0ZU 4A1TA 4X8TH 2DE9A 3QDZB 1ZTJA 3VXFH 2BB4A 2BY6X 1OS8A 5C5OA 1GCTC 1F92A 5E0JA 1UTMA 5EW2H 1QTFA 2XWAA 3GCHC 2BYAX 1WTHD 2VIPA 3A87A 1XXDA 5GIBA 1OSSA 1TFXA 4OGXA 2J4IA 5C1UA 2Y5GA 1DE7H 1GBBA 1YPKH 4WH6A 5GDSH 4X2VA 3BTFE 1FY1A 3RXVA 2FM2A 4DOQA 3EGKH 3VEQB 5F8ZA 1L1GA 2QYIA 1UTQA 3LPRA 1D3DB 1GBIA 2BXTH 5FCKA 4ZXYH 1ELAA 1MAYA 1QBVH 3UQVA 3T26A 1EZXC 1SQTA 3VPKA 4B71A 1JXPA 1YLCA 1P01A 1TBQH 2IJOB 1Z7KA 1SGIB 2G00A 2G52A 5E0GA 2H9HA 2ZHEH 3RM2H 1A3EH 3SNBA 5F8TA 4KTUA 1O3IA 1QA0A 3A8CA 2Z6BD 5A0BA 1HAHH 1NFXA 1THPB 4O03A 1O3NA 6CHAC 2GZ7A 4ABAA 1KLIH 1LKBA 3FANA 2ZU2A 3FAOA 4ZMAH 1GDQA 1GDUA 2JETC 4ASHA 2PKAA 1D3TB 1OPHB 2HOBA 3SJIA 3QZQA 1ESTA 4DG4A 1A4WH 1CU1A 3M37A 5A8XA 2CXVA 2ZU5A 4JYUH 1C1VH 2J9NA 1Z6EA 3V7TA 1BJUA 1AMHA 1GBCA 3RU4E 3U8TH 1N1LA 1HPGA 1GMDG 1YKTA 2K1QA 4Z6AH 2NU1E 4BAMB 3RC5A 3SU2A 4NIYA 3M3SA 4ZH8A 2G4UA 1MD7A 3P6ZB 2VIQA 3NCLA 2A5KA 3GCHB 1RXPA 2I6SA 4JYTA 3BN9A 1A1RA 1LTOA 1GBJA 1TX7A 1K1LA 1ZMNA 2FO9A 2Y82A 3RUOA 1NU7B 2OP9A 3QZRA 3SOSA 1C1OA 2A2XH 1CT2E 1DANH 1NC6A 3RXCA 1C5ZB 3M35A 1YGCH 2RDLA 3R3GB 1GJ4H 1NN6A 2JH5D 1SGEE 4KELA 3SV7A 4ABIA 3M5LA 4AFSA 4LK4A 4CRBA 1TPPA 2OBQA 1NS3A 3BG8A 1SMFE 2ZFTA 1ZPZA 3UWJH 2RCEA 3H7TA 5C1YA 1XXFA 3MNXA 4BAOB 1P02A 3TGJE 1IOEA 1C1TA 2ESTE 2G4TA 3ITIA 3MI4A 1BBRH 1AFQC 4YT7H 2AH4X 3MH5A 2QCYA 5JPMH 3PROA 1X7AC 4WMDA 2FI4E 3TH3H 3VB3A 1B0EA 1PYTD 1PPHE 4J2YB 1C5RA 3ZZ6A 3VB5A 2FZZA 1ZTKA 3ZVFA 2C4FH 3CENA 4GCHG 1UMAH 2ZQ2A 1AWFH 1BHXB 3LONA 3MO9A 2BX4A 4ZXXH 5JBAS 1ETSH 1HXFH 2A4GA 4MPUA 1HB0B 2B9LA 1GJCB 3PYHA 2NWNA 1L1NA 3RXQA 4ZHAA 1GWAA 1P9UA 1D3PB 1O35A 1MKXH 3SNEA 2WPIS 2WPHS 4WF8A 1SPJA 2FOAA 1GGDC 3RC4A 4AB9A 2CMYA 1TRYA 4DIIH 1O2IA 1V2KT 1O3CA 1HAOH 2A4OA 1BUIA 4JYVH 3BTHE 3GCTF 1W2KH 2PTCE 3O8BA 2GCHG 3PWBA 1DS2E 2ZEBA 1V2JT 3OYPA 2AMQA 1TOMH 5ETXA 1C2HA 1P09A 3I78A 3RLWH 2VWLA 1ZMJA 2THFB 5CE1A 1QJ1B 2GV6A 1C5NH 1TQ7B 1Q2WA 4CHAB 3Q77A 1ZHMA 2ZC9H 3AAVA 5DK1A 3UY9A 2H2ZA 3FP6E 1F7ZA 1GJ8B 4ISHH 5LH8A 2AYWA 1SGDE 1AU8A 3L6PA 2XBXA 4SGBE 3DT0H 1O34A 3DA9B 2Y5FA 2GD4B 2P3TB 1LHFH 2XBVA 1A0JA 1DWDH 1P3EA 2HWLB 2P8OC 3KNXA 3MU5A 1D4PB 5FX5A 1J9CH 1NFWA 1CQQA 3MO6A 4ABFA 9ESTA 3A86A 1KXCA 4MTBA 1RD3B 3RMLH 1C4Y2 1WAYB 4CRDA 2HGTH 3TITA 2G5VA 3QGJA 1RIWC 2V0BA 3MH4A 1LVOA 3UPEA 1BHXF 1JBUH 1C1PA 1Y3YA 3I29A 3M5OA 2B0FA 1HBTH 1C1UH 3NWUA 1A5IA 2BD3A 1MQ5A 1V2VT 2BVXH 1O37A 1MTNB 1GI2A 2BY9X 1LCYA 1XUKA 3TJOA 3S9AA 1TBZH 3BTGE 3SU4A 1MQ6A 4NIXA 3PM3A 4INLA 3ODDA 1IQHA 1EPTC 2V35A 3CS7A 3Q3YA 3OSYA 1KXAA 4FXGH 2AGGX 1VGCC 1VJAU 2P95A 1HFDA 3IITA 4BOHA 3QX5H 1Y5UT 3D23A 4NSYA 4R0IA 5L6NH 1M9UA 2UWOA 3CS0A 2R0LA 1TRNA 1WQVH 1HAIH 1OWJA 3GDVA 2ZGCA 1GJ7B 1EOJA 4OS4A 4X2XA 1GHXH 3PB1E 1O30A 2ULLA 1Y5BT 2ASUB 3T5FH 1XMNB 2AMDA 5L2ZH 1Y3UA 5C20A 3U9AH 1SI5H 2OXSA 1EASA 1BMAA 3GY5A 1GBDA 1N6XA 1F0SA 1FQ3A 2GT8A 1RTLA 3A7YA 1QIXB 5DP7A 1UVSH 3TJVA 3T28A 3URCA 4UE7H 2CGAA 2UUJB 2ZHDA 1BMNH 2VWOA 4DJZB 1C2KA 1EX3A 2BMGB 2BX3A 4FUJA 1QRWA 3PMBB 4Y7BA 1YCPM 1O0DH 2W3IA 2FESH 1PQ7A 3K65B 1C2JA 2A5AA 2BD8A 2WV5A 1G9IE 4ZKRU 3VXEH 2XWBI 1O36A 1AVGH 3N7OA 2F9VA 1DICA 1JMOH 1DWBH 2C8XB 1QURH 2BY7X 1XVMA 1QQUA 3PMAB 1XUGA 2QXHA 1G3BA 2HALA 3ZZDA 1OWKA 3MH7A 1GHWH 2TPIZ 1SQAA 1EOLA 4ABEA 1DWEH 1EATA 2H5DA 4OS7A 3LU9B 3A8BA 1ZHRA 2FOHA 1AKSB 2CN0H 5HM2A 1ARBA 1GBKA 1C5MD 1ZYOA 2ZU4A 5T3HA 2P3UB 3RMNH 1W7GH 4X1QU 1HUTH 1A5GH 1O5EH 4BAKB 4YOJA 1VGCB 4TYDA 4JZEH 1OYQA 3ZZ5A 5LPRA 2OC1A 1HGTH 5CHAB 3FP8E 3ZZ3A 1B0FA 1C2MA 3SJKA 3TJUA 3UNSA 4HTCH 4A1XA 4AX9H 1C9TA 3DUXH 2RA3A 1GVKB 1AVXA 1VJ9U 2B7DH 1XKAC 1AN1E 1WSSH 1V2NT 2QC2A 2J34A 4ISOA 1MZDA 4X1NU 3BV9B 3E1XB 4WVPE 4AG1A 1DUAA 4JCNA 1C1SA 3LGUA 3SN8A 1S0RA 4D9QA 2Y7ZA 4TWWA 4BTUB 2GDDA 3W95A 3ENSB 5DO4H 3GDSA 1KTTB 1ACBE 3QTOH 2V3HH 1O5AB 3UFAA 1FAXA 1GHYH 1IQNA 4KKDA 3M5NA 5C3NA 1D6RA 1HJ9A 1TNHA 4Y79A 1QBNA 1TRMA 1YPJH 3TU7H 4IS5A 4E7NA 3ZV9A 4UONA 4AG2A 2QXGA 3RLYH 1YC0A 1ZR0A 1C5SA 2H9EH 1CA0C 5K0HA 1TMTH 1PPBH 4YTAA 3SGBE 3ZVCA 1ELCA 2AERH 1Z8IB 5AFZH 1O3GA 3TJNA 1YBWA 2P3FH 1FXYA 2OC7A 3SUDA 1W8BH 2OD3B 2ZECA 1OP0A 2Z9IA 3KQEA 5JBTA 4Q2KA 1JIRA 1K9OE 5TJXA 1H8IH 1QBOA 1V2ST 3NPSA 1TAWA 1PFXC 1L4ZA 4NWKA 5T6GA 1P10A 4U2WA 2PTNA 3M7QA 3SNDA 4MPXA 4IC5A 1W3CA 1O3OA 3RP2A 1LHDH 4WH8A 1DLEA 