8LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA01
1FPCH 1GJ9B 5DP6A 1AVWA 2W7UA 3F6UH 2AS9A 1ESAA 3SNBA 3SU2A 2NU3E 4AOQA 3QUMP 3ATIA 2EI6A 3L6PA 2B0FA 3A80A 1MTWA 1MU8B 4WVPE 2FO9A 3T29A 1SB1H 3LU9B 3LT3A 5A0BA 3LKWA 5A8XA 1C2LA 1JOUB 2SNWA 3BTKE 3K9XB 2GV6A 1ANEA 1IQHA 1J8AA 3T62A 3DHKH 2C8WB 1A5IA 2BVXH 1GBAA 2TPIZ 3BG8A 1P02A 1GGDB 3ODDA 5F8TA 5T3HA 1O2SA 4BXSA 3MH5A 2OC8A 2JETC 3PWCA 3LJOA 1ESBA 1EZXC 4FU9A 4FUEA 1KXCA 3MU8A 1C4Y2 3SQEE 4FVDA 1HDTH 1UK2A 4ZXXH 3TLOA 1C5YB 1LVMA 2ZP0H 1GI7B 4LXBH 1UCYK 5JBCS 1W7XH 3A89A 3BTME 2GCHF 2ZFFH 2ZPQA 4CRDA 1QR3E 1BTYA 2BLWA 2Z9JA 1BQYA 4GLYA 4IS5A 1HAIH 3Q00A 1BOQA 2UWOA 1KLTA 1UVUH 5IYTA 3LGWA 2PKAB 4RSPA 1BJVA 1E36B 1O2IA 3ZZ5A 3RXKA 4X8SH 4K1TA 2GDDA 4JZIA 1IQMA 3E3TA 5E2PA 3SW2B 1TE0A 2O8WA 1DLEA 2OC0A 5DKMA 2W3KA 2ZHQH 1EAIA 5F8XA 1S5SA 1NFUA 3A86A 3RXTA 1C2IA 1KLJH 2PKSB 3PM3A 1FJSA 3RXSA 1BMMH 4KKDA 2BX4A 3AASA 2XCFA 2SGDE 1VITF 2FOCA 3NXPA 4VGCC 1JRTA 1E34B 2NU0E 4BAMB 2SGPE 1DITH 1T8MA 3ZVDA 1Y5BT 4M7GA 1BIOA 2Z6BD 3SJ8A 1Z6EA 1ELTA 2WUBA 4FUIA 1SLVB 2V3OH 2OTVA 4JZFH 1DANH 1HYLA 1ZJDA 2FM2A 3RDZA 5DP7A 1BTPA 1TQ7B 4YZUA 1IHSH 1T32A 1XXFA 4NIXA 5EOKA 4UD9H 4YLUA 1FY4A 2ZU1A 4Y11E 3MU4A 4H4FA 1XMNB 1E35B 1TX6A 1VCPA 2BB4A 1EQ9A 3SUDA 1TABE 1EXFA 3VB6A 1RXPA 3F9GA 4XDEA 1EAWA 2PFEA 3DFJA 1OP2A 2QV1A 4X2WA 3DFLA 3FAOA 1NS3A 4U32A 1LMWB 4OS5A 3TJVA 1O5EH 1ZTLA 4YTAA 2GDEH 5PTPA 1P2MA 2FS8A 1U6QA 1TAWA 4AB9A 1TB6H 2G4TA 3VFEA 2A5IA 9LPRA 4D9RA 3Q76A 2Z3CA 3S0NA 1C5VA 2TBSA 2PHBA 1FV9A 4XSKU 1GMHG 2HPPH 2P95A 1TPPA 5FPYA 4MVNA 1LO6A 2C93B 1TYNA 3GDVA 3ZVFA 2G00A 2JH0D 1UTJA 3GISB 1DWEH 2BD9A 1VITG 2GCTB 2RDLA 3SUFA 1QIXB 1OWHA 2QXGA 4TYDA 2ANKH 2I6SA 3HGPA 4CH8B 1GCTC 3TJOA 4CHAB 5FCKA 3KQCA 1GHVH 3MI4A 1IQKA 3LGUA 3SV6A 3HPTB 4CR9A 2XTTB 1INCA 3UR9A 4MNXA 3NPSA 1QB9A 3GY2A 4CHAC 1GCTB 1NRNH 1O3JA 3UWJH 3A82A 3D23A 4IGDA 2BDGA 2ZZUH 4I33A 1O3NA 2PGBB 2ZHEH 5EQRA 3TK5A 1V2ST 3R3GB 1TGCA 5JDUB 1JIRA 5T6DA 2ZCHP 2GKVE 3ZZBA 3VB4A 5HXFA 3KNXA 5L2YH 1L0ZA 3KQEA 1EJAA 1T8OA 3URCA 1QA7A 2BZ6H 1EP5A 1AN1E 5C67A 1BTXA 2M5TA 1QA0A 2Z9LA 3I78A 3A84A 2Q1JA 2ZTYA 3NCLA 1SQOA 1ZYOA 1DM4B 1O3LA 3MU0A 5C1YA 2CF9H 1K1PA 1P12E 1Q3XA 2GD4B 3GDUA 1SGFG 4AORA 3A8CA 3UNSA 1NRRH 2Y81A 1MTNB 3A81A 3ATWA 5JYIA 1HAYB 1L4DA 2VIOA 3TITA 3O8CA 2Y7ZA 4YOGA 1AIXH 3M7UA 1AVXA 2QF3A 4Y0YE 1SGYE 3SV7A 4YOJA 1OWEA 1Y59T 4NSVA 1TWXB 1TPOA 2WPMS 3LC3A 2A2QH 4XBDA 5A0CA 1V2LT 1FXYA 1EX3A 5ABWA 3EYDA 1O3GA 2ZFPH 2AIPA 4B74A 1O3FA 4UDWH 2P8OC 1J9CH 1H9HE 1C1TA 2PSYA 4AFZA 4ABFA 6ESTA 3U8TH 1HIAA 1W14U 3SGQE 1Z1IA 4YOIA 3WY8A 9ESTA 2THFB 1GMCG 1KXBA 1ZTJA 3T25A 1YPKH 1WQSA 3VGCB 1S6HA 1OKXA 3S69A 2C3SA 3BTDE 1GHXH 4I32A 2GT8A 1UMAH 4WXVA 2GZ8A 1ELVA 2BDYA 2FOMB 5HMAA 1ETTH 1HAXB 2OBOA 2BDBA 3ATLA 1LKBA 3ATMA 1D3QB 3ENSB 2F9BH 1NRPH 3F9FA 3O8BA 3VB7A 5SGAE 1D9IA 3P17H 5JPMH 3SU1A 3F1SB 1GJ4H 3OU0A 2DE8A 1YCPM 2BY5X 4LOYH 2Q6GA 3S7HB 3E6PH 5T6GA 1G3EA 2O8MA 1V3XA 3PMBB 5CE1A 4AG1A 1BB0B 3RXIA 3A7ZA 1Y3UA 3BG4B 2YNAA 1O3MA 4BOHA 3ZV8A 1GL0E 3GCTG 3CS0A 1HIAB 2PTCE 2A31A 4CR5A 2Z9IA 4ISHH 2FX6A 2WPJS 6LPRA 1F5LA 2FODA 3SJOA 1ZGVA 1GJDB 3E1XB 4YESB 1GPZA 1CU1A 1EB1H 1C9PA 3E0PB 1A0LA 2ILNA 2VWNA 1C2JA 1O38A 3LGTA 1OP0A 1G37A 1UTKA 3ZZ4A 1BTZA 4MNYA 4X8VH 4ABJA 2D2DA 1HJAB 2G52A 5C1XA 2BQWB 1T4UH 1HGTH 3VGCC 4X8TH 2NWNA 2TIOA 3CS7A 1ACBE 1L1GA 3PROA 1NU9A 3JZ2B 4TPIZ 2ZDNA 4ZUHA 1UHBB 3UQVA 1V2NT 1CT2E 2AMPA 4TY6A 3M3SA 7ESTE 3SNCA 4CRAA 1O3AA 3F9EA 1MTUA 1OPHB 4E05H 2QN5T 2UUJB 2P3UB 1PPZA 3PWBA 2FOAA 2A1DB 3SU0A 3ZYDA 1Y5AT 5EXLA 1O3DA 4X1PU 2VJ1A 4BAOB 1GVKB 3ZVGA 1EOLA 1SOTA 1P03A 1WU1A 1MZDA 3MMGA 3ZYEA 1LVYA 1K1NA 3FZZA 3SQHE 2TGTA 3DUXH 4WWYA 1WV7H 2AGIX 2J94A 3NUMA 3S9AA 3TGKE 3GY4A 1Z8JB 1P06A 1N6XA 1QJ7B 2XW9A 1GJBB 1A5HA 1ZR0A 5E0GA 3ZZ8A 2JKHA 1S81A 3TVJB 3OY5U 1V2KT 1GHWH 1FPHH 4X2VA 1BUIA 1YGCH 3RU4E 3AAVA 1TNIA 2G8TA 1V2PT 3IG6B 4ZKNU 1V2TT 1GI4A 5C5NA 4Y8YA 1B5GH 5TCCA 1UTPA 1GI1A 4UFGH 5LPEA 1TBRH 4A5TS 2ZDVH 1GBBA 4IMZA 1YPGH 2BZAA 5I25A 2J38A 3RXLA 2QA9E 3ODFA 2RCEA 1NPMA 5H4IB 3ZVEA 3BTFE 1SGEE 3QWCH 1ABJH 2ZDAH 4UFFH 3RMLH 3BG4C 3SNAA 4DVAU 3MOCA 4I8JA 1O2QA 1AHTH 1ZPCA 4NWLA 5EG4A 1SPJA 2VWMA 1TQ0B 1C5SA 5K0HA 4I7YH 5FPSA 1HFDA 1MMJN 3ELAH 3SJ9A 4WF8A 2GMTB 1DS2E 4NZLA 1QQUA 3U8OH 1GMDF 4U30A 3UUZA 5DGJA 1C4V2 2VH0A 2QF0A 4MPVA 1TALA 1YC0A 1P3CA 3P8OA 2HLCA 2GCTC 1KTSB 1H9IE 5BRRE 5CHAC 1MCTA 4D7FA 1E0FD 4X8UH 3QGJA 1TOMH 3S9CA 1YKTA 1TLDA 2Y80A 2A4QA 1SGTA 2ZFQH 3UWIA 6GCHF 5EW1H 3K2UA 1LQDB 1FN8A 2PW8H 1O36A 3EA7A 4NG9H 1DWBH 1OWKA 1SI5H 3VB5A 3ZZ6A 4Q80A 1XUJA 1CGHA 2XBYA 2FEQH 3UPEA 2LPRA 3SGAE 1AB9C 2Q6FA 3B9FH 5LPFA 1HAVB 1BT7A 4AN7A 5B6OA 1C2GA 1C5WB 4ZHMU 1O2JA 5DP4A 5GCHG 4CBNA 2ZC9H 1A4WH 4B75A 1KXDA 3S7KB 4ZMAH 2GV7A 2ZGXH 2GVFA 5A09A 1UTNA 4I8GA 1SHYA 3UTUH 2J2UA 1ZOMA 2NU2E 1PFXC 5AVDA 3RU4D 2ANWA 2F9PA 1ELFA 1NY22 1MTSA 3QO6A 1YBWA 1O3IA 4ABIA 2NU4E 2GCHG 1IOEA 4DY7B 2PTNA 1J15A 1ZHPA 3LGIA 2BY6X 3QTOH 3M5MA 3RMNH 1S0RA 1TMBH 