8LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Lysobacter enzymogenes
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 8lprA01
1LVOA 3GYLB 2BDYA 1FIWA 4Y8YA 5DJ7A 3ZZ7A 3EA7A 4I8LA 4ZHLU 1QJ6B 1E35B 1S84A 4X6OA 2CN0H 2HOBA 2P3TB 3RXFA 5EXLA 2Y81A 2OBOA 3VB4A 2FIRH 3IG6B 2GZ8A 1KTSB 1OP0A 2F91A 1V2NT 1YCPH 1YPEH 3GCTG 3RXUA 1C5MD 1MKWK 3KF2A 1GI5A 3Q3YA 2SGPE 4X2XA 3B8JA 1XUHA 1GI8B 2ZU1A 3UIRA 3TLOA 1J9CH 2P16A 1IQJA 3P95A 5A0BA 1TNHA 2B0FA 5EG4A 2NU0E 4KGAA 1XUFA 5FPYA 4UD9H 3PO1C 2W7UA 1JRTA 1PQ8A 1TGCA 1EJMA 2BVRH 3U8TH 3E16B 2C8ZB 4ISHH 4XDEA 8GCHF 3E0PB 1Y5UT 1YYY1 1G32B 5JB8S 1YKTA 1BHXB 2GZ7A 1CA8B 1RFNA 3QX5H 1K21H 4IMQA 2AFQB 3QTOH 4ZKNU 4Y6DA 3E91A 1HCGA 4K8BA 4ASHA 3BG4C 1BTZA 2OQUA 4TWWA 1SR5C 2QGRA 1TAWA 1CVWH 2SGDE 4CRCA 4A5TS 1YPHC 2PTNA 1RTFB 2IJOB 1GBFA 4YESB 1ZRBA 5CHAC 1RD3B 5LPFA 3TJNA 3MU8A 5BRRE 3UNSA 3SU1A 1O3KA 2BDIA 1QURH 1JBUH 1C2MA 5DP6A 5DP3A 3Q76A 2DE9A 4ISIH 1DY9A 3A8CA 1O31A 4GCHF 4LZ1H 2BD8A 1HAYB 3GY2A 2QIQA 1TBZH 3ODDA 1NT1A 6GCHG 3BTTE 1BTXA 3PV4A 2C8XB 2GMTB 4I31A 3M7TA 5LGOA 1G2MA 3MYWA 4KTCA 2FS9A 2BXUH 2M5TA 4OS4A 2GV7A 1C2IA 4B75A 1H9IE 4UFFH 1BTPA 2ANMH 3ZZ4A 1ABJH 2A4GA 1HYLA 1AU8A 3SV2H 4UFGH 3A8DA 5ETXA 1PPCE 5JB9S 5DGJA 4X1NU 2WV4A 3SHAH 1C2HA 1UTPA 1H4WA 1GJAB 5E0GA 2BVSH 1A5GH 1FY5A 1J17T 3LT3A 2WUBA 1KXCA 3SW2B 1AFQC 3NK8A 1EAXA 3Q3XA 2ZHDA 1OYQA 3MH6A 1IQLA 3SJKA 5GCHG 4MLFB 1BBRE 2CHAB 1P11E 4GUXA 5FX5A 1THSH 4ZKRU 1ELDE 1C2DA 2Q1JA 4WF8A 1WQVH 1IQNA 1XVMA 2P3UB 1J16A 3LKWA 1DSUA 2R3YA 3TK6A 1XUKA 1DX5M 1SGIB 2A4QA 2HNTE 3FVFB 3E0NB 1MMJN 1C2JA 1TMUH 1K28D 4B74A 4A1TA 2ZU3A 2C3SA 4A7IB 1YPGH 1F5RA 1V2KT 