1P2QA 5AVDA 1T4VH 1UCYK 3U1IB 1JRSA 3BTEE 2W7UA 3Q3KA 1TPSA 3BTME 2FLBH 1ZSJA 3RXGA 5LPEA 3E90B 3SO3A 2TRMA 2A32A 3QLPH 1CA0B 2QN5T 1DWCH 1EZUC 1WYKA 1C2DA 4A5TS 3OX7U 4DURA 2BDIA 1GI1A 4I8JA 2SGFE 2P94A 3A80A 5DP9A 4K2YA 2IN2A 1QL8A 3G01A 5DJ7A 1BRUP 1CT0E 1O5BB 4FUBA 5E2PA 3RC6A 5A8ZA 4I8HA 2JKHA 2FXRA 4XBCA 3ZYEA 2SGQE 2AGIX 5FPTA 2BOKA 3B9FH 1QRZA 1T8MA 2VH6A 1Z6JH 2I6QA 1G37A 2GKVE 2P93A 2Y80A 4I8GA 5J4SA 3KHVA 3RXSA 2PWXA 4FUCA 1FV9A 2PKAB 4Y76A 1OWHA 3LKWA 3NUMA 1T7CA 3E16B 1A5HA 1DPOA 1ELTA 4UFGH 1FZZA 4OS1A 1YP9A 1E0FD 4IN1A 1C4V2 3GY8A 2ZTZA 3P17H 6GCHG 1YM0A 4O3UA 3BF6H 2ZA5A 1SQOA 3SNAA 4MDSA 1AUTC 2PHBA 1BRBE 1ZPBA 4D9RA 8LPRA 2VGCC 2IPHA 4FUDA 1Y8TA 2ZDNA 4D76A 4YESB 1MUEB 4FUIA 1BTYA 4X1PU 1PPZA 1ZZZA 1LHCH 3PO1B 3SORA 1YPLH 2PLXA 2KAIA 3EE0B 1CE5A 2OQ5A 3F9GA 3LGTA 1FNIA 3U8OH 1HIAA 1SGNE 1T31A 1MCTA 4U32A 1O3FA 1Z71A 5A2MH 1GJAB 2P16A 1SFIA 2BQWB 1BOQA 1GJBB 1EAIA 2TGAA 3FFGA 2NU3E 4LXBH 1OWDA 2O8MA 1MD8A 1MTSA 1L2EA 1GHAG 2HPPH 5SGAE 1QQ4A 4CH2B 1TBRH 3CP7A 4A1VA 4B73A 1EZQA 4D7GA 3EA9A 1WBGB 3KN2A 4HZHA 4YT6H 1C1NA 3O8RA 1O3KA 3OU0A 2ZGBH 3BEFB 1IHSH 1UHBA 2BDCA 3DFJA 5IYTA 5DKMA 3A8AA 5F6MA 1BTWA 1O2LA 2LPRA 3ATIA 3TNSA 1P2NA 5CHAC 5C1XA 4CRGA 4AZ2B 3EDXB 6CHAB 2BOHB 4I7YH 5HM9A 2A7CA 3P8GA 1NRQH 3U98H 3ZVDA 1LVMA 4A6LA 4IN2A 1EAXA 1Y3XA 3VB4A 1TLDA 4AYYB 4A92A 1ZSKA 1F0TA 4UFFH 1YPHC 1EKBB 1E38B 2KAIB 1WTGH 1SGYE 3SUGA 1BRAA 2C90B 1KDQB 4MVNA 4GHQA 3FP7E 1DXWA 1OKXA 3P92A 2W7SA 4BXSA 2XNIA 3A89A 4ZKSU 1PPGE 2BLWA 2V6NA 3BTWE 1GI0A 4Y11E 3ESTA 1GBEA 3M7TA 2VGCB 5EG4A 3IWMA 1VCPA 3OY6U 2ZU3A 2BZAA 3F9HA 2QF0A 4FU9A 2BLQA 1O39A 3F9FA 5C67A 3T27A 2BD9A 2F9OA 2SGEE 3URDA 1C5OH 1K28D 1O3LA 3A84A 1G32B 3HATH 1WUNH 5LPFA 4CH8B 1GHVH 4FU8A 1GVZA 3KQCA 8GCHG 3MYWA 3BEIB 1O2JA 1PPEE 5FX6A 4AFUA 1EJAA 1FIZA 4THNH 1A7SA 1QRXA 4IBLH 2QXIA 2B8OH 1JRTA 3U69H 3UOUA 9LPRA 1O2TA 4F49A 1ORFA 2C8WB 2R2MB 7GCHF 4TPYA 5DPAA 4I33A 1EP5A 3RXJA 4CRAA 2ODPA 1SOZA 1AQ7A 1XKBC 1GMCF 2HLCA 4IMZA 4INKA 1FI8A 3B8JA 5A09A 1KXDA 1FJSA 1AB9B 1RJXB 1O2OA 1OP2A 4K8BA 2VVUA 5JB8S 1EP6A 1RTKA 3SV2H 1P03A 1Q31A 2VINA 4NZQA 1A46H 2QF3A 1RIWB 4JK5A 3PLPA 3HK6B 2W3KA 5JBBS 1MTWA 2SGDE 2A5IA 1TONA 2F9BH 1MAXA 3BEUA 3SV8A 1O2NA 4UFEH 4VGCB 1LKAA 1GI5A 1PYTC 2ZFPH 3VB7A 3E91A 1LPZB 1BRCE 2CJIA 3E0NB 1FY4A 4RN6A 5DP3A 2XYAA 5K7RA 1F5KU 2ZFFH 5DG6A 1FY5A 4KP0A 1AFQB 1HAXB 4ZKNU 2R9PA 1HAVA 3PWCA 1NFYA 3RXKA 1V2PT 4ABDA 1EUFA 1KSNA 5E8EH 1LPKB 3A81A 1OWIA 2AIQA 2EEKA 3QUMP 3P8FA 3SU6A 3V3MA 4E7RG 1CHGA 4AGJA 2Z94A 1N6YA 3E6PH 1EQ9A 1GHBG 4NFEA 1TA2A 1ETRH 2O8TA 3RXFA 4DIHH 4XFQA 4DCDA 4X6PA 3AAUA 1V6DA 1QR3E 4ZAEA 2QXJA 1UK2A 4DY7B 2ZKSA 1ANEA 1O2UA 1Z1IA 5ABWA 1BTPA 4GCHF 3MU1A 3LDXH 3E0PB 5E2OA 2H6MA 1MZAA 3KIDU 1V2TT 1L0ZA 1ELGA 1IHTH 4ESTE 3GYLB 2RG3A 2QIQA 3A7XA 1ETTH 1HYLA 3GISB 1K2I1 4I31A 2PUQH 2JH0D 4BTTB 4GLYA 3DD2H 4RKJB 2GCHF 2YNBA 1TNIA 1GGDB 3SV9A 1HRTH 3RXBA 1QB6A 3C1KA 1ZHPA 2ODYB 3RXUA 3MWIU 3GCOA 5FBIA 1O3BA 1HAPH 1SHHB 3TH4H 3GICB 2WPLS 1O3JA 4INHA 2Z3EA 3LJOA 4Q7YA 1NO9H 1TGTA 1K1IA 5JBCS 1BTUA 3ZVGA 2P59A 1UK4A 2ZTXA 3A82A 3S7HB 2TGPZ 3RMMH 2ZGXH 3D65E 4NIWA 2PKSB 2W26A 2XTTB 4CRFA 1GCDA 3FZZA 3K2UA 4B2AA 1CGHA 4ABBA 1YCPK 2AGEX 1LHEH 5HXFA 1AGJA 3S0NA 4B1TA 5L30H 4AYVB 1ANCA 4JZFH 1MTNC 2UUKB 2Z9GA 1C5LH 4K8YA 4HI3A 2AS9A 1AY6H 1O2PA 2ZIQH 2Z7FE 1DDJA 1HXEH 1JOUB 2XW9A 3KGPA 2R0KA 4LOYH 1SGCA 2FLRH 3RXLA 4OS6A 4PROA 5E0HA 4WJG2 1ABIH 5G4BA 3KL6A 1UVOA 1HAVB 1PPFE 4X8UH 1TGNA 5TCCA 1O2SA 1FLEE 3AW1A 1BZXE 2ALPA 3ATLA 3KQBA 1INCA 4BAQB 3MNBA 3SU1A 1SLVB 1FMGA 2FYRA 2GCTB 2ILNA 3C27B 1G2MA 4NGAH 3GY7A 4ABGA 2CHAC 3KQDA 1WQSA 4GAWA 1O5DH 1NTPA 1E35B 2GV7A 2GVFA 1WOFA 3M3VA 1D9IA 1V2LT 1CGIE 4FUFA 1IQJA 4X6OA 4UEHH 1UTJA 3VFEA 2HVXA 4BANB 1J15A 4X8VH 1GBAA 2GX4A 3QN7A 2WUBA 1ZJKA 1O2GH 1KXEA 1YF4A 5EQQA 1IQEA 1XUIA 2NU4E 3S69A 1KDQA 1GBFA 1YPHE 3NXPA 4BXWA 1T8OA 3O8DA 4RSPA 1DY8A 4LZ4B 2DUCA 3TPIZ 8GCHF 1KIGH 1XUHA 1O3AA 1G36A 1GCTB 1TNLA 1GJDB 3IG6B 3UNRA 1WCZA 1HDTH 1ZLRA 3EA7A 3MU4A 2WPMS 1AZZA 2ZPQA 3L3TA 2ALVA 2PR3A 1ZPCA 3TLOA 2SNVA 1P3CA 2J94A 1EJNA 1GDNA 1P9SA 1NT1A 1GL0E 1BTHH 1OOKB 3LGYA 3BTTE 2ZO3H 2OC0A 3TH2H 1T8LA 1NRRH 2Q1JA 1BQYA 4DT7B 2BDAA 3QK1A 1NRNH 1IQFA 4X6MA 1GMCG 5ESTE 2M5TA 1Z1JA 