3CP7A 3GYMA 1JIMA 3HATH 1YLCA 3M35A 5GIBA 2WYGA 1AUTC 4K1SA 1B7XB 1ZHMA 3L3TA 2OINA 1Z71A 1QURH 1ELCA 2BM2A 2QIQA 3QZQA 4X6NA 1NT1A 1A3BH 1OYTH 3Q3YA 4FUCA 1DWCH 1SLUB 2BD3A 3SNEA 1C5NH 1JRSA 1QRXA 1SFIA 1IQJA 1XM1A 3SU5A 3SU3A 1DOJA 1G2MA 1SHHB 2W5EA 1O2MA 4ISLA 1ELBA 1OP8A 1MAYA 2O8TA 1FIWA 5A2MH 2XBXA 2FOEA 3M3TA 1BRCE 4BNRA 1TIOA 1AQ7A 1TRMA 5A8YA 3EGKH 1C5OH 1DSUA 1IQLA 1NC6A 3MU5A 2ZEBA 1ANBA 1C1RA 3VXFH 3BTHE 2BVSH 4WMFA 1QJ6B 1N1LA 2J4IA 2PKAA 2JETB 2SFAA 4ABDA 2QXIA 4FVBA 1RIWC 3PMJA 4KP0A 3E91A 3EA8A 1ELAA 5DO4H 1CHOF 4HFPB 4Q7YA 1SQTA 4MPWA 3FP6E 1EZQA 3DT0H 4I8HA 2WYJA 4ISIH 1VCWA 3RMOH 3ESTA 2VGCC 1AZZA 3OX7U 4THNH 3V7TA 4Y71A 2XC0A 1H8IH 1V6DA 4BTIB 2K1QA 1EP6A 4DW2U 3SJIA 4OGYA 1DUAA 2BD5A 1N8OC 3LC5A 1F0RA 2ZQ2A 1GWAA 1A61H 1O32A 1ABIH 3LGYA 3RP2A 1ZJKA 4JYTA 2ESTE 2BTCE 1BRAA 3PLPA 1TGSZ 1DXPA 4XBBA 1GDUA 1QFKH 1C5RA 5DPAA 2IPHA 4YM9A 1QBNA 4DJZB 1P9UA 1UCYH 2WPIS 4GVUA 3D49H 4H42U 1JXPA 1XVOA 1ZMLA 2AMDA 3B23B 1VCQA 1AKSA 3E8LA 1MD7A 4OS7A 1EB2A 2ZKSA 4AGKA 3MO9A 2CF8H 2ZPRA 3KHVA 4IN2A 1EOJA 4GUXA 1P9SA 1GBDA 2VVUA 1O33A 2HWLB 1HJAC 2W3IA 2BLQA 3MHWU 3U1JB 1UVOA 4Y0ZE 2AGGX 1FUJA 1HRTH 4X2XA 4LZ1H 1D6WA 3G01A 3KGPA 2KAIA 3V13A 1F0SA 1KYNA 1ZRBA 4CRFA 2FS9A 1N8OB 2F9OA 1D3TB 4ISNA 2FYQA 4ZHAA 2H9EH 1T4VH 1YM0A 1CA0C 4K69A 4DIHH 4AYYB 4FUFA 2GP9B 1CHGA 4O3TA 5GDSH 3A87A 3BIUH 1GL1A 2AIQA 1O2PA 1O2OA 1O34A 1CVWH 3GY8A 1O5CB 1UTMA 2VNTA 2BXTH 3MWIU 1YPLH 3NWUA 2F91A 2UUKB 1VGCC 1D4PB 4E7RG 2R2WU 4K8YA 1BHXF 2XWAA 2CHAC 1X7AC 5EW2H 3RMMH 3GCHC 1V2RT 1Z8GA 1EPTA 1F0UA 2HRVA 4IC5A 1BRBE 3BEIB 1GI2A 4R8TB 4DOQA 1P10A 1CQQA 1NRSH 1P8VC 3VEQB 5JBAS 1BCUH 3QDZB 1E38B 1AU8A 3RXAA 1MQ6A 1DLKB 1GBEA 5JBTA 2O9QA 4KTCA 1AMHA 3T2NA 1NESE 1PQ7A 3RXCA 2ZFTA 4B2CA 2TGAA 1AFEH 2ODQA 1YPHC 1A3EH 1DX5M 3GCNA 1XKBC 1LHCH 4X1NU 3RXUA 4Y6DA 1TGNA 2OCVB 4YT6H 2A45B 2ZDMA 3BF6H 1CT0E 3E16B 2PUXB 1BBRE 2FX4A 1O31A 1GBCA 1WOFA 2GZ9A 1F5RA 2IJOB 1O2NA 2OUAA 3SV9A 1MBQA 1GBFA 2WUCA 3UY9A 2SGQE 1W3CA 1SL3A 1HV7A 1K1IA 1AWHB 4Y8XA 1CE5A 1FDPA 2FXRA 1K22H 4KTSA 1Y5UT 4ISOA 3QLPH 1G36A 2C8ZB 5F03A 4INHA 3PV4A 3RXGA 1C1MA 1ZSLA 1HJ9A 1O3HA 1QRZA 3KQBA 2VWOA 4A1TA 1AFQB 1Z7KA 1M9UA 1C5ZB 1TMUH 5HGGA 4E06H 1RJXB 3MNCA 1IQNA 2XCNA 1GI8B 1OWDA 7KMEH 3A8BA 1PQ5A 4A7IB 2F9UA 5J4SA 2PWXA 3H5CB 1BMLA 4MNWA 4DURA 1XX9A 1NRQH 1KY9A 3LH3A 2ODPA 1EJNA 1ZSJA 1HXEH 3T27A 4B76A 1GJ8B 1S0QA 4NA8A 1FY8E 1RTFB 5JBBS 3BSQA 4FUGA 1BJUA 5BPEA 2H6MA 4ABGA 1J17T 1AD8H 2AERH 3GCHB 4NWKA 2Z3DA 3STJA 2WV4A 1T8NA 2R9PA 4OGXA 2OQ5A 4BAKB 1GHAF 4KTUA 1GMDG 4E7NA 1HXFH 3A88A 1TNLA 4AX9H 2FPZA 1ZSKA 1C5PA 4BAHB 5DK1A 1ELEE 1FMGA 2G55A 1ZPBA 4B73A 1D3DB 2FTLE 3AW0A 1F7ZA 1RS0A 4TWYA 2HALA 2FOBA 3A7VA 4AGJA 3RLYH 2F9VA 1ETRH 2WPLS 1SGNE 3A85A 4X1QU 3LPRA 3TU7H 3A83A 1H8DH 1P01A 3RLWH 2SNVA 3Q3KA 2WPKS 3N7OA 1GJCB 4UONA 1SGIB 2A5AA 1KDQB 2R0LA 2VIDA 2ZHDA 4Q7ZA 2EI8A 3M7QA 1O3EA 5FBIA 4ZAEA 2FLBH 3SU6A 2BY7X 4MPUA 2TRMA 1EATA 1FY1A 1IQIA 1ELGA 3RXVA 2WINI 1O2GH 2OLGA 1NFXA 2QXJA 3ZZCA 3TGIE 1VR1H 1GI3A 2FIRH 4X6PA 1UK3A 2O8UA 1LPKB 1WCZA 3EQ0H 3FVFB 3SO3A 1HAVA 1QL9A 2P59A 4MNVA 4I8LA 8GCHG 4Q7XA 2BDIA 3BTEE 4GSOA 3O8RA 3RXRA 3V12A 3BTQE 2GX4A 6CHAB 2RA0A 1GCDA 1YCPK 1XXDA 2AYWA 2GGVB 1P2NA 3VPKA 4DT7B 1O2ZA 3QTVH 1GBTA 2ZTXA 4BXWA 3TH3H 1O2UA 3SN8A 2R3UA 4YO9A 1Y8TA 2XNIA 1XKAC 5HM9A 3M37A 1PPCE 1P3EA 1PPFE 1P0SH 3A7WA 3ZZ7A 1TX7A 1GHYH 1TGBA 1DDJA 7LPRA 1ORFA 1F2SE 1GJ6A 1HB0B 5E2OA 1NU7B 1HLTH 5F8ZA 1SOZA 2P3FH 1TNGA 4SGBE 2VGCB 1MZAA 3RM2H 3ZZ9A 2A7JA 1W8BH 2BMGB 3HK3B 1UCYE 2WPHS 3PLBA 3UNRA 4ZKOU 2ZECA 1O2YA 1YLDA 1DE7H 1GBLA 2GT7A 4XOJA 2DE9A 1L1NA 2B8OH 4U01A 3RXPA 2BD4A 3SJKA 8ESTE 2JH6D 3AAUA 4D8NA 1WAYB 1T8LA 1HAOH 1ID5H 2OP9A 1H4WA 1YPHE 3T28A 3TNSA 1Z1JA 1OXGA 2OBQA 1GJAB 2G5VA 1RRKA 2Z9KA 4MQAA 1QGFA 2BY8X 1KLIH 1TA6A 3SHAH 2Q6DA 1S84A 2XWBI 3UQOA 1MKXK 3VXEH 2ZIQH 1YP9A 5TJXA 1CA0B 4WXIA 1WBGB 3JZ1B 1D3PB 1WTGH 1YF4A 1G30B 1HAHH 3ZZDA 1HCGA 2H5DA 3K6ZA 3RC6A 2AGEX 4MLFB 4WMDA 2VWLA 4RKOB 1C1VH 1ZMNA 3QGNB 3Q77A 1GVLA 1IQFA 5EPNA 2CGAA 3EA9A 3K65B 2OQUA 3KIDU 1ARCA 2C8YB 1S83A 3ATKA 1Y3WA 1NN6A 4WH8A 1FZZA 2QXHA 3E0NB 3QX5H 4IW4E 5T6FA 4AFUA 1LTOA 1EASA 1W0ZU 1Z8RA 2I6QA 1ZGIA 3GYLB 1LHGH 3U8RH 3P8FA 1PPBH 4HZHA 2H2ZA 1SLWB 3TJUA 3LDXH 3KF2A 4X0WU 2Y5FA 2R0KA 2BD2A 2P94A 5L6NH 3V0XA 2Y82A 4Y10E 3B8JA 2V35A 2BYAX 4ZKRU 2W26A 5DG6A 4ZXYH 1EZSC 3TK9A 1DPOA 3MNBA 1TRNA 3RUOA 4Z0KA 4K5ZA 1GJ5H 4D9QA 5HYOA 2ALPA 1P2IA 4TWWA 5CMXH 4BTUB 3HKIB 1THRH 2A5KA 5A0AE 4UEHH 1KXAA 3OSYA 1AKSB 1KTTB 1FONA 5G4BA 7GCHF 1MTNC 2VINA 1KSNA 1MAXA 3BEFB 1GBIA 1CGJE 2BVRH 4K2YA 2VIWA 1QJ1B 2XXLA 1WQVH 2CV3A 1C5MD 1QBVH 1ESTA 3OYPA 2FMJA 3TJNA 1P57B 1Q31A 3A7YA 4ZH8A 1MTVA 3CENA 1W12U 3W95A 3BTGE 1N6YA 3MFJA 4JZDH 3LOXA 1LQEA 1OOKB 2W7SA 3F68H 1C2HA 1OSSA 1O2WA 1GVZA 1MKWK 1BMAA 2CMYA 3MYWA 2AH4X 1O3BA 1XUFA 2PV9B 2V3HH 3MO3A 3PYHA 3GY7A 1GHBG 2HOBA 1YCPH 1UTQA 2BX3A 1SVPA 1DWDH 2FTMA 5ETXA 2F9NA 4R0IA 1TRYA 3C27B 1PYTC 2AEIH 2FOFA 