1LDTT 1O2MA 1TA6A 2Y7XA 3KF2A 1K1OA 3UTUH 4ZHMU 2D1JA 3SGQE 3SZNA 4NZLA 4X2WA 1H9LB 1W0YH 1J14A 1C5QA 2J2UA 2DE8A 4ISIH 1O3PB 1E37B 1SGPE 2FOCA 3NK8A 6ESTA 1S0QA 2O8WA 2UWLA 1VR1H 2ZFRH 3DFLA 1DVAH 3PMHB 1L4DA 4ZROA 1BBRE 1V2UT 1S81A 2XCFA 1P06A 1QGFA 1H4WA 2EI7A 3ZV8A 1DSTA 7GCHG 2PUXB 3PLBA 3M3TA 4MPWA 1SSXA 3TK5A 1HJ8A 1THSH 1KLJH 4MG3A 2ZDKA 1OYTH 2C8YB 3RU4D 2H9TH 4ISLA 3MTYA 4K3JA 1PQAA 1UHBB 3LOXA 1Z8RA 2PSYA 5BPEA 1GBMA 2FP7B 3QTVH 4WWYA 4GVUA 2W5EA 1K1PA 5GXPA 2XBWA 1ZJDA 3FZDA 2ANMH 1TB6H 1Z8GA 5EXMA 1UCYH 1UTNA 2FX4A 1P8VC 2EI8A 2VIWA 3VGCB 2BDYA 2VVCA 3PMJA 1ELFA 2LNCA 1S5SA 2VVVA 1NM6A 3LH1A 1LPGB 3SBKA 1ARCA 2P8OB 1P0SH 1S6FA 1KYNA 1NY22 1TX6A 2F9UA 2OQUA 3ATKA 2ZCHP 1VCWA 3H7OA 4ZKOU 1BCUH 3U1JB 1SBWA 5DGJA 1VZQH 3TK6A 1J17T 1AI8H 3HKJB 1O3DA 3UNQA 3ZZBA 4WMFA 1O5CB 1N8OB 2ANYA 5AF9H 1ABJH 4SGAE 4H6SB 1ESAA 1Y5AT 5GCHF 1BB0B 2AEIH 4I32A 1QFKH 1V2RT 1UTPA 1P2MA 1ZTLA 3JZ1B 4BAHB 2HNTE 1J16A 3EA8A 3QGNB 1OX1A 3RXIA 1W13U 3F68H 1ZGVA 1QA7A 2BLOA 2STAE 2Y6TA 5JYIA 4MNVA 3EAJA 3L33A 3VGCC 2WPKS 1O2ZA
chains in the Genus database with same CATH superfamily
2UWPA 1UK3A 4XBBA 2VB0A 1EXFA 4NCYA 5IDKA 2F9NA 1S6LA 1SLWB 2YOLA 1AE8H 3WY8A 2BDHA 1AVWA 5A0CA 1FPHH 1FAKH 1KTSB 1CBWB 1P2KA 4MLFB 3SV6A 1GHZA 1BT7A 1RRKA 2CK3D 2ZQ1A 1TGCA 3P8NA 3F2HA 3P70B 5EW1H 2FOGA 5FBEA 2A45B 2RA0A 3M36A 2Z9JA 3OY5U 2OCVB 2VIVA 5DP4A 1ZMLA 5ESBA 4Y71A 8ESTE 3R0FA 4Y6DA 1AIXH 1A2CH 1YYY1 2K8IA 1TWXB 3MU8A 2PGBB 1W12U 1F2SE 1SGTA 2ZG0H 3PLKA 1S82A 4OS2A 1E36B 2OBOA 1BDAA 4FOUC 1CVWH 2WPJS 1O3EA 5HIYA 2XNDD 1MKWH 3WWBA 5KECA 2FOBA 5C2ZA 4Y0YE 1P57B 3M7UA 3MU0A 1AZ8A 1XM1A 2JH6D 1JWTA 3A85A 3E8LA 3RDZA 1Q3XA 2FWWA 3TNTA 5CMXH 2BVRH 1UW7A 2FOEA 5CHBA 5EJZA 1SLUB 3HPTB 3A7WA 3ATMA 3GCTG 1C2EA 4FVBA 2GZ9A 1AWHB 3Q00A 5AHGH 5EXLA 2A0QB 4AOQA 4Z1MD 5T1VA 2R3UA 5EOKA 1ZSLA 4K1TA 1CSOE 2ZTYA 1D3QB 1O2XA 1B5GH 1GG6B 2R2WU 3BSQA 3HK3B 1EAWA 2KCYA 5FPYA 1PJPA 5GCHG 3TGKE 2FI3E 1V2MT 3MOCA 5DP6A 4YO9A 5I25A 3UREA 2ZDAH 1O3MA 1AHTH 5FXLA 1MTUA 1ANBA 5DN6D 1UTLM 4Y7AA 1ESBA 2QA9E 2TBSA 2UUFB 3BTDE 3NKKA 4VGCC 2QAAA 3ZVAA 1MU6B 2C93B 1O5FH 5B6OA 4CHAC 1SR5C 1P11E 3F9EA 2D26C 2YMSB 1GMDF 1ZRBA 5GWZA 2KCOA 1RS0A 2FTMA 3SHCH 1GI6A 1AB9C 1MKWK 1NFUA 3PV4A 3PO1C 4RT1A 1DY9A 1SHYA 1O2WA 2JETB 3SJ9A 2BDBA 4ZCNA 4X8SH 4XOJA 1HJAC 2WUCA 3UIRA 4FUGA 5FCRA 1TNKA 1O2QA 4OGYA 1NROH 2TGDA 1SB1H 3RM0H 2YNAA 3DCLA 3F6UH 1DITH 1IQKA 1O2YA 2WYJA 4NWLA 1WXRA 1TMUH 2ZFQH 3KCGH 3UR9A 5PTPA 1GJ5H 1BIOA 1GHAF 2HRVA 1BMLA 1C1QA 2VIOA 1GI8B 3LGWA 3QO6A 3ZZ7A 5EJ1A 3E3TA 1W11U 2A2QH 3RXEA 3B23B 4O9VA 1OWEA 3A88A 4ACBA 1CA8B 1D6WA 1AUJA 4UFDH 2AIPA 3ODFA 1SGFG 2BM2A 4BTIB 3EYDA 1C5UA 1W14U 3LGVA 5TCAA 3TK9A 3M61U 4TY6A 2O9QA 1OP8A 3FVFB 4NA9H 2ZDLA 2XXLA 2HPQH 2ZPRA 1WU1A 1DLKB 2SGPE 2PV9B 2Z9KA 3HGPA 3ELAH 4AN7A 4FUHA 5L2YH 4Q63A 2WPDD 1KXBA 1DUEA 4DGJA 7LPRA 2ZHFH 4ZUHA 3ATWA 2ZDVH 2ANKH 1MBQA 4X6NA 1FN6A 2WINI 2TIOA 5LGOA 3LIWA 5EU8A 2H5CA 1F5LA 3SHAH 2BY8X 3RXRA 3SI4H 2QV1A 5EODA 1TX8A 2J95A 4MNXA 1VITG 3W94A 1IAUA 4NA8A 3NZIA 2PGQB 1AE5A 2Z9LA 5HIZA 3A7TA 1QL9A 3AVZA 5T6FA 2WZQA 3SNCA 3SUEA 4WXVA 3EQ0H 3HGNA 3BIVH 1GBHA 4K1SA 4GUXA 1BA8B 4MNWA 4E05H 2SFAA 3T62A 4D7FA 3FN8A 2Y5HA 3K6ZA 3TIUA 3MMGA 1A0LA 5DP8A 2G81E 4CREA 2IJD1 2ZFSA 4CRCA 4JZ1A 2A7HA 2OUAA 1CGJE 4RKOB 1CO7E 1BTZA 4MPVA 4WMEA 3UOPA 1G3DA 2PKSC 1TPAE 2PFEA 1ZRKA 5AFYH 5BRRE 1QZ8A 3AW0A 1MU8B 1P2OA 2J38A 3UUZA 1WV7H 1YCPH 1H9IE 2GCTC 2B5TB 4NSVA 2FIRH 1IQGA 3RXMA 1HV7A 1YPGH 3SQEE 4KTSA 1THRH 1P12E 2WV4A 1FUJA 3GY2A 4FU7A 2BD4A 4CR5A 3SI3H 1TALA 1QNJA 5EGMA 4B74A 3MQKC 3RXHA 2GZ8A 3NRLA 2ZU1A 3SGAE 1BTXA 4TY7A 1SL3A 4HFPB 1XUFA 2XRCA 1LVBA 1NPMA 2ZI2H 3BTKE 4YOGA 3S7KB 4DW2U 2ZPSA 4E06H 2GMTC 5T6DA 1O38A 4K5ZA 1HIAB 3BTQE 2STBE 3MFJA 1CHOG 2BXUH 3VB6A 2QY0B 1ZOMA 2Q6GA 2WSSD 4JZDH 1HAYB 1CT4E 1DM4B 5J4QA 4D8NA 4AGKA 1EPTB 1NBME 1TABE 5C5NA 1E34B 1G3CA 1TYNA 4GHTA 3N7DA 2VH0A 1GPZA 2A7JA 2ZHWH 3A7ZA 4KTCA 1DOJA 3BIUH 2BVSH 4JMYA 2HNTF 1UO6A 1O2RA 1VITF 5F8XA 1C2LA 2RFKC 1BBRK 2FS8A 1C5YB 3QWCH 1KLTA 1O2VA 2Q6DA 1SFQB 2BQ7B 3V13A 1H9HE 2ZP0H 1AO5A 4TSFD 1HAZB 1K0HA 4NIVA 3RXDA 5C0TA 3SUFA 3S9BA 4K1EA 3ZZAA 4GSOA 1GI7B 5C0UA 3ZZ4A 1ELVA 2EQNA 4UDWH 2FEQH 5GJ4B 1BITA 1GMHF 3GY4A 1C5PA 