2ZFRH 1C1UH 5E0JA 3L33A 3AVZA 2BDHA 1RTKA 2QGRA 3RXEA 1XUKA 1DVAH 1GMCF 4ZKSU 2BXUH 1EAXA 5C3NA 1C2FA 4AB8A 1GBJA 2P3TB 2SGEE 4Y8ZA 2ZGBH 1PPGE 5F6MA 4FU8A 3ZVCA 7GCHG 4ABEA 2B5TB 2VU8E 2H5CA 3FFGA 1TOCB 3TH2H 1V2UT 1TA2A 1AE8H 3KQDA 5AFYH 1XUIA 4GHTA 1F5KU 3C1KA 3IITA 1NROH 1KIGH 2BDCA 4IC6A 4B1TA 1BITA 5FCRA 1P09A 3GCTF 2BQ7B 2EC9H 4BANB 1QL8A 2OC1A 3PMHB 4LK4A 1EJMA 1CSOE 1ZRKA 4FUHA 3RXBA 1UVPA 1Z8IB 4CREA 1TGTA 1TFXA 2UWPA 1BHXB 2IOTA 3HK6B 2STAE 1P2QA 1ETSH 1MQ5A 3PTNA 4ABHA 5AFZH 1J14A 3QN7A 4X1RU 4NIVA 4NA9H 3PTBA 1EZUC 2Z3EA 2G51A 1PJPA 2AFQB 4Q2KA 2GZ7A 1AZ8A 3MNSA 1GDQA 2ZNKH 3T26A 2R3YA 1LCYA 2QCYA 5C20A 1O5BB 2C8XB 5FX6A 4B71A 1AVGH 3I77A 1KXFA 4JK5A 2HNTE 1TBZH 4FU7A 1XUGA 4O97A 1GI0A 4O9VA 2J34A 2PKSC 4UE7H 1UJ1A 4U2WA 1SGFA 4X6OA 3UREA 2B9LA 1O2XA 1FQ3A 3EAJA 1H1BA 5ESBA 4INKA 8LPRA 1EUFA 2VIPA 1DUEA 1O5DH 1G3BA 4YT7H 1Y3YA 1SBWA 2IN2A 3FANA 5HM2A 3MO6A 3DD2H 1DY8A 2QC2A 1CA8B 1B0FA 2ZHWH 3GY5A 4OS2A 1IAUA 1AE5A 1ANCA 3M5NA 1HAZB 1LHEH 1PPHE 4DGJA 3PO1C 1UK4A 4FUBA 1TNJA 3P8GA 1P2OA 5A8ZA 4GPGA 1W11U 3PLKA 1YYY1 1B0EA 2NU1E 1WUNH 1Y3XA 2F3CE 1MKXH 1QBOA 1HPGA 1L4ZA 1JBUH 2Z94A 1O5GH 2RA3A 3NKKA 5EXNA 3KCGH 5FXLA 2ULLA 3FP8E 2SGAA 2SGFE 1G3CA 2VB0A 5JB8S 3UOPA 4B2BA 1DXWA 1QL7A 1K28D 2CN0H 3BIVH 4XFQA 3ZVAA 1QB6A 1TNKA 1UO6A 1GI6A 4RKJB 5LPRA 1A0JA 1Q2WA 4D7GA 1BMNH 1SR5C 3SBKA 2LNCA 3ITIA 2ZDLA 1C1SA 3U69H 2ANMH 1HBTH 4HGCA 4X6MA 4ZROA 5EXMA 2V0BA 2ZFSA 2ZU3A 4INLA 1XVMA 4ABBA 3P95A 3H7OA 2EI7A 3GOVB 4NIYA 3MTYA 1T7CA 4D76A 1O2RA 5FHTA 1CT4E 4MTBA 1QB1A 3D65E 5DJ7A 3KEEA 2FOGA 1V2WT 4PROA 4A1VA 1CGIE 2ZWLH 1HAPH 4NFEA 2KAIB 5AHGH 3U9AH 2OXSA 4WY3A 4QT8C 1SC8U 1P04A 1C5UA 1EPTB 4ASHA 1BRUP 5I46H 4OS6A 5EGMA 4RN6A 5DP9A 4GAWA 1GDNA 1SMFE 2PR3A 1UTOA 2ZI2H 2ZGJA 1GMHF 3UOUA 4OS4A 1HJ8A 1MBMA 1O3CA 1SGQE 4NGAH 1ZZZA 1AGJA 1FY3A 3TIUA 3K6YA 3MU1A 3SZNA 1FN6A 2XC5A 2PLXA 2VIVA 2ANYA 3R0FA 5AF9H 4GHQA 1SLXB 5GCHF 1ARBA 3P92A 2WV5A 1O0DH 3URDA 2CHAB 1DY9A 1RGQA 4TY7A 3M3VA 3MNXA 1XUHA 4NZQA 4KELA 2G81E 1QRWA 1C1QA 2BHGA 2EEKA 1DICA 4JYUH 5L30H 1E37B 2P93A 3RXJA 1GHZA 1RD3B 1SGCA 3SI4H 3GCOA 2ZF0H 1EAUA 1MU6B 1OWJA 3U1IB 1SGDE 3BEUA 2ZCLP 2A2XH 1RTLA 3MH7A 1LPGB 2XBVA 1DT2A 1GI5A 4JCNA 2D1JA 1NFWA 1A46H 1CBWB 1J16A 1K1LA 2FP7B 3FZDA 3SGBE 2A32A 1C2DA 1QY6A 3S9BA 1UVSH 3A8DA 5GJ4B 1GBMA 4MDSA 2HGTH 2ZG0H 1S82A 1P05A 4B2AA 3RXDA 4DIIH 4JZ1A 1GG6B 3SUGA 2ZCKP 2PUQH 2ZGHA 1WTHD 4JYVH 1MCVA 1L2EA 1FY5A 1V2MT 1C2MA 1SFQB 2TGDA 1KDQA 3SUEA 1C1OA 1K1MA 2FI5E 4IBLH 3NK8A 3HGNA 1V2QT 2P8OB 1RFNA 4H6TA 5GPIB 1ELDE 1S85A 1GHBF 5E8EH 2STBE 3GY6A 1C1PA 3LONA 3Q3XA 1TX8A 1G3DA 1O39A 1TONA 2R2MB 4HI3A 1GI9B 2QY0B 3RXHA 2J92A 2XYAA 1T31A 4GCHF 4X2YA 2A4OA 1AI8H 3A8AA 3I29A 2PGQB 1O5FH 4GCHG 3OY6U 3E90B 1JMOH 2BQ6B 4AFSA 8GCHF 1CHOG 3KN2A 5C5OA 1IQEA 5K7RA 3V3MA 2C4FH 1MH0A 4YLQH 2UUFB 3LGVA 2BLOA 3M5OA 1D6RA 1O2LA 2ZDKA 1A7SA 1BBRK 3RM0H 4A6LA 3M5LA 3SV2H 5FX5A 3SNDA 2BY9X 5C1UA 3RC5A 5JB9S 4H6SB 1Z6JH 1A2CH 4K8BA 1LHDH 3LJJA 3UR6A 5LGOA 2O8LA 4AZ2B 4XBCA 2D8WA 1A5GH 3PO1B 3T5FH 1ZMJA 2Z9GA 1V2OT 2ZU5A 3UFAA 4J1YA 5FAHA 1RIWB 1VITH 1IQGA 4LZ4B 5CHAB 2FDAA 1OX1A 1ZPZA 4MPXA 1BDAA 1P2JA 4XE4A 3TH4H 4MG3A 1FIZA 3MH4A 4K60A 3M36A 1SQAA 3UIRA 2GMTC 4BTTB 4CRBA 3D62A 1GBKA 1DFPA 5DP5A 5DP8A 1C5TA 3A7XA 2Y7XA 2DUCA 2Z7FE 1G2LA 2ZO3H 4Y7AA 5EU8A 4NA7A 2RG3A 3F9HA 3SORA 1K21H 4JMYA 1S6FA 1C1WH 4NFFA 1AUJA 1PYTD 1A0HB 5LH8A 2XBWA 1Y3VA 2Y5GA 3LH1A 3QZRA 3HKJB 1AWFH 2ZTZA 1FAXA 3RXQA 1GBHA 4Y7BA 4K3JA 1BTHH 1FNIA 2BDAA 1F0TA 3AW1A 2BOHB 1P11E 4AYVB 4X1SU 1P2KA 4JZEH 5EODA 1QNJA 2VH6A 4JK6A 3BTTE 6CHAC 1MUEB 1V2JT 2VVVA 1NTPA 1OS8A 2A7HA 1NM6A 1LKAA 1ZTKA 2H1UA 4J2YB 3W94A 4CH2B 4IMQA 4I31A 1O2HA 1BZXE 2D26C 2FLRH 3NZIA 1MD8A 2VIQA 4ABAA 2F83A 2UWLA 1LHFH 3PB1E 1A1RA 5DP3A 2B7DH 2ZPSA 3U98H 4AFQA 1SG8B 1GJ7B 4O03A 3P8NA 3TK6A 3SI3H 1JWTA 1V2VT 2ZU2A 3ZVBA 8KME2 5GWZA 3PMAB 2HVXA 1BBRH 1ANDA 2Y6TA 4WJG2 4CBOA 1DSTA 1WYKA 4FXGH 5EPYA 1W13U 4Y79A 1W7GH 2YNBA 5GXPA 2CXVA 3TPIZ 1K2I1 2ZHFH 2H9HA 1FI8A 1YPEH 2J9NA 2XC4A 2JH5D 4O3UA 2CJIA 1AB9B 3OTJE 1QTFA 2FWWA 4NSYA 4VGCB 3BN9A 3QK1A 3ZZAA 2A4RA 1O30A 3ZV9A 1MKWH 1PQAA 2FYRA 2FI4E 5FBEA 2FESH 1TBQH 3TGJE 1C2KA 1O2VA 5ESTE 1LVOA 1K1JA 1C4U2 1ZHRA 2QAAA 1THSH 4DG4A 1GG6C 1K1OA 1O2KA 1O3OA 1F92A 1NO9H 4OS1A 4KGAA 4TPYA 3ZZ3A 1G9IE 2ASUB 2ZGCA 1YPJH 2OC7A 3P6ZB 2XRCA 1SGPE 1QQ4A 1K9OE 1O37A 4AG2A 1AY6H 1C5XB 4WH6A 4I8KA 5EQQA 5FPTA 1WSSH 3BV9B 4A92A 1VGCB 5EQSA 3UNQA 1C5QA 1EKBB 2G4UA 2A0QB 1CBWC 2ZU4A 2EA3A 2H9TH 3H7TA 1GHAG 3STIA 1UHBA 1O35A 3P70B 1ZLRA 2TGPZ 1TMTH 2ZQ1A 1O2TA 2YOLA 5J4QA 1VJAU 1C1NA 3IWMA 4K1EA 1C5LH 4CRCA 2C90B 1OYQA 2VVCA 1QCPA 3RXMA 4NCYA 2PSXA 6GCHG 1NFYA 4ESTE 5TCAA 3BTWE 2BD7A 4WMEA 2ALVA 2BD8A 3FP7E 3MH6A 1GGDC 1G32B 1OWIA 4A1XA 1BTWA 1PPEE 4F4OC 2UUYA 4NIWA 3SU4A 3GDSA 3GY3A 2J95A 2ZA5A 2OD3B 3LIWA 3A7TA 3M61U 3SHCH 1C2EA 2V6NA 3EE0B 1W0YH 3EDXB 1QHRB 4IN1A 1AO5A 4BAQB 4HTCH 4SGAE 5E0HA 3RU4T 4Y76A 1AFQC 2AMQA 1H9LB 4UFDH 1O5AB 2HNTC 1HUTH 1O3KA 1BA8B 1UVTH 3GICB 1HNEE 1SSXA 2HPQH 3RXFA 1LDTT 1TPAE 1LPZB 3RXOA 2G5NA 1C9TA 1L1JA 1VJ9U 3TNTA 2FI3E 3RC4A 4CRGA 4F49A 2A7CA 1UTLM 2A4GA 5L2ZH 4FUJA 1THPB 3M7TA 1SGRE 1PQ8A 1O3PB 2QYIA 1FLEE 1W2KH 2GTBA 1TPSA 1EPTC 1VZQH 3KL6A 1TNHA 1KXEA 1NZQH 3SOSA 5C2ZA 1HAGE 1FAKH 2FOHA 1BTUA 1LVBA 1YPMH 4Z6AH 5IDKA 4ZHLU 2HNTF 4UFEH 2P16A 2Y5HA 3O8DA 1IHTH 1W10U 4DCDA 1CO7E 2BLVA 2FZZA 2BOKA 3SV8A 3DA9B 4FUDA 2ODYB 3VB3A