1YPEH 2IOTA 3TVJB 4BNRA 3LC3A 4NG9H 4Z0KA 6LPRA 1MCVA 2FTLE 3D62A 3Q3XA 4YLQH 4A7IB 1L1JA 4X1RU 2FI5E 3GY6A 1NRSH 1O3HA 1C5VA 2J92A 1SC8U 1QHRB 1EB1H 1H8ED 3A7VA 1IQLA 3MH6A 1C1WH 1K21H 1TPOA 3AK5A 2D2DA 1AD8H 2W6JD 1FN8A 1V2OT 1GVLA 1NU9A 2Y81A 1OXGA 1GI9B 4K69A 4NFFA 1FDPA 4Y0ZE 2Z3CA 4AORA 2QGRA 1Y3VA 3MHWU 4H6TA 2CF8H 1GI4A 3K6YA 2OTVA 2GMTB 2O8LA 1BMMH 3H5CB 1DSUA 1GG6C 4XSKU 1SGQE 1H1BA 5HMAA 2HNTC 3AASA 4B2BA 4B6FA 1MMJN 4X2YA 1TE0A 1QJ7B 1KXFA 2CF9H 3SU3A 1SVPA 1F5RA 1Y3WA 3LT3A 3K9XB 1HJAB 1A3BH 2XC5A 3OE7D 3ZVEA 1UTOA 5EXNA 4YXWD 3HKIB 4ZHLU 2UUYA 1K1JA 1XVOA 2VNTA 4AFQA 1RTFB 3OTPA 4Q80A 1FY3A 2L6OA 4CBNA 1S83A 4FVDA 3SYJA 2AFQB 1O5GH 2OLGA 3T2NA 2G5NA 2EI6A 2A1DB 1S85A 1DFPA 1QJ6B 1T32A 1GI3A 4IC6A 3BG4C 1UVUH 3MO3A 1QB9A 2J98A 4KGAA 2A4RA 1W10U 4FUEA 4I8LA 1MKXK 3V0XA 2F91A 4K60A 4JZIA 2VWMA 1HAGE 4CR9A 1GJ6A 4XE4A 1GBLA 2O8UA 3SU0A 1AFEH 2SGAA 2ZHQH 2FOFA 1O33A 1XUJA 3MNCA 4B75A 1ANDA 3LJJA 1GMHG 2C8ZB 4R8TB 1MBMA 3A8DA 3I77A 1RFNA 3P8OA 3GOVB 5EQSA 8KME2 1C5WB 4X0WU 1SOTA 1QCPA 1P2JA 2VU8E 3STJA 3VG8A 2QF5A 4Q7ZA 1QL7A 1QY6A 1EPTA 1G3EA 1H8HD 2R3YA 2GGVB 1CHOF 1Y59T 4M7GA 2IPQX 4QT8C 1NRPH 4H4FA 2FX6A 4YOIA 3UB0A 7KMEH 1V3XA 4B6EA 5I46H 1LO6A 1FONA 3A83A 2FMJA 1ELDE 3PRBA 1C2FA 3LH3A 2WYGA 1DXPA 1P05A 2BHGA 1V2WT 2TGTA 1GL1A 2PSXA 1SG8B 5EQRA 2ZCLP 3V12A 4UD9H 4TPIZ 2BZ6H 3PTNA 3F2GA 2AMPA 3MNSA 1LMWB 1NZQH 1TIOA 1EB2A 1QB1A 1FIWA 1C5TA 3RXAA 3STIA 1DT2A 5JB9S 2ZCKP 1TNGA 1ZGIA 2ZGJA 4JK6A 1O2KA 1EZSC 1W7XH 3SU5A 1K22H 1F0RA 1NESE 1SGRE 1MH0A 2G55A 2CV3A 3FO8D 3O8CA 1TGBA 2BLVA 2V3OH 1P04A 1AKSA 2BDGA 2BTCE 1UVTH 2A4QA 5DP5A 1CBWC 2XCNA 2FYQA 4Q7XA 3SW2B 1B7XB 1C5XB 1LVYA 2Q6FA 1TMBH 2OC8A 1C9PA 3LGIA 1K1NA 3RXOA 3RU4T 2FPZA 5EPNA 2EC9H 2BD5A 1UJ1A 6GCHF 4Y10E 1G2LA 4MNYA 4XDEA 3ZZCA 1O31A 2GDEH 1ID5H 1Z8JB 2F3CE 2ODQA 1RGQA 5JDUB 2F9PA 4Y8ZA 4IGDA 4NA7A 1HCGA 1PQ8A 1UCYE 3UWIA 4ABHA 1VCQA 1SLXB 7ESTE 4ISNA 2BQ6B 1LQEA 2GT7A 3S9CA 4O97A 5F03A 3M5MA 1GBTA 1KY9A 1MTVA 1T4UH 1V2QT 2FDAA 1J8AA 5HGGA 1PQ5A 4IMQA 4AB8A 3D49H 3GY3A 3RXTA 1F0UA 4X1SU 4YM9A 2OK5A 3UR6A 3KEEA 2BD2A 1VITH 1JIMA 1O32A 3RXPA 2KR7A 1FY8E 2ZGHA 5FAHA 5FHTA 2ANWA 2ZDMA 4TWYA 3GCNA 3Q76A 4ASUD 3LC5A 1TOCB 2ZWLH 1C2IA 1TNJA 1H8DH 2CHAB 5HKKD 4HGCA 5A0AE 1EAUA 5FPSA 5A8YA 1T8NA 2Z3DA 1IQMA 4LZ1H 2PW8H 4YZUA 5EPYA 2VJ1A 2OINA 1GHBF 1U6QA 1UTKA 2D8WA 1UVPA 2A31A 1PPCE 2NU2E 4B2CA 1HNEE 1YPMH 1C1RA 4I8KA 3T25A 2XC4A 3T29A 1FPCH 2GP9B 3ZZ9A 3SQHE 4DT4A 5HYOA 3DHKH 3GDUA 2G8TA 3KYGA 5H4IB 4J1YA 3JZ2B 2EA3A 2VWNA 2C3SA 1XX9A 4B76A 3EE7A 1C4U2 1C1MA 1S6HA 1P2IA 2BY5X 2XC0A 1N8OC 3GYMA 2GTBA 3PTBA 1TGSZ 2SNWA 3P95A 4U30A 3U8RH 2BD7A 1O2HA 2VIDA 2ZF0H 4IW4E 3SJ8A 1ELEE 1S84A 3SJOA 4Q4LA 1HLTH 4WY3A 3RMOH 4MQAA 2H1UA 1GJ9B 2FS9A 3ZYDA 1ELBA 1SGFA 4Y8YA 4XBDA 2F83A 1BJVA 3OTJE 4H42U 2ZZUH 1A0HB 1LHGH 4O3TA 4OS5A 4AFZA 1TQ0B 2ZNKH 2XBYA 4Y8XA 3ZZ8A 1G30B 1EJMA 1C2GA 4WXIA 3UAIC 3ZVBA 4ABJA 2FOMB 1DX5M 1K1MA 1A61H 4YLUA 2NU0E 2G51A 4DVAU 2FODA 1IQIA 4GPGA 3BG4B 4F4OC 3UQOA 1LQDB 4U01A 2WV9A 3F1SB 3TGIE 1YLDA 4CBOA 5GPIB 1W0ZU 4A1TA 4X8TH 2DE9A 3QDZB 1ZTJA 3VXFH 2BB4A 2BY6X 1OS8A 5C5OA 1GCTC 3F2FA 1F92A 5E0JA 1UTMA 5EW2H 1QTFA 2XWAA 3GCHC 2BYAX 3DSOA 1WTHD 2VIPA 3A87A 1XXDA 5GIBA 1OSSA 1TFXA 4OGXA 2J4IA 5C1UA 2Y5GA 1DE7H 1GBBA 1YPKH 4WH6A 5F53A 5GDSH 4X2VA 3BTFE 1FY1A 3RXVA 2FM2A 4DOQA 3EGKH 3VEQB 3F3BA 1L1GA 5F8ZA 1VKYA 2QYIA 1UTQA 2J97A 3LPRA 4M9FA 1D3DB 1GBIA 2BXTH 5FCKA 4ZXYH 1ELAA 1MAYA 1QBVH 3UQVA 3T26A 1EZXC 1SQTA 3VPKA 4B71A 1JXPA 1YLCA 1P01A 2KM0A 1TBQH 2IJOB 1Z7KA 1SGIB 2G00A 2G52A 5E0GA 2H9HA 2ZHEH 3RM2H 1A3EH 3SNBA 5F8TA 4KTUA 1O3IA 1QA0A 3A8CA 1YWUA 2Z6BD 1HAHH 1NFXA 1THPB 4O03A 1O3NA 5A0BA 6CHAC 2GZ7A 4ABAA 1KLIH 1LKBA 3FANA 2ZU2A 3FAOA 4ZMAH 2KFWA 1GDQA 1GDUA 2JETC 4ASHA 2PKAA 1D3TB 1OPHB 3WW7A 4OM9A 2HOBA 3SJIA 3QZQA 1ESTA 4DG4A 1A4WH 3U28C 1CU1A 3M37A 2QF4A 5A8XA 2CXVA 2ZU5A 4JYUH 1C1VH 2J9NA 1Z6EA 3V7TA 1BJUA 1AMHA 1GBCA 3RU4E 3U8TH 1N1LA 1HPGA 1GMDG 1YKTA 2K1QA 4Z6AH 2NU1E 4BAMB 3RC5A 3SU2A 4NIYA 3M3SA 4ZH8A 2G4UA 1MD7A 3P6ZB 2VIQA 3NCLA 2A5KA 3GCHB 1RXPA 1EFRD 2I6SA 4JYTA 3BN9A 1A1RA 1LTOA 1GBJA 1TX7A 1K1LA 1ZMNA 2FO9A 2Y82A 3RUOA 1NU7B 2OP9A 3QZRA 3SOSA 1C1OA 2A2XH 1CT2E 1DANH 1NC6A 3RXCA 1C5ZB 3M35A 1YGCH 2RDLA 2KCAA 3R3GB 4P00A 1GJ4H 1NN6A 2JH5D 1SGEE 4KELA 3SV7A 4ABIA 3M5LA 4AFSA 4LK4A 4CRBA 1TPPA 2OBQA 1NS3A 3BG8A 1SMFE 2PP6A 2ZFTA 1ZPZA 3UWJH 2RCEA 3H7TA 5C1YA 1XXFA 3MNXA 4BAOB 1P02A 5GNDA 3TGJE 1IOEA 1C1TA 2ESTE 2G4TA 3FOAA 3ITIA 3MI4A 1BBRH 1AFQC 2J98B 4ACAA 4YT7H 2AH4X 3MH5A 2QCYA 5JPMH 3PROA 1X7AC 4WMDA 2FI4E 3TH3H 3VB3A 1B0EA 1PYTD 1PPHE 4J2YB 1C5RA 3ZZ6A 3VB5A 2FZZA 1ZTKA 3ZVFA 2C4FH 3CENA 4GCHG 1UMAH 2ZQ2A 1AWFH 1BHXB 3LONA 3MO9A 2BX4A 4ZXXH 5JBAS 1ETSH 1HXFH 2A4GA 4MPUA 1HB0B 2B9LA 1GJCB 3GS9A 3PYHA 2NWNA 1L1NA 3RXQA 4ZHAA 1GWAA 1P9UA 1D3PB 1O35A 1MKXH 3SNEA 2WPIS 2WPHS 4WF8A 1SPJA 2FOAA 1GGDC 3RC4A 4AB9A 2CMYA 1TRYA 4DIIH 1O2IA 1V2KT 1O3CA 1HAOH 2A4OA 1BUIA 4JYVH 3BTHE 3GCTF 4AC9A 1W2KH 2PTCE 3O8BA 2GCHG 3PWBA 1DS2E 2ZEBA 1V2JT 3OYPA 2AMQA 1TOMH 5ETXA 1C2HA 1P09A 5FL7D 3I78A 3RLWH 2VWLA 1ZMJA 2THFB 5CE1A 1QJ1B 2GV6A 1C5NH 1TQ7B 1Q2WA 4CHAB 3Q77A 1ZHMA 2ZC9H 3AAVA 5DK1A 3UY9A 2H2ZA 3FP6E 1GJ8B 1F7ZA 4ISHH 5LH8A 2AYWA 1SGDE 1AU8A 3L6PA 2XBXA 4SGBE 3DT0H 1O34A 3DA9B 2Y5FA 2GD4B 2P3TB 1LHFH 2XBVA 1YLNA 1A0JA 1DWDH 1P3EA 2HWLB 2P8OC 3KNXA 3MU5A 1D4PB 1COWD 5FX5A 1J9CH 2HLDD 1NFWA 1CQQA 3MO6A 4ABFA 9ESTA 3A86A 1KXCA 4MTBA 1RD3B 3RMLH 1C4Y2 1WAYB 4CRDA 2HGTH 4TT3D 3TITA 2G5VA 3QGJA 1RIWC 2V0BA 3MH4A 1LVOA 3UPEA 1BHXF 1JBUH 1C1PA 1Y3YA 3I29A 3M5OA 2B0FA 1HBTH 1YY3A 1C1UH 3NWUA 1A5IA 2BD3A 1MQ5A 2M2AA 1V2VT 2BVXH 4I86A 1O37A 1MTNB 1GI2A 2BY9X 1LCYA 1XUKA 3TJOA 3OEHD 3S9AA 1TBZH 3BTGE 3SU4A 1MQ6A 4NIXA 3PM3A 4INLA 3ODDA 1IQHA 1EPTC 2V35A 3CS7A 3Q3YA 3OSYA 1KXAA 4FXGH 2AGGX 1VGCC 1VJAU 2P95A 1HFDA 3IITA 4BOHA 3QX5H 2KCPA 5B6LA 1Y5UT 3D23A 4NSYA 4R0IA 5L6NH 1M9UA 2UWOA 3CS0A 2R0LA 1TRNA 1WQVH 1HAIH 1OWJA 3GDVA 2ZGCA 1GJ7B 1EOJA 4OS4A 4X2XA 1GHXH 3PB1E 1O30A 2ULLA 1Y5BT 2ASUB 3T5FH 1XMNB 2AMDA 5L2ZH 1Y3UA 5C20A 3U9AH 1SI5H 2OXSA 1EASA 1BMAA 3GY5A 1GBDA 1N6XA 1F0SA 1FQ3A 2GT8A 1RTLA 3A7YA 1QIXB 5DP7A 1UVSH 3TJVA 1KMHB 3T28A 3URCA 4UE7H 2CGAA 2UUJB 2ZHDA 1BMNH 2VWOA 3F0PA 4DJZB 1C2KA 2JJ1D 1EX3A 2BMGB 2BX3A 4FUJA 1QRWA 3PMBB 4Y7BA 4XD7D 1YCPM 3OEED 3N7EA 1O0DH 2W3IA 2FESH 1PQ7A 3K65B 1C2JA 2A5AA 2BD8A 2XOKD 2WV5A 1G9IE 4ZKRU 3VXEH 2XWBI 1O36A 1AVGH 3N7OA 2F9VA 1DICA 1JMOH 1DWBH 2C8XB 1QURH 2BY7X 1XVMA 3SZEA 1QQUA 3PMAB 1XUGA 2QXHA 1G3BA 2HALA 3ZZDA 1OWKA 3MH7A 1GHWH 2TPIZ 1SQAA 1EOLA 4ABEA 1DWEH 2V7QD 1EATA 2H5DA 4OS7A 3LU9B 3A8BA 1ZHRA 2FOHA 1AKSB 2CN0H 5HM2A 1ARBA 1GBKA 1C5MD 1ZYOA 2ZU4A 5T3HA 2P3UB 2J5UA 3RMNH 1W7GH 1WDIA 4X1QU 1HUTH 1A5GH 1O5EH 4BAKB 4YOJA 1VGCB 4TYDA 4JZEH 1OYQA 3ZZ5A 5LPRA 2OC1A 1HGTH 5CHAB 3FP8E 3ZZ3A 1B0FA 1C2MA 3SJKA 2EY4C 2VBCA 3TJUA 3UNSA 4HTCH 4A1XA 4AX9H 3DSGA 1C9TA 5EIYA 4P02A 3DUXH 2RA3A 1GVKB 1AVXA 1VJ9U 5C94A 1OHHD 2B7DH 1XKAC 1AN1E 1WSSH 1V2NT 2QC2A 2J34A 4ISOA 1MZDA 4X1NU 3PRDA 3BV9B 3E1XB 4WVPE 4AG1A 1DUAA 4JCNA 1C1SA 3LGUA 3SN8A 1S0RA 4D9QA 2Y7ZA 2YMSC 4TWWA 4BTUB 2GDDA 3W95A 3ENSB 5DO4H 3GDSA 1KTTB 1ACBE 3QTOH 2V3HH 1O5AB 3UFAA 1FAXA 1GHYH 1IQNA 4KKDA 3M5NA 5C3NA 1D6RA 1HJ9A 1TNHA 1E1RD 4Y79A 1QBNA 1TRMA 1YPJH 3TU7H 3CNRA 4IS5A 4E7NA 3ZV9A 4UONA 4AG2A 2QXGA 3RLYH 1YC0A 5KEDA 1ZR0A 1C5SA 2H9EH 1CA0C 5K0HA 1TMTH 1PPBH 4YTAA 3SGBE 3ZVCA 1ELCA 2AERH 1Z8IB 5AFZH 1O3GA 3TJNA 1YBWA 2P3FH 1FXYA 2OC7A 3SUDA 1W8BH 2OD3B 2ZECA 1OP0A 2Z9IA 3KQEA 5JBTA 4Q2KA 1JIRA 1K9OE 5TJXA 1H8IH 1QBOA 1V2ST 3NPSA 1TAWA 1PFXC 1L4ZA 4NWKA 5T6GA 1P10A 4U2WA 2PTNA 3M7QA 3SNDA 3KYFA 4MPXA 4IC5A 1W3CA 1O3OA 3FKSD 3RP2A 1LHDH 4WH8A 1DLEA 1P2QA 5AVDA 1T4VH 1UCYK 3U1IB 2JJ2D 1JRSA 3BTEE 2W7UA 3Q3KA 1TPSA 3BTME 2FLBH 1ZSJA 3RXGA 5LPEA 3E90B 3SO3A 2TRMA 2A32A 3QLPH 1CA0B 2QN5T 1DWCH 1EZUC 1WYKA 1C2DA 4A5TS 3OX7U 4DURA 2BDIA 1GI1A 4I8JA 2SGFE 2P94A 1FX0B 3A80A 5DP9A 5DSFA 4K2YA 2IN2A 1QL8A 3G01A 5DJ7A 1BRUP 1CT0E 1O5BB 4FUBA 5E2PA 3RC6A 5A8ZA 4I8HA 2JKHA 2FXRA 4XBCA 3ZYEA 2SGQE 2AGIX 5FPTA 1BMFD 2BOKA 3B9FH 1QRZA 1T8MA 2VH6A 1Z6JH 2I6QA 1G37A 2GKVE 2P93A 2Y80A 4I8GA 5J4SA 3KHVA 3RXSA 2PWXA 4FUCA 1FV9A 2PKAB 4Y76A 1OWHA 3LKWA 3NUMA 1T7CA 3E16B 3H09A 1A5HA 1DPOA 1ELTA 4UFGH 1FZZA 4OS1A 1YP9A 1E0FD 4IN1A 1C4V2 3GY8A 2ZTZA 4RI0A 3P17H 6GCHG 1YM0A 4O3UA 3BF6H 2ZA5A 1SQOA 3SNAA 2V3MA 4MDSA 1E79D 1AUTC 2F4LA 2PHBA 1BRBE 1ZPBA 4D9RA 8LPRA 2VGCC 2IPHA 4FUDA 1Y8TA 2ZDNA 4D76A 4YESB 1MUEB 4FUIA 1BTYA 4X1PU 