chains in the Genus database with same CATH superfamily
1FPCH 1GJ9B 5DP6A 1AVWA 5C94A 2W7UA 3F6UH 2AS9A 1ESAA 3SNBA 3SU2A 2OK5A 3EE7A 2NU3E 4AOQA 3QUMP 3ATIA 2EI6A 3L6PA 2B0FA 3A80A 5T1VA 1MTWA 1MU8B 4WVPE 2FO9A 3DSOA 3T29A 2XOKD 1SB1H 3LU9B 3LT3A 5A0BA 3LKWA 5A8XA 1C2LA 1JOUB 2SNWA 3BTKE 3K9XB 2GV6A 1ANEA 1IQHA 1J8AA 3T62A 3DHKH 2C8WB 1A5IA 2BVXH 1GBAA 2TPIZ 3BG8A 1P02A 1GGDB 3ODDA 5F8TA 5T3HA 1O2SA 4BXSA 3MH5A 2OC8A 2JETC 3PWCA 3LJOA 1ESBA 1EZXC 4FU9A 4FUEA 1KXCA 3MU8A 1C4Y2 3SQEE 4FVDA 1HDTH 1UK2A 4ZXXH 3TLOA 1C5YB 1LVMA 2ZP0H 1GI7B 4LXBH 1UCYK 5JBCS 1W7XH 3A89A 3BTME 2GCHF 2ZFFH 2ZPQA 4CRDA 1QR3E 1BTYA 2BLWA 2Z9JA 1BQYA 4GLYA 4IS5A 1HAIH 3Q00A 1BOQA 2UWOA 1KLTA 1UVUH 5IYTA 3LGWA 2PKAB 4RSPA 1BJVA 1E36B 1O2IA 3ZZ5A 3RXKA 4X8SH 4K1TA 2GDDA 4JZIA 1IQMA 3E3TA 5E2PA 3SW2B 1TE0A 2O8WA 1DLEA 2OC0A 5DKMA 2W3KA 2ZHQH 1EAIA 5F8XA 1W0JD 1S5SA 1NFUA 3A86A 3RXTA 1C2IA 1KLJH 2PKSB 3PM3A 1FJSA 3RXSA 1BMMH 1YY3A 4KKDA 2BX4A 3AASA 2XCFA 2SGDE 1VITF 2FOCA 3NXPA 4VGCC 1JRTA 1E34B 2NU0E 4BAMB 1W0KD 2SGPE 1DITH 1T8MA 3ZVDA 1Y5BT 4M7GA 1BIOA 2Z6BD 3WWFA 3SJ8A 1Z6EA 1ELTA 2WUBA 4FUIA 1SLVB 2V3OH 2OTVA 4JZFH 1DANH 1HYLA 1ZJDA 2FM2A 3WW7A 3RDZA 5DP7A 1BTPA 1TQ7B 4YZUA 1IHSH 1T32A 1XXFA 4NIXA 5EOKA 4UD9H 4YLUA 1FY4A 2ZU1A 4Y11E 3MU4A 4H4FA 1XMNB 1E35B 1TX6A 1VCPA 2BB4A 1EQ9A 2J98B 3SUDA 1TABE 1EXFA 3VB6A 1RXPA 3F9GA 3OEED 4XDEA 1EAWA 2PFEA 3DFJA 1OP2A 2QV1A 4X2WA 3DFLA 3FAOA 1NS3A 4U32A 1LMWB 4OS5A 3TJVA 1O5EH 1ZTLA 4YTAA 2GDEH 5PTPA 1P2MA 2FS8A 1U6QA 1TAWA 4AB9A 1TB6H 2G4TA 3VFEA 2A5IA 9LPRA 4D9RA 3Q76A 2Z3CA 3S0NA 1C5VA 2TBSA 2PHBA 1FV9A 4XSKU 1GMHG 2HPPH 2P95A 1TPPA 5FPYA 4MVNA 1LO6A 2C93B 1TYNA 3GDVA 3ZVFA 2G00A 2JH0D 1UTJA 2KCYA 3GISB 1WDIA 1DWEH 2BD9A 1VITG 2GCTB 2RDLA 3SUFA 1QIXB 1OWHA 2QF5A 2QXGA 4TYDA 2ANKH 2I6SA 3HGPA 4CH8B 1GCTC 3TJOA 4CHAB 5FCKA 3KQCA 1GHVH 3PRDA 3MI4A 1IQKA 3LGUA 3SV6A 3HPTB 4CR9A 2XTTB 1INCA 3UR9A 4MNXA 3NPSA 1QB9A 3GY2A 4CHAC 1GCTB 1NRNH 1O3JA 3UWJH 3A82A 3D23A 4IGDA 2GJGA 2BDGA 2ZZUH 4I33A 1O3NA 2PGBB 2ZHEH 5EQRA 3TK5A 1V2ST 3R3GB 1TGCA 5C0UA 5JDUB 1JIRA 5T6DA 2ZCHP 3UB0A 2GKVE 3ZZBA 3VB4A 5HXFA 3KNXA 5L2YH 1L0ZA 3KQEA 1EJAA 1T8OA 3URCA 1QA7A 2BZ6H 1EP5A 1AN1E 5C67A 1BTXA 2M5TA 1QA0A 2Z9LA 3I78A 2WHXA 3A84A 2Q1JA 2ZTYA 3NCLA 1SQOA 1ZYOA 1DM4B 1O3LA 3MU0A 5C1YA 2CF9H 1K1PA 1P12E 1Q3XA 2GD4B 3GDUA 1SGFG 4AORA 3A8CA 3UNSA 1NRRH 2Y81A 1MTNB 3A81A 3ATWA 5JYIA 1HAYB 1L4DA 2VIOA 3TITA 3O8CA 2Y7ZA 4YOGA 1AIXH 3M7UA 1AVXA 2QF3A 4Y0YE 1SGYE 3SV7A 4YOJA 1OWEA 1Y59T 4NSVA 1TWXB 1TPOA 2WPMS 3LC3A 2A2QH 4XBDA 5A0CA 1V2LT 1FXYA 1EX3A 5ABWA 3EYDA 1O3GA 2WV9A 2ZFPH 2AIPA 4B74A 1O3FA 4UDWH 2P8OC 1J9CH 1H9HE 1C1TA 2PSYA 4AFZA 4ABFA 6ESTA 3U8TH 1HIAA 1W14U 3SGQE 1Z1IA 4YOIA 3WY8A 9ESTA 2THFB 1GMCG 1KXBA 1ZTJA 3T25A 1YPKH 1WQSA 3VGCB 1S6HA 1OKXA 3S69A 2C3SA 3BTDE 1GHXH 2QE7D 4I32A 2GT8A 1UMAH 4WXVA 2GZ8A 1ELVA 2BDYA 2FOMB 5HMAA 1ETTH 1HAXB 2OBOA 5KEDA 2BDBA 3ATLA 1LKBA 3ATMA 1D3QB 3ENSB 2F9BH 1NRPH 3GS9A 3F9FA 3O8BA 2RFKC 3VB7A 5SGAE 1D9IA 3P17H 5JPMH 3SU1A 3F1SB 1GJ4H 3OU0A 2DE8A 1YCPM 2BY5X 4LOYH 2Q6GA 3S7HB 3E6PH 5T6GA 1G3EA 2O8MA 1V3XA 3PMBB 5CE1A 4AG1A 1BB0B 3RXIA 3A7ZA 1Y3UA 3BG4B 2YNAA 1O3MA 4BOHA 3ZV8A 1GL0E 3GCTG 3CS0A 1HIAB 2PTCE 2A31A 4CR5A 2Z9IA 4ISHH 2FX6A 2WPJS 3FOAA 6LPRA 1F5LA 2FODA 3SJOA 1ZGVA 1GJDB 3E1XB 2KM0A 4YESB 1GPZA 1CU1A 1EB1H 1C9PA 3E0PB 1A0LA 2ILNA 2VWNA 1C2JA 1O38A 5C0TA 3LGTA 1OP0A 1G37A 1UTKA 3ZZ4A 1BTZA 4MNYA 4X8VH 4ABJA 2D2DA 1HJAB 2G52A 5C1XA 2BQWB 1T4UH 1HGTH 3VGCC 4X8TH 2NWNA 2TIOA 3DSPA 3CS7A 1ACBE 2L74A 1L1GA 3PROA 1NU9A 3JZ2B 4TPIZ 2ZDNA 4ZUHA 1UHBB 3UQVA 1FX0B 1V2NT 1CT2E 2AMPA 4TY6A 3M3SA 7ESTE 3SNCA 4CRAA 1O3AA 3F9EA 1MTUA 5HIZA 2YMSB 1OPHB 4E05H 2QN5T 2V7QD 2UUJB 4HG6A 2P3UB 1PPZA 3PWBA 2FOAA 2A1DB 3SU0A 3ZYDA 1Y5AT 5EXLA 1O3DA 4X1PU 2VJ1A 4BAOB 1GVKB 3ZVGA 1EOLA 1SOTA 1P03A 1WU1A 1MZDA 3MMGA 3ZYEA 1LVYA 1K1NA 3FZZA 3SQHE 2TGTA 3DUXH 4WWYA 1WV7H 2AGIX 2J94A 3NUMA 3S9AA 3TGKE 3GY4A 3H09A 1Z8JB 1P06A 1N6XA 1QJ7B 2XW9A 1GJBB 3F0PA 1A5HA 1ZR0A 5E0GA 3ZZ8A 2JKHA 1S81A 3TVJB 3OY5U 1V2KT 2XNDD 1GHWH 1FPHH 4X2VA 1BUIA 1YGCH 3RU4E 3AAVA 1TNIA 2G8TA 1V2PT 3IG6B 4ZKNU 3OTPA 1V2TT 1GI4A 5C5NA 4Y8YA 1B5GH 1S6LA 5TCCA 1UTPA 1GI1A 4UFGH 5LPEA 1TBRH 4A5TS 2ZDVH 1GBBA 4IMZA 1YPGH 2BZAA 5I25A 2J38A 3RXLA 2QA9E 3ODFA 2RCEA 1NPMA 5H4IB 3ZVEA 3BTFE 1SGEE 3QWCH 1ABJH 2ZDAH 3DCLA 4UFFH 3RMLH 1SQRA 3BG4C 3SNAA 4DVAU 3MOCA 4RT1A 4I8JA 1O2QA 1AHTH 1ZPCA 4NWLA 5EG4A 1SPJA 2VWMA 1TQ0B 1C5SA 5K0HA 4I7YH 5FPSA 1HFDA 1MMJN 3ELAH 3SJ9A 4WF8A 2GMTB 1DS2E 4NZLA 1QQUA 3U8OH 1GMDF 1NBMD 4U30A 3UUZA 5DGJA 1C4V2 2VH0A 2QF0A 4MPVA 1TALA 1YC0A 1P3CA 3P8OA 2HLCA 1WXRA 4M9FA 2GCTC 1KTSB 1H9IE 5BRRE 5CHAC 1MCTA 4D7FA 1E0FD 4X8UH 4TSFD 3QGJA 1TOMH 3S9CA 1YKTA 1TLDA 2Y80A 2A4QA 1SGTA 2ZFQH 3UWIA 6GCHF 5EW1H 3K2UA 1LQDB 1FN8A 2PW8H 1O36A 3EA7A 4NG9H 1DWBH 1OWKA 1SI5H 3VB5A 3ZZ6A 4Q80A 1XUJA 1CGHA 2XBYA 2FEQH 3UPEA 2LPRA 3OFND 3SGAE 1AB9C 2Q6FA 3B9FH 5LPFA 1HAVB 1BT7A 4AN7A 5B6OA 1C2GA 1C5WB 4ZHMU 1O2JA 5DP4A 5GCHG 4CBNA 2ZC9H 1A4WH 4B75A 1KXDA 3S7KB 4ZMAH 2GV7A 2ZGXH 2GVFA 5A09A 1UTNA 4I8GA 1SHYA 3NRLA 3UTUH 2J2UA 1ZOMA 3WWBA 2NU2E 1PFXC 3DSGA 2HVYB 5AVDA 2AHME 3RU4D 2ANWA 1E79D 2F9PA 1ELFA 1NY22 2KFWA 1MTSA 3QO6A 1YBWA 1O3IA 4ABIA 2NU4E 2GCHG 1IOEA 4DY7B 2PTNA 1J15A 1ZHPA 3LGIA 2BY6X 3QTOH 3M5MA 3RMNH 1S0RA 1TMBH 3CP7A 1SKYE 3GYMA 5KECA 1JIMA 3HATH 1YLCA 3M35A 5GIBA 2WYGA 1AUTC 4K1SA 1B7XB 1ZHMA 3L3TA 2OINA 1Z71A 2KX4A 4B6FA 1QURH 1ELCA 2BM2A 2QIQA 3QZQA 4X6NA 1NT1A 1A3BH 1OYTH 3Q3YA 4RI0A 4FUCA 1DWCH 1SLUB 2BD3A 3SNEA 1C5NH 1JRSA 1QRXA 1SFIA 1IQJA 1QZ8A 1XM1A 2K8IA 3SU5A 3SU3A 1DOJA 1G2MA 1SHHB 2W5EA 3UAIC 1O2MA 4ISLA 1ELBA 1OP8A 1MAYA 2O8TA 1FIWA 5A2MH 2XBXA 2FOEA 3M3TA 1BRCE 4BNRA 1TIOA 1AQ7A 1TRMA 5A8YA 1UW7A 3EGKH 1C5OH 1DSUA 1IQLA 1NC6A 3MU5A 2ZEBA 1ANBA 3SYJA 1C1RA 2YMSD 2KR7A 5HIYA 3VXFH 3BTHE 2BVSH 4WMFA 4AC9A 1QJ6B 1N1LA 2J4IA 2PKAA 2JETB 2SFAA 4ABDA 2QXIA 1EFRD 4FVBA 1RIWC 3PMJA 4KP0A 3E91A 3EA8A 1ELAA 5DO4H 1CHOF 4HFPB 4Q7YA 1SQTA 4MPWA 3FP6E 1EZQA 3DT0H 4I8HA 1BMFD 2WYJA 4ISIH 1VCWA 3RMOH 3ESTA 2VGCC 1AZZA 3OX7U 4THNH 3V7TA 4Y71A 2XC0A 1H8IH 1V6DA 5C17A 4BTIB 2K1QA 1EP6A 4DW2U 3SJIA 4OGYA 1DUAA 2BD5A 1N8OC 3LC5A 1F0RA 4Z1MD 2ZQ2A 1GWAA 1A61H 1O32A 1ABIH 3LGYA 3RP2A 1ZJKA 4JYTA 2ESTE 2BTCE 1BRAA 3PLPA 1TGSZ 1DXPA 4XBBA 1GDUA 1QFKH 1C5RA 5DPAA 2IPHA 4YM9A 1QBNA 4DJZB 1P9UA 1UCYH 2WPIS 4GVUA 3D49H 4H42U 1JXPA 1XVOA 1ZMLA 2AMDA 2YMSC 3B23B 1VCQA 1AKSA 3E8LA 1MD7A 4OS7A 1EB2A 2ZKSA 4AGKA 3MO9A 2CF8H 2ZPRA 3KHVA 4IN2A 1EOJA 4GUXA 1P9SA 1GBDA 3W1EA 2VVUA 2K0QA 1O33A 2HWLB 1HJAC 2W3IA 2BLQA 3MHWU 3U1JB 1UVOA 4Y0ZE 2AGGX 1FUJA 1HRTH 4X2XA 4LZ1H 1D6WA 3G01A 3KGPA 2KAIA 3V13A 1F0SA 1KYNA 1ZRBA 4CRFA 2VBCA 2FS9A 1N8OB 2F9OA 1D3TB 4ISNA 2FYQA 4ZHAA 2H9EH 1T4VH 1YM0A 1CA0C 4K69A 4DIHH 4AYYB 4FUFA 2GP9B 1CHGA 4O3TA 5GDSH 3A87A 3BIUH 1GL1A 2AIQA 1O2PA 1O2OA 1O34A 1CVWH 3GY8A 1O5CB 1UTMA 2VNTA 2BXTH 4I86A 3MWIU 1YPLH 3NWUA 2F91A 2UUKB 1VGCC 1D4PB 4E7RG 2R2WU 4K8YA 1BHXF 2XWAA 2CHAC 1X7AC 2WZQA 5EW2H 3RMMH 3GCHC 1V2RT 1Z8GA 1EPTA 1F0UA 2HRVA 4IC5A 1BRBE 3BEIB 1GI2A 4R8TB 4DOQA 1P10A 1CQQA 1NRSH 3F0OA 1P8VC 3VEQB 5JBAS 1BCUH 3QDZB 3OAAD 1E38B 1AU8A 5EJLA 3RXAA 1MQ6A 1DLKB 1GBEA 5JBTA 2O9QA 4KTCA 1AMHA 3T2NA 1NESE 2QF4A 1PQ7A 3RXCA 2ZFTA 4B2CA 2J97A 2TGAA 1AFEH 2ODQA 1YPHC 1A3EH 1DX5M 3GCNA 1XKBC 1LHCH 4X1NU 3RXUA 4Y6DA 1TGNA 2OCVB 4YT6H 2A45B 2ZDMA 3BF6H 1CT0E 3E16B 2PUXB 1BBRE 2FX4A 1O31A 2JJ1D 1GBCA 1WOFA 2W6ID 2GZ9A 1F5RA 2IJOB 1O2NA 2OUAA 3SV9A 1MBQA 1GBFA 2WUCA 3UY9A 2SGQE 1W3CA 1SL3A 1HV7A 1K1IA 1AWHB 4Y8XA 1CE5A 1FDPA 2FXRA 1K22H 4KTSA 1Y5UT 4ISOA 3QLPH 1G36A 2C8ZB 5F03A 4INHA 3PV4A 3RXGA 1C1MA 1ZSLA 1HJ9A 1O3HA 1QRZA 3KQBA 2VWOA 4A1TA 1AFQB 1Z7KA 1M9UA 1C5ZB 1TMUH 5HGGA 4E06H 4YXWD 1RJXB 4Q63A 2KCOA 3MNCA 1IQNA 2XCNA 1GI8B 1OWDA 7KMEH 3A8BA 4ZCNA 1PQ5A 4A7IB 2F9UA 5J4SA 2LELA 5CHBA 2PWXA 3FKSD 3H5CB 1BMLA 4MNWA 4DURA 1XX9A 1NRQH 1KY9A 3LH3A 2ODPA 1EJNA 1ZSJA 1HXEH 3T27A 4B76A 1GJ8B 1S0QA 4NA8A 1FY8E 1RTFB 5JBBS 3BSQA 4FUGA 1BJUA 5BPEA 2H6MA 4ABGA 1J17T 1AD8H 2AERH 3GCHB 4NWKA 2Z3DA 3STJA 2WV4A 1T8NA 2R9PA 4OGXA 2OQ5A 4BAKB 1GHAF 4KTUA 1GMDG 4E7NA 1HXFH 3A88A 1TNLA 4AX9H 2FPZA 1ZSKA 1C5PA 4BAHB 5DK1A 1ELEE 1FMGA 2G55A 1ZPBA 4B73A 1NBME 1D3DB 2FTLE 3AW0A 1F7ZA 1RS0A 4TWYA 2HALA 2FOBA 3A7VA 4AGJA 3RLYH 2F9VA 1ETRH 2WSSD 2WPLS 1SGNE 3A85A 4X1QU 3LPRA 2J5UA 3TU7H 3A83A 1H8DH 1P01A 3RLWH 2SNVA 3Q3KA 2WPKS 3N7OA 1GJCB 4UONA 1SGIB 2A5AA 1KDQB 2R0LA 2VIDA 2ZHDA 4Q7ZA 2EI8A 3M7QA 1O3EA 5FBIA 4RT0A 2FLBH 4ZAEA 3SU6A 2W6JD 2BY7X 4MPUA 2TRMA 1EATA 1FY1A 4XD7D 1IQIA 1ELGA 3RXVA 2WINI 1O2GH 2OLGA 1NFXA 2QXJA 3ZZCA 3TGIE 1VR1H 1GI3A 2FIRH 4X6PA 1UK3A 2O8UA 1LPKB 1WCZA 3F3BA 3EQ0H 3FVFB 3SO3A 1HAVA 1QL9A 2P59A 4MNVA 4I8LA 8GCHG 4Q7XA 2BDIA 3BTEE 4GSOA 3O8RA 3RXRA 3V12A 3BTQE 2GX4A 6CHAB 2RA0A 1GCDA 1YCPK 1XXDA 2AYWA 2GGVB 1P2NA 3VPKA 4DT7B 1O2ZA 3QTVH 1GBTA 2ZTXA 4BXWA 3TH3H 3FN8A 1O2UA 3SN8A 2CK3D 2R3UA 3PV5A 4YO9A 1Y8TA 2XNIA 1XKAC 5HM9A 3M37A 1PPCE 1P3EA 1PPFE 1P0SH 3A7WA 3ZZ7A 1TX7A 1GHYH 1TGBA 1DDJA 7LPRA 1ORFA 1F2SE 1GJ6A 1HB0B 5E2OA 1NU7B 1HLTH 5F8ZA 1SOZA 2P3FH 1TNGA 4SGBE 2VGCB 1K0HA 1MZAA 3RM2H 3ZZ9A 2A7JA 5EIYA 1W8BH 2BMGB 3HK3B 1UCYE 2WPHS 3PLBA 3UNRA 4ZKOU 2ZECA 1O2YA 1YLDA 1DE7H 1E1QD 1GBLA 2GT7A 4XOJA 2DE9A 1L1NA 2B8OH 4U01A 3RXPA 2BD4A 2IPQX 3SJKA 8ESTE 2JH6D 3AAUA 4D8NA 3PV2A 1WAYB 1T8LA 1HAOH 1ID5H 2OP9A 1H4WA 1YPHE 3T28A 3TNSA 1Z1JA 1OXGA 2OBQA 1GJAB 2G5VA 1RRKA 2Z9KA 4MQAA 1QGFA 2BY8X 1KLIH 1TA6A 3SHAH 2Q6DA 3U28C 1S84A 2XWBI 