1PPZA 1ZZZA 1LHCH 3PO1B 3SORA 1YPLH 2PLXA 2KAIA 3EE0B 1CE5A 2OQ5A 3F9GA 3LGTA 1FNIA 3U8OH 1HIAA 1SGNE 1T31A 1MCTA 4U32A 1O3FA 1Z71A 5A2MH 2P16A 1GJAB 2K0QA 1SFIA 2BQWB 3W1EA 1BOQA 1GJBB 4F48B 1EAIA 2TGAA 3WWFA 3FFGA 4HG6A 2NU3E 4LXBH 1OWDA 2O8MA 1MD8A 1MTSA 2RDEA 1L2EA 1GHAG 2HPPH 5SGAE 1QQ4A 4CH2B 1TBRH 3CP7A 4A1VA 4B73A 1EZQA 4D7GA 3EA9A 1WBGB 3KN2A 4HZHA 4YT6H 1C1NA 3O8RA 1O3KA 3OU0A 2ZGBH 3PV2A 3BEFB 1IHSH 1UHBA 2BDCA 2JIZD 3DFJA 5IYTA 5DKMA 3A8AA 5F6MA 2QE7D 1BTWA 2LPRA 1O2LA 3ATIA 3TNSA 1P2NA 5CHAC 5C1XA 4CRGA 4AZ2B 3EDXB 6CHAB 2BOHB 4I7YH 5HM9A 2A7CA 3P8GA 1NRQH 3U98H 3ZVDA 1LVMA 4A6LA 4IN2A 1EAXA 1Y3XA 3VB4A 1TLDA 4AYYB 2YMSD 1ZSKA 1F0TA 4UFFH 4A92A 1YPHC 1EKBB 1E38B 2KAIB 1WTGH 1SGYE 3SUGA 1BRAA 2C90B 1KDQB 4MVNA 4GHQA 3FP7E 1DXWA 1OKXA 2LELA 3P92A 2W7SA 4BXSA 2XNIA 3A89A 4ZKSU 1PPGE 2BLWA 2V6NA 3BTWE 1GI0A 4Y11E 3ESTA 1GBEA 2W6ID 3M7TA 2VGCB 5EG4A 3IWMA 1VCPA 3OY6U 2ZU3A 2BZAA 3F9HA 2QF0A 4FU9A 2BLQA 1O39A 3ZIAD 3F9FA 5C67A 3T27A 2BD9A 2F9OA 2SGEE 3URDA 1C5OH 3KQ5A 1K28D 1O3LA 3A84A 1G32B 3HATH 1WUNH 4F55A 5LPFA 4CH8B 1GHVH 4FU8A 1GVZA 3KQCA 8GCHG 3MYWA 3BEIB 1O2JA 1PPEE 5FX6A 4AFUA 1EJAA 1FIZA 4THNH 1A7SA 1QRXA 4IBLH 2QXIA 2B8OH 1JRTA 3U69H 3UOUA 9LPRA 1O2TA 4F49A 1ORFA 2C8WB 2R2MB 7GCHF 4TPYA 5DPAA 4I33A 1EP5A 5EJLA 3RXJA 4CRAA 2ODPA 1SOZA 1AQ7A 1XKBC 1GMCF 5CDFE 2HLCA 4IMZA 4INKA 1FI8A 3B8JA 5A09A 1KXDA 1FJSA 1AB9B 1RJXB 1O2OA 1OP2A 4K8BA 2VVUA 5JB8S 1EP6A 1RTKA 3SV2H 1P03A 1Q31A 2VINA 4NZQA 1A46H 2QF3A 1RIWB 4JK5A 3PLPA 3HK6B 2W3KA 5JBBS 1MTWA 2SGDE 2A5IA 1TONA 2F9BH 1MAXA 3BEUA 3SV8A 1O2NA 4UFEH 4VGCB 1LKAA 1GI5A 1PYTC 2ZFPH 3VB7A 3E91A 1LPZB 1BRCE 2CJIA 3E0NB 1FY4A 4RN6A 5DP3A 2XYAA 5K7RA 1F5KU 2ZFFH 5DG6A 1FY5A 2JDID 4KP0A 1AFQB 1HAXB 4ZKNU 2R9PA 1HAVA 3PWCA 1NFYA 3RXKA 1V2PT 2GJGA 4ABDA 1EUFA 1KSNA 5E8EH 1LPKB 3A81A 1OWIA 2AIQA 2EEKA 3QUMP 3P8FA 3SU6A 3V3MA 4E7RG 1CHGA 4AGJA 2Z94A 1N6YA 3E6PH 1EQ9A 1GHBG 4NFEA 1TA2A 1ETRH 2O8TA 3RXFA 4DIHH 4XFQA 4DCDA 4X6PA 3AAUA 1V6DA 1QR3E 4ZAEA 2L74A 2QXJA 1UK2A 4DY7B 2ZKSA 1ANEA 1O2UA 1Z1IA 5ABWA 1BTPA 4GCHF 3MU1A 3DSPA 3LDXH 3E0PB 5E2OA 2H6MA 1MZAA 3KIDU 1V2TT 1L0ZA 1ELGA 1IHTH 4ESTE 3GYLB 2RG3A 2QIQA 3A7XA 1ETTH 1HYLA 3GISB 1K2I1 4I31A 2PUQH 2JH0D 4BTTB 3PV5A 4GLYA 3DD2H 4RKJB 2GCHF 2YNBA 1TNIA 1GGDB 3SV9A 1HRTH 3N99A 3RXBA 3OFND 1QB6A 3C1KA 1ZHPA 2ODYB 3RXUA 3MWIU 3GCOA 5FBIA 1E1QD 1O3BA 1HAPH 1SHHB 3TH4H 3GICB 2WPLS 1O3JA 2WHXA 4INHA 2Z3EA 3LJOA 4Q7YA 1NO9H 1TGTA 1SQRA 1K1IA 5JBCS 1BTUA 3ZVGA 2P59A 1UK4A 2ZTXA 3A82A 3S7HB 2TGPZ 3RMMH 2ZGXH 3D65E 4NIWA 2PKSB 2W26A 2XTTB 4CRFA 1GCDA 3FZZA 3K2UA 4B2AA 1CGHA 4ABBA 1YCPK 2AGEX 1LHEH 5HXFA 1AGJA 3S0NA 4B1TA 4FETA 5L30H 4AYVB 5IK2D 1ANCA 4JZFH 1MTNC 2UUKB 2Z9GA 1C5LH 4K8YA 4HI3A 2AS9A 1AY6H 1O2PA 2ZIQH 2Z7FE 1DDJA 1HXEH 1JOUB 2XW9A 3KGPA 2R0KA 4LOYH 1SGCA 2FLRH 3RXLA 4OS6A 3OAAD 4PROA 5E0HA 4RT0A 4WJG2 1ABIH 5G4BA 3KL6A 1UVOA 1HAVB 1PPFE 4X8UH 1TGNA 5TCCA 1O2SA 1FLEE 3AW1A 1BZXE 2ALPA 3ATLA 3KQBA 1INCA 4BAQB 3MNBA 2AHME 3SU1A 1SLVB 1FMGA 2FYRA 2GCTB 2ILNA 3C27B 1G2MA 4NGAH 3GY7A 4XRNA 4ABGA 2CHAC 1NBMD 1W0KD 3KQDA 1WQSA 4GAWA 1O5DH 1NTPA 1E35B 2GV7A 2GVFA 1WOFA 3M3VA 1D9IA 1V2LT 1CGIE 4FUFA 1IQJA 4X6OA 4UEHH 1UTJA 3VFEA 2HVXA 4BANB 1J15A 4X8VH 1GBAA 2GX4A 3QN7A 1ZJKA 1O2GH 2WUBA 1KXEA 1YF4A 5EQQA 1IQEA 1XUIA 2NU4E 3S69A 1KDQA 1GBFA 1YPHE 3NXPA 4BXWA 1T8OA 3O8DA 4RSPA 1DY8A 4LZ4B 2DUCA 3TPIZ 8GCHF 1KIGH 5C17A 1XUHA 1O3AA 1G36A 1GCTB 1TNLA 1GJDB 3IG6B 3UNRA 1WCZA 1HDTH 1ZLRA 3EA7A 3MU4A 2WPMS 1AZZA 2ZPQA 3L3TA 2ALVA 2PR3A 1ZPCA 3TLOA 2SNVA 1P3CA 2J94A 1EJNA 1GDNA 1P9SA 1W0JD 1NT1A 1GL0E 1BTHH 1OOKB 3LGYA 3BTTE 2ZO3H 2OC0A 3TH2H 1T8LA 1NRRH 2Q1JA 1BQYA 4DT7B 2BDAA 3QK1A 1NRNH 1IQFA 4X6MA 1GMCG 5ESTE 2M5TA 1Z1JA 1LDTT 1O2MA 1SKYE 1TA6A 2Y7XA 3KF2A 1K1OA 3UTUH 4ZHMU 2F43B 2D1JA 3SGQE 3SZNA 4NZLA 4X2WA 1H9LB 1W0YH 1J14A 1C5QA 2J2UA 2DE8A 4ISIH 1O3PB 1E37B 1SGPE 2FOCA 3NK8A 6ESTA 1S0QA 2KZ4A 2HVYB 1MABB 2O8WA 2UWLA 1VR1H 2ZFRH 3DFLA 1DVAH 3PMHB 1L4DA 4ZROA 1BBRE 1V2UT 1S81A 2XCFA 1P06A 1QGFA 1H4WA 2EI7A 3ZV8A 1DSTA 7GCHG 2PUXB 3PLBA 3M3TA 4MPWA 1SSXA 3TK5A 1HJ8A 1THSH 1KLJH 4MG3A 2ZDKA 1OYTH 2C8YB 3RU4D 2H9TH 4ISLA 3MTYA 4K3JA 1PQAA 1UHBB 3LOXA 1Z8RA 2PSYA 5BPEA 1GBMA 2FP7B 3QTVH 4WWYA 4GVUA 2W5EA 1K1PA 5GXPA 2XBWA 1ZJDA 3FZDA 2ANMH 1TB6H 1Z8GA 5EXMA 1UCYH 1UTNA 2FX4A 1P8VC 2EI8A 2VIWA 3VGCB 2BDYA 2VVCA 3PMJA 1ELFA 2LNCA 1S5SA 2VVVA 1NM6A 3LH1A 1LPGB 3SBKA 1ARCA 2P8OB 1P0SH 1S6FA 3F0OA 5KGOA 1KYNA 1NY22 1TX6A 2F9UA 2OQUA 3ATKA 2ZCHP 1VCWA 3H7OA 4ZKOU 1BCUH 3U1JB 2KX4A 1SBWA 5DGJA 1VZQH 3TK6A 1J17T 1AI8H 3HKJB 1O3DA 3UNQA 3ZZBA 4WMFA 1O5CB 1N8OB 2ANYA 5AF9H 1ABJH 4SGAE 4H6SB 1ESAA 1Y5AT 5GCHF 1BB0B 2AEIH 4I32A 1QFKH 1V2RT 2LP6A 1UTPA 1P2MA 1ZTLA 3JZ1B 4BAHB 2HNTE 1J16A 3EA8A 3QGNB 1OX1A 3RXIA 1W13U 3F68H 1ZGVA 1QA7A 2BLOA 2STAE 2Y6TA 5JYIA 4MNVA 3EAJA 3L33A 3VGCC 2WPKS 1O2ZA