3UQOA 1MKXK 3VXEH 2ZIQH 1YP9A 5TJXA 1CA0B 4WXIA 1WBGB 3N99A 3JZ1B 1D3PB 1WTGH 1YF4A 1G30B 1HAHH 3ZZDA 1HCGA 2H5DA 3K6ZA 3RC6A 2AGEX 4MLFB 4WMDA 2VWLA 4RKOB 1C1VH 1ZMNA 3QGNB 3Q77A 1GVLA 1IQFA 5EPNA 2CGAA 3EA9A 3K65B 2OQUA 3KIDU 1ARCA 2C8YB 1S83A 3ATKA 1H8HD 1NN6A 1Y3WA 4WH8A 1FZZA 2QXHA 3E0NB 3QX5H 4IW4E 5T6FA 4AFUA 1LTOA 1EASA 1W0ZU 1Z8RA 2I6QA 1ZGIA 3GYLB 1LHGH 3U8RH 3P8FA 1PPBH 4HZHA 2H2ZA 1SLWB 3TJUA 3LDXH 3KF2A 4X0WU 2Y5FA 2R0KA 2BD2A 2P94A 5L6NH 2WPDD 3V0XA 2Y82A 4Y10E 3B8JA 2L6OA 2V35A 2BYAX 4ZKRU 2W26A 5DG6A 4ZXYH 1EZSC 3TK9A 1DPOA 3MNBA 1TRNA 3RUOA 3MQKC 4Z0KA 4K5ZA 1GJ5H 4D9QA 5HYOA 2ALPA 1P2IA 4TWWA 5CMXH 4BTUB 3HKIB 1THRH 2A5KA 5A0AE 4UEHH 1KXAA 3OSYA 1AKSB 1KTTB 1FONA 5G4BA 7GCHF 1MTNC 2VINA 1KSNA 1MAXA 3BEFB 1GBIA 1CGJE 2BVRH 4K2YA 2VIWA 1QJ1B 2XXLA 1WQVH 2CV3A 1C5MD 1QBVH 1ESTA 2RDEA 3OYPA 2FMJA 3TJNA 1P57B 1Q31A 3A7YA 4ZH8A 1MTVA 3CENA 1W12U 3W95A 3BTGE 1N6YA 3MFJA 4FETA 4JZDH 4F55A 3LOXA 1LQEA 1OOKB 2W7SA 3F68H 1C2HA 1OSSA 1O2WA 1GVZA 1MKWK 1BMAA 2CMYA 3MYWA 2AH4X 1O3BA 1XUFA 2PV9B 2V3HH 3MO3A 3PYHA 4ASUD 3GY7A 1GHBG 2HOBA 1YCPH 1UTQA 2BX3A 1SVPA 1DWDH 2FTMA 5ETXA 2F9NA 4R0IA 1TRYA 3C27B 1PYTC 2AEIH 2FOFA 2ZFRH 3OEHD 1C1UH 5E0JA 3L33A 3AVZA 2BDHA 1RTKA 2QGRA 4Q4LA 3RXEA 1XUKA 4TT3D 1DVAH 1GMCF 4ZKSU 2BXUH 1EAXA 5C3NA 1C2FA 4AB8A 4P00A 1GBJA 2P3TB 2SGEE 4Y8ZA 2ZGBH 1PPGE 5F6MA 4FU8A 3ZVCA 7GCHG 4ABEA 2B5TB 2VU8E 2H5CA 3FFGA 1TOCB 3TH2H 1V2UT 1TA2A 1AE8H 3KQDA 5AFYH 1XUIA 4GHTA 1F5KU 3C1KA 3IITA 1NROH 1KIGH 2BDCA 4IC6A 4B1TA 1BITA 1H8ED 5FCRA 1P09A 3GCTF 2BQ7B 2EC9H 4BANB 1QL8A 2OC1A 3PMHB 4LK4A 1EJMA 1CSOE 1ZRKA 4FUHA 3RXBA 1UVPA 1Z8IB 4CREA 1TGTA 5GNDA 1TFXA 2M2AA 2UWPA 1BHXB 2IOTA 3HK6B 2STAE 1P2QA 1ETSH 1MQ5A 3PTNA 4ABHA 5AFZH 1J14A 3QN7A 4X1RU 4NIVA 4NA9H 3PTBA 1EZUC 2Z3EA 3N7EA 2G51A 1PJPA 2AFQB 4Q2KA 2GZ7A 1AZ8A 3MNSA 1GDQA 2ZNKH 3T26A 2R3YA 1LCYA 2QCYA 5C20A 1O5BB 2C8XB 5FX6A 4B71A 1AVGH 3I77A 1KXFA 2V3MA 4JK5A 2HNTE 1TBZH 4FU7A 1XUGA 4O97A 1GI0A 4O9VA 4F48B 2J34A 2PKSC 5IK2D 4UE7H 1UJ1A 4U2WA 1SGFA 4X6OA 3UREA 2B9LA 1O2XA 4FOUC 1FQ3A 3EAJA 1H1BA 5ESBA 4INKA 8LPRA 1EUFA 2VIPA 1DUEA 1O5DH 1G3BA 4YT7H 1Y3YA 1SBWA 2IN2A 3FANA 5HM2A 3MO6A 3DD2H 1DY8A 2QC2A 1CA8B 1B0FA 2ZHWH 3GY5A 4OS2A 1IAUA 5EJ1A 1AE5A 1ANCA 3M5NA 1HAZB 1LHEH 1PPHE 4DGJA 3PO1C 1UK4A 4FUBA 1TNJA 3P8GA 1P2OA 5A8ZA 4GPGA 1W11U 3PLKA 1YYY1 1B0EA 2NU1E 1WUNH 1Y3XA 2F3CE 1MKXH 1QBOA 1HPGA 1L4ZA 1JBUH 2Z94A 1O5GH 2RA3A 3NKKA 5EXNA 3KCGH 5FXLA 2ULLA 3FP8E 2SGAA 2SGFE 1G3CA 2VB0A 5JB8S 3UOPA 4B2BA 1DXWA 1QL7A 1K28D 2CN0H 3BIVH 4XFQA 3ZVAA 1QB6A 1TNKA 1UO6A 1GI6A 4RKJB 5LPRA 1A0JA 1Q2WA 4D7GA 1BMNH 1SR5C 3SBKA 2LNCA 3ITIA 2ZDLA 1C1SA 3U69H 2ANMH 1HBTH 4HGCA 4X6MA 4ZROA 5EXMA 2V0BA 2ZFSA 2ZU3A 4INLA 1XVMA 4ABBA 3P95A 3H7OA 2EI7A 3GOVB 4NIYA 3MTYA 1T7CA 4D76A 1O2RA 5FHTA 3AK5A 1CT4E 4MTBA 1QB1A 3D65E 5DJ7A 3KEEA 2FOGA 1V2WT 3CNRA 4PROA 4A1VA 1CGIE 2ZWLH 1HAPH 4NFEA 3F2GA 2KAIB 5AHGH 3U9AH 5EJZA 2OXSA 4WY3A 4QT8C 1SC8U 1P04A 1C5UA 1EPTB 4ASHA 1BRUP 5I46H 4OS6A 5EGMA 4RN6A 5DP9A 5F53A 4GAWA 1GDNA 1SMFE 2JIZD 2PR3A 1UTOA 2ZI2H 2ZGJA 1GMHF 3UOUA 4OS4A 1HJ8A 1MBMA 1O3CA 1SGQE 4NGAH 1ZZZA 1AGJA 1FY3A 3TIUA 3K6YA 3MU1A 3SZNA 1FN6A 2XC5A 5KGOA 2PLXA 2VIVA 2ANYA 3R0FA 5AF9H 4GHQA 1SLXB 5GCHF 2IJD1 1ARBA 3P92A 2WV5A 1O0DH 5DSFA 2CHAB 3URDA 1DY9A 1RGQA 4TY7A 1MABB 3M3VA 3MNXA 1XUHA 4NZQA 4KELA 2F4LA 1QRWA 1C1QA 2BHGA 2EEKA 1DICA 2G81E 4JYUH 5L30H 1E37B 2P93A 3RXJA 1GHZA 1RD3B 1SGCA 3SI4H 3GCOA 2ZF0H 1EAUA 1MU6B 1OWJA 2EY4C 3U1IB 1SGDE 3KYFA 3BEUA 2ZCLP 2A2XH 1RTLA 3MH7A 1LPGB 2XBVA 1DT2A 1GI5A 4JCNA 2D1JA 1NFWA 1A46H 1CBWB 1J16A 1K1LA 2FP7B 3FZDA 3SGBE 2A32A 1C2DA 1QY6A 3S9BA 1UVSH 3A8DA 5GJ4B 1GBMA 4MDSA 2HGTH 2ZG0H 1S82A 1P05A 4B2AA 3RXDA 4DIIH 3KYGA 4JZ1A 1GG6B 3KQ5A 3SUGA 2ZCKP 2PUQH 2ZGHA 1WTHD 4JYVH 1MCVA 1L2EA 1FY5A 1V2MT 1C2MA 1SFQB 2TGDA 1KDQA 3SUEA 1C1OA 1K1MA 2FI5E 4IBLH 3NK8A 3HGNA 1V2QT 2P8OB 1RFNA 4H6TA 5DN6D 5GPIB 1ELDE 1S85A 1GHBF 5E8EH 2STBE 4ACAA 3GY6A 1C1PA 3LONA 3Q3XA 1TX8A 1G3DA 1O39A 1TONA 2R2MB 4HI3A 2HLDD 1GI9B 2QY0B 3RXHA 2J92A 2XYAA 1T31A 4GCHF 4X2YA 2A4OA 1AI8H 1VKYA 3A8AA 3I29A 2PGQB 1O5FH 4GCHG 3OY6U 3E90B 1JMOH 2BQ6B 4AFSA 8GCHF 1CHOG 3KN2A 5C5OA 1IQEA 5K7RA 3V3MA 2C4FH 1MH0A 4YLQH 2UUFB 3LGVA 5CDFE 2BLOA 4P02A 3M5OA 1D6RA 1O2LA 2ZDKA 1A7SA 1BBRK 3RM0H 4A6LA 3M5LA 3SV2H 5FX5A 3SNDA 2BY9X 5C1UA 3RC5A 5JB9S 4H6SB 1Z6JH 1A2CH 4K8BA 1LHDH 3LJJA 3UR6A 3PRBA 2O8LA 5LGOA 4AZ2B 4XBCA 2D8WA 1A5GH 3PO1B 3T5FH 1ZMJA 2Z9GA 1V2OT 2ZU5A 3UFAA 4J1YA 5FAHA 1RIWB 1VITH 1IQGA 4LZ4B 5CHAB 2FDAA 1OX1A 1ZPZA 4MPXA 1BDAA 1P2JA 4XE4A 2JJ2D 3TH4H 4MG3A 1FIZA 1E1RD 3MH4A 5FL7D 4K60A 3M36A 1SQAA 3UIRA 2GMTC 4BTTB 4CRBA 3D62A 1GBKA 1DFPA 5DP5A 5DP8A 1C5TA 3A7XA 2Y7XA 2DUCA 2Z7FE 1G2LA 2ZO3H 4Y7AA 5EU8A 4NA7A 1YWUA 2RG3A 3F9HA 3SORA 1K21H 4JMYA 1S6FA 1C1WH 1KMHB 4NFFA 1AUJA 1PYTD 4DT4A 1A0HB 5LH8A 2XBWA 3OE7D 1Y3VA 2Y5GA 3LH1A 3QZRA 3HKJB 1AWFH 2ZTZA 1FAXA 2F43B 3RXQA 1GBHA 4Y7BA 4K3JA 1BTHH 2J98A 1FNIA 2BDAA 1F0TA 3AW1A 2BOHB 1P11E 4AYVB 4X1SU 1P2KA 4JZEH 4OM9A 5EODA 1QNJA 2VH6A 4JK6A 3BTTE 6CHAC 1MUEB 1V2JT 2VVVA 1NTPA 1OS8A 2A7HA 1NM6A 1LKAA 1ZTKA 2H1UA 4J2YB 3W94A 4CH2B 4IMQA 4I31A 1O2HA 1BZXE 2D26C 2FLRH 2JDID 3NZIA 3N7DA 1MD8A 2VIQA 4ABAA 2F83A 5HKKD 2UWLA 1LHFH 3PB1E 3FO8D 1A1RA 5DP3A 2B7DH 2EQNA 2ZPSA 3U98H 4AFQA 1SG8B 1GJ7B 4O03A 3P8NA 1COWD 3TK6A 3SI3H 1JWTA 1V2VT 2ZU2A 3ZVBA 8KME2 5GWZA 3PMAB 2HVXA 1BBRH 1ANDA 2Y6TA 1OHHD 4WJG2 4CBOA 1DSTA 1WYKA 4FXGH 5EPYA 1W13U 4Y79A 3F2HA 1W7GH 2YNBA 5GXPA 2CXVA 3TPIZ 1K2I1 3SZEA 2ZHFH 2H9HA 1FI8A 1YPEH 2J9NA 2XC4A 2JH5D 4O3UA 2CJIA 1AB9B 3OTJE 1QTFA 2FWWA 2LP6A 4NSYA 4VGCB 3BN9A 3QK1A 3ZZAA 2A4RA 1O30A 3ZV9A 1MKWH 1PQAA 2FYRA 2FI4E 5FBEA 2FESH 1TBQH 3TGJE 1C2KA 1O2VA 5ESTE 1LVOA 1K1JA 1C4U2 1ZHRA 2QAAA 1THSH 4DG4A 1GG6C 1K1OA 1O2KA 1O3OA 1F92A 1NO9H 4OS1A 4KGAA 4TPYA 3ZZ3A 1G9IE 2ASUB 2ZGCA 1YPJH 2OC7A 3P6ZB 2XRCA 1SGPE 1QQ4A 1K9OE 1O37A 4AG2A 1AY6H 1C5XB 4WH6A 4I8KA 5EQQA 5FPTA 1WSSH 3BV9B 4A92A 1VGCB 5EQSA 3UNQA 1C5QA 1EKBB 2G4UA 2A0QB 3ZIAD 2PP6A 1CBWC 2ZU4A 2EA3A 2H9TH 3H7TA 1GHAG 3STIA 1UHBA 1O35A 3P70B 1ZLRA 2TGPZ 1TMTH 2ZQ1A 1O2TA 2YOLA 5J4QA 1VJAU 1C1NA 3IWMA 4K1EA 1C5LH 4CRCA 2C90B 1OYQA 2VVCA 1QCPA 3RXMA 4NCYA 2PSXA 6GCHG 1NFYA 4ESTE 5TCAA 3BTWE 2BD7A 4WMEA 2ALVA 2BD8A 3FP7E 3MH6A 1GGDC 1G32B 1OWIA 4A1XA 1BTWA 1PPEE 4F4OC 2UUYA 4NIWA 3SU4A 3GDSA 3GY3A 2J95A 2ZA5A 2OD3B 3LIWA 3A7TA 3M61U 3SHCH 1C2EA 2V6NA 3EE0B 1W0YH 3EDXB 1QHRB 4IN1A 1AO5A 4BAQB 4HTCH 4SGAE 5E0HA 3RU4T 4Y76A 1AFQC 2AMQA 1H9LB 4UFDH 1O5AB 2HNTC 1HUTH 1O3KA 1BA8B 1UVTH 2KCAA 3GICB 1HNEE 1SSXA 2HPQH 3RXFA 1YLNA 1LDTT 1TPAE 4B6EA 1LPZB 3RXOA 2G5NA 1C9TA 1L1JA 1VJ9U 3TNTA 2FI3E 3RC4A 4CRGA 4F49A 2A7CA 1UTLM 2A4GA 5L2ZH 2KZ4A 3F2FA 4FUJA 1THPB 3M7TA 1SGRE 1PQ8A 4XRNA 1O3PB 2QYIA 5B6LA 1FLEE 1W2KH 2GTBA 1TPSA 1EPTC 1VZQH 3KL6A 4ACBA 1TNHA 1KXEA 1NZQH 3SOSA 5C2ZA 1HAGE 1FAKH 2FOHA 1BTUA 1LVBA 1YPMH 3VG8A 4Z6AH 5IDKA 4ZHLU 2HNTF 4UFEH 2P16A 2Y5HA 3O8DA 1IHTH 1W10U 4DCDA 1CO7E 2BLVA 2FZZA 2BOKA 2KCPA 3SV8A 3DA9B 4FUDA 2ODYB 3VB3A
chains in the Genus database with same CATH topology
1FPCH 1GJ9B 5DP6A 1AVWA 2W7UA 3F6UH 2AS9A 1ESAA 3SNBA 3SU2A 2NU3E 4AOQA 3QUMP 3ATIA 2EI6A 3L6PA 2B0FA 3A80A 1MTWA 1MU8B 4WVPE 2FO9A 3T29A 1SB1H 3LU9B 3LT3A 5A0BA 3LKWA 5A8XA 1C2LA 1JOUB 2SNWA 3BTKE 3K9XB 2GV6A 1ANEA 1IQHA 1J8AA 3T62A 3DHKH 2C8WB 1A5IA 2BVXH 1GBAA 2TPIZ 3BG8A 1P02A 1GGDB 3ODDA 5F8TA 5T3HA 1O2SA 4BXSA 3MH5A 2OC8A 2JETC 3PWCA 3LJOA 1ESBA 1EZXC 4FU9A 4FUEA 1KXCA 3MU8A 1C4Y2 3SQEE 4FVDA 1HDTH 1UK2A 4ZXXH 3TLOA 1C5YB 1LVMA 2ZP0H 1GI7B 4LXBH 1UCYK 5JBCS 1W7XH 3A89A 3BTME 2GCHF 2ZFFH 2ZPQA 4CRDA 1QR3E 1BTYA 2BLWA 2Z9JA 1BQYA 4GLYA 4IS5A 1HAIH 3Q00A 1BOQA 2UWOA 1KLTA 1UVUH 5IYTA 3LGWA 2PKAB 4RSPA 1BJVA 1E36B 1O2IA 3ZZ5A 3RXKA 4X8SH 4K1TA 2GDDA 4JZIA 1IQMA 3E3TA 5E2PA 3SW2B 1TE0A 2O8WA 1DLEA 2OC0A 5DKMA 2W3KA 2ZHQH 1EAIA 5F8XA 1S5SA 1NFUA 3A86A 3RXTA 1C2IA 1KLJH 2PKSB 3PM3A 1FJSA 3RXSA 1BMMH 4KKDA 2BX4A 3AASA 2XCFA 2SGDE 1VITF 2FOCA 3NXPA 4VGCC 1JRTA 1E34B 2NU0E 4BAMB 2SGPE 1DITH 1T8MA 3ZVDA 1Y5BT 4M7GA 1BIOA 2Z6BD 3SJ8A 1Z6EA 1ELTA 2WUBA 4FUIA 1SLVB 2V3OH 2OTVA 4JZFH 1DANH 1HYLA 1ZJDA 2FM2A 3RDZA 5DP7A 1BTPA 1TQ7B 4YZUA 1IHSH 1T32A 1XXFA 4NIXA 5EOKA 4UD9H 4YLUA 1FY4A 2ZU1A 4Y11E 3MU4A 4H4FA 1XMNB 1E35B 1TX6A 1VCPA 2BB4A 1EQ9A 3SUDA 1TABE 1EXFA 3VB6A 1RXPA 3F9GA 4XDEA 1EAWA 2PFEA 3DFJA 1OP2A 2QV1A 4X2WA 3DFLA 3FAOA 1NS3A 4U32A 1LMWB 4OS5A 3TJVA 1O5EH 1ZTLA 4YTAA 2GDEH 5PTPA 1P2MA 2FS8A 1U6QA 1TAWA 4AB9A 1TB6H 2G4TA 3VFEA 2A5IA 9LPRA 4D9RA 3Q76A 2Z3CA 3S0NA 1C5VA 2TBSA 2PHBA 1FV9A 4XSKU 1GMHG 2HPPH 2P95A 1TPPA 5FPYA 4MVNA 1LO6A 2C93B 1TYNA 3GDVA 3ZVFA 2G00A 2JH0D 1UTJA 3GISB 1DWEH 2BD9A 1VITG 2GCTB 2RDLA 3SUFA 1QIXB 1OWHA 2QXGA 4TYDA 2ANKH 2I6SA 3HGPA 4CH8B 1GCTC 3TJOA 4CHAB 5FCKA 3KQCA 1GHVH 3MI4A 1IQKA 3LGUA 3SV6A 3HPTB 4CR9A 2XTTB 1INCA 3UR9A 4MNXA 3NPSA 1QB9A 3GY2A 4CHAC 1GCTB 1NRNH 1O3JA 3UWJH 3A82A 3D23A 4IGDA 2BDGA 2ZZUH 4I33A 1O3NA 2PGBB 2ZHEH 5EQRA 3TK5A 1V2ST 3R3GB 1TGCA 5JDUB 1JIRA 5T6DA 2ZCHP 2GKVE 3ZZBA 3VB4A 5HXFA 3KNXA 5L2YH 1L0ZA 3KQEA 1EJAA 1T8OA 3URCA 1QA7A 2BZ6H 1EP5A 1AN1E 5C67A 1BTXA 2M5TA 1QA0A 2Z9LA 3I78A 3A84A 2Q1JA 2ZTYA 3NCLA 1SQOA 1ZYOA 1DM4B 1O3LA 3MU0A 5C1YA 2CF9H 1K1PA 1P12E 1Q3XA 2GD4B 3GDUA 1SGFG 4AORA 3A8CA 3UNSA 1NRRH 2Y81A 1MTNB 3A81A 3ATWA 5JYIA 1HAYB 1L4DA 2VIOA 3TITA 3O8CA 2Y7ZA 4YOGA 1AIXH 3M7UA 1AVXA 2QF3A 4Y0YE 1SGYE 3SV7A 4YOJA 1OWEA 1Y59T 4NSVA 1TWXB 1TPOA 2WPMS 3LC3A 2A2QH 4XBDA 5A0CA 1V2LT 1FXYA 1EX3A 5ABWA 3EYDA 1O3GA 2ZFPH 2AIPA 4B74A 1O3FA 4UDWH 2P8OC 1J9CH 1H9HE 1C1TA 2PSYA 4AFZA 4ABFA 6ESTA 3U8TH 1HIAA 1W14U 3SGQE 1Z1IA 4YOIA 3WY8A 9ESTA 2THFB 1GMCG 1KXBA 1ZTJA 3T25A 1YPKH 1WQSA 3VGCB 1S6HA 1OKXA 3S69A 2C3SA 3BTDE 1GHXH 4I32A 2GT8A 1UMAH 4WXVA 2GZ8A 1ELVA 2BDYA 2FOMB 5HMAA 1ETTH 1HAXB 2OBOA 2BDBA 3ATLA 1LKBA 3ATMA 1D3QB 3ENSB 2F9BH 1NRPH 3F9FA 3O8BA 3VB7A 5SGAE 1D9IA 3P17H 5JPMH 3SU1A 3F1SB 1GJ4H 3OU0A 2DE8A 1YCPM 2BY5X 4LOYH 