chains in the Genus database with same CATH topology
2UWPA 1UK3A 4XBBA 2VB0A 1EXFA 4NCYA 5IDKA 2F9NA 1SLWB 2YOLA 1AE8H 3WY8A 2BDHA 1AVWA 5A0CA 1FPHH 1FAKH 1KTSB 1CBWB 1P2KA 4MLFB 3SV6A 1GHZA 1BT7A 1RRKA 2ZQ1A 1TGCA 3P8NA 3P70B 5EW1H 2FOGA 5FBEA 2A45B 2RA0A 3M36A 2Z9JA 3OY5U 2OCVB 2VIVA 5DP4A 1ZMLA 5ESBA 4Y71A 8ESTE 3R0FA 4Y6DA 1AIXH 1A2CH 1YYY1 1TWXB 3MU8A 2PGBB 1W12U 1F2SE 1SGTA 2ZG0H 3PLKA 1S82A 4OS2A 1E36B 2OBOA 1BDAA 1CVWH 2WPJS 1O3EA 1MKWH 2FOBA 5C2ZA 4Y0YE 1P57B 3M7UA 3MU0A 1AZ8A 1XM1A 2JH6D 1JWTA 3A85A 3E8LA 3RDZA 1Q3XA 2FWWA 3TNTA 5CMXH 2BVRH 2FOEA 1SLUB 3HPTB 3A7WA 3ATMA 3GCTG 1C2EA 4FVBA 2GZ9A 1AWHB 3Q00A 5AHGH 5EXLA 2A0QB 4AOQA 2R3UA 5EOKA 1ZSLA 4K1TA 1CSOE 2ZTYA 1D3QB 1O2XA 1B5GH 1GG6B 2R2WU 3BSQA 3HK3B 1EAWA 5FPYA 1PJPA 5GCHG 3TGKE 2FI3E 1V2MT 3MOCA 5DP6A 4YO9A 5I25A 3UREA 2ZDAH 1O3MA 1AHTH 5FXLA 1MTUA 1ANBA 1UTLM 4Y7AA 1ESBA 2QA9E 2TBSA 2UUFB 3BTDE 3NKKA 4VGCC 2QAAA 3ZVAA 1MU6B 2C93B 1O5FH 5B6OA 4CHAC 1SR5C 1P11E 3F9EA 2D26C 1GMDF 1ZRBA 5GWZA 1RS0A 2FTMA 3SHCH 1GI6A 1AB9C 1MKWK 1NFUA 3PV4A 3PO1C 1DY9A 1SHYA 1O2WA 2JETB 3SJ9A 2BDBA 4X8SH 4XOJA 1HJAC 2WUCA 3UIRA 4FUGA 5FCRA 1TNKA 1O2QA 4OGYA 1NROH 2TGDA 1SB1H 3RM0H 2YNAA 3F6UH 1DITH 1IQKA 1O2YA 2WYJA 4NWLA 1TMUH 2ZFQH 3KCGH 3UR9A 5PTPA 1GJ5H 2VIOA 1BIOA 1GHAF 2HRVA 1BMLA 1C1QA 1GI8B 3LGWA 3QO6A 3ZZ7A 3E3TA 1W11U 2A2QH 3RXEA 3B23B 4O9VA 1OWEA 3A88A 1CA8B 1D6WA 1AUJA 4UFDH 2AIPA 3ODFA 1SGFG 2BM2A 4BTIB 3EYDA 1C5UA 1W14U 3LGVA 5TCAA 3TK9A 3M61U 4TY6A 2O9QA 1OP8A 3FVFB 4NA9H 2ZDLA 2XXLA 2HPQH 2ZPRA 1WU1A 1DLKB 2SGPE 2PV9B 2Z9KA 3HGPA 3ELAH 4AN7A 4FUHA 5L2YH 1KXBA 1DUEA 4DGJA 7LPRA 2ZHFH 4ZUHA 3ATWA 2ZDVH 2ANKH 1MBQA 4X6NA 1FN6A 2WINI 2TIOA 5LGOA 3LIWA 5EU8A 2H5CA 1F5LA 3SHAH 2BY8X 3RXRA 3SI4H 2QV1A 5EODA 1TX8A 2J95A 4MNXA 1VITG 3W94A 1IAUA 4NA8A 3NZIA 2PGQB 1AE5A 2Z9LA 3A7TA 1QL9A 3AVZA 5T6FA 3SNCA 3SUEA 4WXVA 3EQ0H 3HGNA 3BIVH 1GBHA 4K1SA 4GUXA 1BA8B 4MNWA 4E05H 2SFAA 3T62A 4D7FA 2Y5HA 3K6ZA 3TIUA 3MMGA 1A0LA 5DP8A 2G81E 4CREA 2ZFSA 4CRCA 4JZ1A 2A7HA 2OUAA 1CGJE 4RKOB 1CO7E 1BTZA 4MPVA 4WMEA 3UOPA 1G3DA 2PKSC 1TPAE 2PFEA 1ZRKA 5AFYH 5BRRE 3AW0A 1MU8B 1P2OA 2J38A 3UUZA 1WV7H 1YCPH 1H9IE 2GCTC 2B5TB 4NSVA 2FIRH 1IQGA 3RXMA 1HV7A 1YPGH 3SQEE 4KTSA 1THRH 1P12E 2WV4A 1FUJA 3GY2A 4FU7A 2BD4A 4CR5A 3SI3H 1TALA 1QNJA 5EGMA 4B74A 3RXHA 2GZ8A 2ZU1A 3SGAE 1BTXA 4TY7A 1SL3A 4HFPB 1XUFA 2XRCA 1LVBA 1NPMA 2ZI2H 3BTKE 4YOGA 3S7KB 4DW2U 2ZPSA 4E06H 2GMTC 5T6DA 1O38A 4K5ZA 1HIAB 3BTQE 2STBE 3MFJA 1CHOG 2BXUH 3VB6A 2QY0B 1ZOMA 2Q6GA 4JZDH 1HAYB 1CT4E 1DM4B 5J4QA 4D8NA 4AGKA 1EPTB 1TABE 5C5NA 1E34B 1G3CA 1TYNA 4GHTA 2VH0A 1GPZA 2A7JA 2ZHWH 3A7ZA 4KTCA 1DOJA 3BIUH 2BVSH 4JMYA 2HNTF 1UO6A 1O2RA 1VITF 5F8XA 1C2LA 1BBRK 2FS8A 1C5YB 3QWCH 1KLTA 1O2VA 2Q6DA 1SFQB 2BQ7B 3V13A 1H9HE 2ZP0H 1AO5A 1HAZB 4NIVA 3RXDA 3SUFA 3S9BA 4K1EA 3ZZAA 4GSOA 1GI7B 3ZZ4A 1ELVA 4UDWH 2FEQH 5GJ4B 1BITA 1GMHF 3GY4A 1C5PA 1YPEH 2IOTA 3TVJB 4BNRA 3LC3A 4NG9H 4Z0KA 6LPRA 1MCVA 2FTLE 3D62A 3Q3XA 4YLQH 4A7IB 1L1JA 4X1RU 2FI5E 3GY6A 1NRSH 1O3HA 1C5VA 2J92A 1SC8U 1QHRB 1EB1H 3A7VA 1IQLA 3MH6A 1C1WH 1K21H 1TPOA 2D2DA 1AD8H 1FN8A 1V2OT 1GVLA 1NU9A 2Y81A 1OXGA 1GI9B 4K69A 4NFFA 1FDPA 4Y0ZE 2Z3CA 4AORA 2QGRA 1Y3VA 3MHWU 4H6TA 2CF8H 1GI4A 3K6YA 2OTVA 2GMTB 2O8LA 1BMMH 3H5CB 1DSUA 1GG6C 4XSKU 1SGQE 1H1BA 5HMAA 2HNTC 3AASA 4B2BA 1MMJN 4X2YA 1TE0A 1QJ7B 1KXFA 2CF9H 3SU3A 1SVPA 1F5RA 1Y3WA 3LT3A 3K9XB 1HJAB 1A3BH 2XC5A 3ZVEA 1UTOA 5EXNA 3HKIB 4ZHLU 2UUYA 1K1JA 1XVOA 2VNTA 4AFQA 1RTFB 4Q80A 1FY3A 4CBNA 1S83A 4FVDA 2AFQB 1O5GH 2OLGA 3T2NA 2G5NA 2EI6A 2A1DB 1S85A 1DFPA 1QJ6B 1T32A 1GI3A 4IC6A 3BG4C 1UVUH 3MO3A 1QB9A 4KGAA 