2Q6GA 3S7HB 3E6PH 5T6GA 1G3EA 2O8MA 1V3XA 3PMBB 5CE1A 4AG1A 1BB0B 3RXIA 3A7ZA 1Y3UA 3BG4B 2YNAA 1O3MA 4BOHA 3ZV8A 1GL0E 3GCTG 3CS0A 1HIAB 2PTCE 2A31A 4CR5A 2Z9IA 4ISHH 2FX6A 2WPJS 6LPRA 1F5LA 2FODA 3SJOA 1ZGVA 1GJDB 3E1XB 4YESB 1GPZA 1CU1A 1EB1H 1C9PA 3E0PB 1A0LA 2ILNA 2VWNA 1C2JA 1O38A 3LGTA 1OP0A 1G37A 1UTKA 3ZZ4A 1BTZA 4MNYA 4X8VH 4ABJA 2D2DA 1HJAB 2G52A 5C1XA 2BQWB 1T4UH 1HGTH 3VGCC 4X8TH 2NWNA 2TIOA 3CS7A 1ACBE 1L1GA 3PROA 1NU9A 3JZ2B 4TPIZ 2ZDNA 4ZUHA 1UHBB 3UQVA 1V2NT 1CT2E 2AMPA 4TY6A 3M3SA 7ESTE 3SNCA 4CRAA 1O3AA 3F9EA 1MTUA 1OPHB 4E05H 2QN5T 2UUJB 2P3UB 1PPZA 3PWBA 2FOAA 2A1DB 3SU0A 3ZYDA 1Y5AT 5EXLA 1O3DA 4X1PU 2VJ1A 4BAOB 1GVKB 3ZVGA 1EOLA 1SOTA 1P03A 1WU1A 1MZDA 3MMGA 3ZYEA 1LVYA 1K1NA 3FZZA 3SQHE 2TGTA 3DUXH 4WWYA 1WV7H 2AGIX 2J94A 3NUMA 3S9AA 3TGKE 3GY4A 1Z8JB 1P06A 1N6XA 1QJ7B 2XW9A 1GJBB 1A5HA 1ZR0A 5E0GA 3ZZ8A 2JKHA 1S81A 3TVJB 3OY5U 1V2KT 1GHWH 1FPHH 4X2VA 1BUIA 1YGCH 3RU4E 3AAVA 1TNIA 2G8TA 1V2PT 3IG6B 4ZKNU 1V2TT 1GI4A 5C5NA 4Y8YA 1B5GH 5TCCA 1UTPA 1GI1A 4UFGH 5LPEA 1TBRH 4A5TS 2ZDVH 1GBBA 4IMZA 1YPGH 2BZAA 5I25A 2J38A 3RXLA 2QA9E 3ODFA 2RCEA 1NPMA 5H4IB 3ZVEA 3BTFE 1SGEE 3QWCH 1ABJH 2ZDAH 4UFFH 3RMLH 3BG4C 3SNAA 4DVAU 3MOCA 4I8JA 1O2QA 1AHTH 1ZPCA 4NWLA 5EG4A 1SPJA 2VWMA 1TQ0B 1C5SA 5K0HA 4I7YH 5FPSA 1HFDA 1MMJN 3ELAH 3SJ9A 4WF8A 2GMTB 1DS2E 4NZLA 1QQUA 3U8OH 1GMDF 4U30A 3UUZA 5DGJA 1C4V2 2VH0A 2QF0A 4MPVA 1TALA 1YC0A 1P3CA 3P8OA 2HLCA 2GCTC 1KTSB 1H9IE 5BRRE 5CHAC 1MCTA 4D7FA 1E0FD 4X8UH 3QGJA 1TOMH 3S9CA 1YKTA 1TLDA 2Y80A 2A4QA 1SGTA 2ZFQH 3UWIA 6GCHF 5EW1H 3K2UA 1LQDB 1FN8A 2PW8H 1O36A 3EA7A 4NG9H 1DWBH 1OWKA 1SI5H 3VB5A 3ZZ6A 4Q80A 1XUJA 1CGHA 2XBYA 2FEQH 3UPEA 2LPRA 3SGAE 1AB9C 2Q6FA 3B9FH 5LPFA 1HAVB 1BT7A 4AN7A 5B6OA 1C2GA 1C5WB 4ZHMU 1O2JA 5DP4A 5GCHG 4CBNA 2ZC9H 1A4WH 4B75A 1KXDA 3S7KB 4ZMAH 2GV7A 2ZGXH 2GVFA 5A09A 1UTNA 4I8GA 1SHYA 3UTUH 2J2UA 1ZOMA 2NU2E 1PFXC 5AVDA 3RU4D 2ANWA 2F9PA 1ELFA 1NY22 1MTSA 3QO6A 1YBWA 1O3IA 4ABIA 2NU4E 2GCHG 1IOEA 4DY7B 2PTNA 1J15A 1ZHPA 3LGIA 2BY6X 3QTOH 3M5MA 3RMNH 1S0RA 1TMBH 3CP7A 3GYMA 1JIMA 3HATH 1YLCA 3M35A 5GIBA 2WYGA 1AUTC 4K1SA 1B7XB 1ZHMA 3L3TA 2OINA 1Z71A 1QURH 1ELCA 2BM2A 2QIQA 3QZQA 4X6NA 1NT1A 1A3BH 1OYTH 3Q3YA 4FUCA 1DWCH 1SLUB 2BD3A 3SNEA 1C5NH 1JRSA 1QRXA 1SFIA 1IQJA 1XM1A 3SU5A 3SU3A 1DOJA 1G2MA 1SHHB 2W5EA 1O2MA 4ISLA 1ELBA 1OP8A 1MAYA 2O8TA 1FIWA 5A2MH 2XBXA 2FOEA 3M3TA 1BRCE 4BNRA 1TIOA 1AQ7A 1TRMA 5A8YA 3EGKH 1C5OH 1DSUA 1IQLA 1NC6A 3MU5A 2ZEBA 1ANBA 1C1RA 3VXFH 3BTHE 2BVSH 4WMFA 1QJ6B 1N1LA 2J4IA 2PKAA 2JETB 2SFAA 4ABDA 2QXIA 4FVBA 1RIWC 3PMJA 4KP0A 3E91A 3EA8A 1ELAA 5DO4H 1CHOF 4HFPB 4Q7YA 1SQTA 4MPWA 3FP6E 1EZQA 3DT0H 4I8HA 2WYJA 4ISIH 1VCWA 3RMOH 3ESTA 2VGCC 1AZZA 3OX7U 4THNH 3V7TA 4Y71A 2XC0A 1H8IH 1V6DA 4BTIB 2K1QA 1EP6A 4DW2U 3SJIA 4OGYA 1DUAA 2BD5A 1N8OC 3LC5A 1F0RA 2ZQ2A 1GWAA 1A61H 1O32A 1ABIH 3LGYA 3RP2A 1ZJKA 4JYTA 2ESTE 2BTCE 1BRAA 3PLPA 1TGSZ 1DXPA 4XBBA 1GDUA 1QFKH 1C5RA 5DPAA 2IPHA 4YM9A 1QBNA 4DJZB 1P9UA 1UCYH 2WPIS 4GVUA 3D49H 4H42U 1JXPA 1XVOA 1ZMLA 2AMDA 3B23B 1VCQA 1AKSA 3E8LA 1MD7A 4OS7A 1EB2A 2ZKSA 4AGKA 3MO9A 2CF8H 2ZPRA 3KHVA 4IN2A 1EOJA 4GUXA 1P9SA 1GBDA 2VVUA 1O33A 2HWLB 1HJAC 2W3IA 2BLQA 3MHWU 3U1JB 1UVOA 4Y0ZE 2AGGX 1FUJA 1HRTH 4X2XA 4LZ1H 1D6WA 3G01A 3KGPA 2KAIA 3V13A 1F0SA 1KYNA 1ZRBA 4CRFA 2FS9A 1N8OB 2F9OA 1D3TB 4ISNA 2FYQA 4ZHAA 2H9EH 1T4VH 1YM0A 1CA0C 4K69A 4DIHH 4AYYB 4FUFA 2GP9B 1CHGA 4O3TA 5GDSH 3A87A 3BIUH 1GL1A 2AIQA 1O2PA 1O2OA 1O34A 1CVWH 3GY8A 1O5CB 1UTMA 2VNTA 2BXTH 3MWIU 1YPLH 3NWUA 2F91A 2UUKB 1VGCC 1D4PB 4E7RG 2R2WU 4K8YA 1BHXF 2XWAA 2CHAC 1X7AC 5EW2H 3RMMH 3GCHC 1V2RT 1Z8GA 1EPTA 1F0UA 2HRVA 4IC5A 1BRBE 3BEIB 1GI2A 4R8TB 4DOQA 1P10A 1CQQA 1NRSH 1P8VC 3VEQB 5JBAS 1BCUH 3QDZB 1E38B 1AU8A 3RXAA 1MQ6A 1DLKB 1GBEA 5JBTA 2O9QA 4KTCA 1AMHA 3T2NA 1NESE 1PQ7A 3RXCA 2ZFTA 4B2CA 2TGAA 1AFEH 2ODQA 1YPHC 1A3EH 1DX5M 3GCNA 1XKBC 1LHCH 4X1NU 3RXUA 4Y6DA 1TGNA 2OCVB 4YT6H 2A45B 2ZDMA 3BF6H 1CT0E 3E16B 2PUXB 1BBRE 2FX4A 1O31A 1GBCA 1WOFA 2GZ9A 1F5RA 2IJOB 1O2NA 2OUAA 3SV9A 1MBQA 1GBFA 2WUCA 3UY9A 2SGQE 1W3CA 1SL3A 1HV7A 1K1IA 1AWHB 4Y8XA 1CE5A 1FDPA 2FXRA 1K22H 4KTSA 1Y5UT 4ISOA 3QLPH 1G36A 2C8ZB 5F03A 4INHA 3PV4A 3RXGA 1C1MA 1ZSLA 1HJ9A 1O3HA 1QRZA 3KQBA 2VWOA 4A1TA 1AFQB 1Z7KA 1M9UA 1C5ZB 1TMUH 5HGGA 4E06H 1RJXB 3MNCA 1IQNA 2XCNA 1GI8B 1OWDA 7KMEH 3A8BA 1PQ5A 4A7IB 2F9UA 5J4SA 2PWXA 3H5CB 1BMLA 4MNWA 4DURA 1XX9A 1NRQH 1KY9A 3LH3A 2ODPA 1EJNA 1ZSJA 1HXEH 3T27A 4B76A 1GJ8B 1S0QA 4NA8A 1FY8E 1RTFB 5JBBS 3BSQA 4FUGA 1BJUA 5BPEA 2H6MA 4ABGA 1J17T 1AD8H 2AERH 3GCHB 4NWKA 2Z3DA 3STJA 2WV4A 1T8NA 2R9PA 4OGXA 2OQ5A 4BAKB 1GHAF 4KTUA 1GMDG 4E7NA 1HXFH 3A88A 1TNLA 4AX9H 2FPZA 1ZSKA 1C5PA 4BAHB 5DK1A 1ELEE 1FMGA 2G55A 1ZPBA 4B73A 1D3DB 2FTLE 3AW0A 1F7ZA 1RS0A 4TWYA 2HALA 2FOBA 3A7VA 4AGJA 3RLYH 2F9VA 1ETRH 2WPLS 1SGNE 3A85A 4X1QU 3LPRA 3TU7H 3A83A 1H8DH 1P01A 3RLWH 2SNVA 3Q3KA 2WPKS 3N7OA 1GJCB 4UONA 1SGIB 2A5AA 1KDQB 2R0LA 2VIDA 2ZHDA 4Q7ZA 2EI8A 3M7QA 1O3EA 5FBIA 4ZAEA