2A4RA 1W10U 4FUEA 4I8LA 1MKXK 3V0XA 2F91A 4K60A 4JZIA 2VWMA 1HAGE 4CR9A 1GJ6A 4XE4A 1GBLA 2O8UA 3SU0A 1AFEH 2SGAA 2ZHQH 2FOFA 1O33A 1XUJA 3MNCA 4B75A 1ANDA 3LJJA 1GMHG 2C8ZB 4R8TB 1MBMA 3A8DA 3I77A 1RFNA 3P8OA 3GOVB 5EQSA 8KME2 1C5WB 4X0WU 1SOTA 1QCPA 1P2JA 2VU8E 3STJA 4Q7ZA 1QL7A 1QY6A 1EPTA 1G3EA 2R3YA 2GGVB 1CHOF 1Y59T 4M7GA 4QT8C 1NRPH 4H4FA 2FX6A 4YOIA 7KMEH 1V3XA 5I46H 1LO6A 1FONA 3A83A 2FMJA 1ELDE 1C2FA 3LH3A 2WYGA 1DXPA 1P05A 2BHGA 1V2WT 2TGTA 1GL1A 2PSXA 1SG8B 5EQRA 2ZCLP 3V12A 4UD9H 4TPIZ 2BZ6H 3PTNA 2AMPA 3MNSA 1LMWB 1NZQH 1TIOA 1EB2A 1QB1A 1FIWA 1C5TA 3RXAA 3STIA 1DT2A 5JB9S 2ZCKP 1TNGA 1ZGIA 2ZGJA 4JK6A 1O2KA 1EZSC 1W7XH 3SU5A 1K22H 1F0RA 1NESE 1SGRE 1MH0A 2G55A 2CV3A 3O8CA 1TGBA 2BLVA 2V3OH 1P04A 1AKSA 2BDGA 2BTCE 1UVTH 2A4QA 5DP5A 1CBWC 2XCNA 2FYQA 4Q7XA 3SW2B 1B7XB 1C5XB 1LVYA 2Q6FA 1TMBH 2OC8A 1C9PA 3LGIA 1K1NA 3RXOA 3RU4T 2FPZA 5EPNA 2EC9H 2BD5A 1UJ1A 6GCHF 4Y10E 1G2LA 4MNYA 4XDEA 3ZZCA 1O31A 2GDEH 1ID5H 1Z8JB 2F3CE 2ODQA 1RGQA 5JDUB 2F9PA 4Y8ZA 4IGDA 4NA7A 1HCGA 1PQ8A 1UCYE 3UWIA 4ABHA 1VCQA 1SLXB 7ESTE 4ISNA 2BQ6B 1LQEA 2GT7A 3S9CA 4O97A 5F03A 3M5MA 1GBTA 1KY9A 1MTVA 1T4UH 1V2QT 2FDAA 1J8AA 5HGGA 1PQ5A 4IMQA 4AB8A 3D49H 3GY3A 3RXTA 1F0UA 4X1SU 4YM9A 3UR6A 3KEEA 2BD2A 1VITH 1JIMA 1O32A 3RXPA 1FY8E 2ZGHA 5FAHA 5FHTA 2ANWA 2ZDMA 4TWYA 3GCNA 3Q76A 3LC5A 1TOCB 2ZWLH 1C2IA 1TNJA 1H8DH 2CHAB 4HGCA 5A0AE 1EAUA 5FPSA 5A8YA 1T8NA 2Z3DA 1IQMA 4LZ1H 2PW8H 4YZUA 5EPYA 2VJ1A 2OINA 1GHBF 1U6QA 1UTKA 2D8WA 1UVPA 2A31A 1PPCE 2NU2E 4B2CA 1HNEE 1YPMH 1C1RA 4I8KA 3T25A 2XC4A 3T29A 1FPCH 2GP9B 3ZZ9A 3SQHE 5HYOA 3DHKH 3GDUA 2G8TA 5H4IB 4J1YA 3JZ2B 2EA3A 2VWNA 2C3SA 1XX9A 4B76A 1C4U2 1C1MA 1S6HA 1P2IA 2BY5X 2XC0A 1N8OC 3GYMA 2GTBA 3PTBA 1TGSZ 2SNWA 3P95A 4U30A 3U8RH 2BD7A 1O2HA 2VIDA 2ZF0H 4IW4E 3SJ8A 1ELEE 1S84A 3SJOA 1HLTH 4WY3A 3RMOH 4MQAA 2H1UA 1GJ9B 2FS9A 3ZYDA 1ELBA 1SGFA 4Y8YA 4XBDA 2F83A 1BJVA 3OTJE 4H42U 2ZZUH 1A0HB 1LHGH 4O3TA 4OS5A 4AFZA 1TQ0B 2ZNKH 2XBYA 4Y8XA 3ZZ8A 1G30B 1EJMA 1C2GA 4WXIA 3ZVBA 4ABJA 2FOMB 1DX5M 1K1MA 1A61H 4YLUA 2NU0E 2G51A 4DVAU 2FODA 1IQIA 4GPGA 3BG4B 4F4OC 3UQOA 1LQDB 4U01A 3F1SB 3TGIE 1YLDA 4CBOA 5GPIB 1W0ZU 4A1TA 4X8TH 2DE9A 3QDZB 1ZTJA 3VXFH 2BB4A 2BY6X 1OS8A 5C5OA 1GCTC 1F92A 5E0JA 1UTMA 5EW2H 1QTFA 2XWAA 3GCHC 2BYAX 1WTHD 2VIPA 3A87A 1XXDA 5GIBA 1OSSA 1TFXA 4OGXA 2J4IA 5C1UA 2Y5GA 1DE7H 1GBBA 1YPKH 4WH6A 5GDSH 4X2VA 3BTFE 1FY1A 3RXVA 2FM2A 4DOQA 3EGKH 3VEQB 5F8ZA 1L1GA 2QYIA 1UTQA 3LPRA 1D3DB 1GBIA 2BXTH 5FCKA 4ZXYH 1ELAA 1MAYA 1QBVH 3UQVA 3T26A 1EZXC 1SQTA 3VPKA 4B71A 1JXPA 1YLCA 1P01A 1TBQH 2IJOB 1Z7KA 1SGIB 2G00A 2G52A 5E0GA 2H9HA 2ZHEH 3RM2H 1A3EH 3SNBA 5F8TA 4KTUA 1O3IA 1QA0A 3A8CA 2Z6BD 5A0BA 1HAHH 1NFXA 1THPB 4O03A 1O3NA 6CHAC 2GZ7A 4ABAA 1KLIH 1LKBA 3FANA 2ZU2A 3FAOA 4ZMAH 1GDQA 1GDUA 2JETC 4ASHA 2PKAA 1D3TB 1OPHB 2HOBA 3SJIA 3QZQA 1ESTA 4DG4A 1A4WH 1CU1A 3M37A 5A8XA 2CXVA 2ZU5A 4JYUH 1C1VH 2J9NA 1Z6EA 3V7TA 1BJUA 1AMHA 1GBCA 3RU4E 3U8TH 1N1LA 1HPGA 1GMDG 1YKTA 2K1QA 4Z6AH 2NU1E 4BAMB 3RC5A 3SU2A 4NIYA 3M3SA 4ZH8A 2G4UA 1MD7A 3P6ZB 2VIQA 3NCLA 2A5KA 3GCHB 1RXPA 2I6SA 4JYTA 3BN9A 1A1RA 1LTOA 1GBJA 1TX7A 1K1LA 1ZMNA 2FO9A 2Y82A 3RUOA 1NU7B 2OP9A 3QZRA 3SOSA 1C1OA 2A2XH 1CT2E 1DANH 1NC6A 3RXCA 1C5ZB 3M35A 1YGCH 2RDLA 3R3GB 1GJ4H 1NN6A 2JH5D 1SGEE 4KELA 3SV7A 4ABIA 3M5LA 4AFSA 4LK4A 4CRBA 1TPPA 2OBQA 1NS3A 3BG8A 1SMFE 2ZFTA 1ZPZA 3UWJH 2RCEA 3H7TA 5C1YA 1XXFA 3MNXA 4BAOB 1P02A 3TGJE 1IOEA 1C1TA 2ESTE 2G4TA 3ITIA 3MI4A 1BBRH 1AFQC 4YT7H 2AH4X 3MH5A 2QCYA 5JPMH 3PROA 1X7AC 4WMDA 2FI4E 3TH3H 3VB3A 1B0EA 1PYTD 1PPHE 4J2YB 1C5RA 3ZZ6A 3VB5A 2FZZA 1ZTKA 3ZVFA 2C4FH 3CENA 4GCHG 1UMAH 2ZQ2A 1AWFH 1BHXB 3LONA 3MO9A 2BX4A 4ZXXH 5JBAS 1ETSH 1HXFH 2A4GA 4MPUA 1HB0B 2B9LA 1GJCB 3PYHA 2NWNA 1L1NA 3RXQA 4ZHAA 1GWAA 1P9UA 1D3PB 1O35A 1MKXH 3SNEA 2WPIS 2WPHS 4WF8A 1SPJA 2FOAA 1GGDC 3RC4A 4AB9A 2CMYA 1TRYA 4DIIH 1O2IA 1V2KT 1O3CA 1HAOH 2A4OA 1BUIA 4JYVH 3BTHE 3GCTF 1W2KH 2PTCE 3O8BA 2GCHG 3PWBA 1DS2E 2ZEBA 1V2JT 3OYPA 2AMQA 1TOMH 5ETXA 1C2HA 1P09A 3I78A 3RLWH 2VWLA 1ZMJA 2THFB 5CE1A 1QJ1B 2GV6A 1C5NH 1TQ7B 1Q2WA 4CHAB 3Q77A 1ZHMA 2ZC9H 3AAVA 5DK1A 3UY9A 2H2ZA 3FP6E 1F7ZA 1GJ8B 4ISHH 5LH8A 2AYWA 1SGDE 1AU8A 3L6PA 2XBXA 4SGBE 3DT0H 1O34A 3DA9B 2Y5FA 2GD4B 2P3TB 1LHFH 2XBVA