2HPQH 1OWEA 1ZMNA 1AWHB 1N8OC 1EKBB 2OTVA 4QT8C 5DP8A 3TJOA 1PFXC 1ETSH 1GBJA 1OPHB 3TH4H 3DUXH 1F5KU 4CRFA 1GWAA 1BBRK 1GJDB 3ZVFA 1VGCB 1L1NA 1SGQE 1O2RA 2WPLS 4A1VA 1S83A 1TGTA 4RKOB 3ATIA 3AVZA 5GJ4B 4HTCH 1AMHA 4BTIB 1ZPBA 1ELFA 3OY5U 3QUMP 3V7TA 3A80A 1SGYE 1QBNA 1GMHF 1ELGA 1FLEE 1HAZB 4K3JA 2A0QB 2FOAA 2O9QA 1TA6A 1UCYE 3PYHA 4IC6A 3VB5A 1QL9A 4WJG2 3K65B 1MU8B 2NU3E 1V2VT 5K0HA 2TGPZ 3T25A 4BAQB 4UONA 1YPKH 4WY3A 3CP7A 3FANA 4VGCC 1NTPA 1P2JA 1YLDA 2P3FH 3A7VA 1SGTA 1UHBA 2FX6A 2ZHEH 1TGSZ 1L1JA 4O3TA 3KN2A 2ZFFH 3ATKA 1O5BB 6CHAB 3ITIA 3DFJA 3JZ1B 4NWLA 3SNBA 3TITA 3SNCA 2PTCE 1QGFA 3M35A 1GJ7B 2G4UA 1C5PA 2G51A 3KHVA 6ESTA 1RRKA 2VIPA 1QRZA 1GMCF 2PKAA 1AE5A 3M61U 1HNEE 5DK1A 1CGIE 3RXJA 1NESE 3GY3A 2BLWA 2Z94A 2QXJA 1NU9A 4FU7A 1W3CA 1YPLH 1C1TA 4JCNA 1OWDA 4BXSA 1NS3A 1SGCA 1CT2E 1H1BA 3BG4B 1KXFA 1WV7H 3RXVA 3FP8E 1GI7B 1LMWB 1GHXH 3ZZ6A 2ZG0H 1D3TB 5DKMA 4XSKU 2RG3A 4MPVA 3DT0H 3RU4D 4KTSA 1WTHD 4H6SB 1UTNA 1TNKA 2W26A 4FU9A 2ZCKP 4JK5A 3RXRA 5EU8A 1P2MA 3BTFE 4ABHA 2RCEA 1KTTB 5L2YH 1A3EH 2BD4A 3ATLA 3BEFB 1PPFE 5AF9H 3LJJA 9ESTA 3ZZDA 1TWXB 2WYGA 4NIYA 1FZZA 4NA7A 3S9BA 5DP9A 1GL1A 2FXRA 2Z7FE 1G3BA 3K2UA 1IOEA 1A5HA 2BY8X 1QA7A 3MO3A 1P3EA 2VWOA 2ZF0H 3T62A 4K1TA 1GMDF 1CGJE 1LCYA 1O2GH 1C4U2 1PQ7A 4KKDA 2Y7ZA 1SLUB 2UUKB 1P05A 1DITH 3GY7A 2ULLA 3SGAE 1O3NA 1VJ9U 5EGMA 1EASA 2ZDAH 2ZFPH 3BF6H 1ZHMA 1MBQA 1VR1H 1HXEH 3QO6A 1VCWA 5G4BA 1DUEA 1ESTA 4J1YA 2ZTYA 3RXMA 1RGQA 1GHAF 1SGEE 2A4RA 1Y3YA 1VZQH 3SN8A 1GCTB 2BQ7B 3I77A 4I8KA 3P8GA 1HAXB 1OWKA 1BA8B 5FPSA 1BZXE 3Q00A 2FOCA 2XCNA 4WMFA 1E36B 1O2WA 2IPHA 3M7UA 4GHTA 2Y5FA 3T26A 1S85A 5TJXA 4LXBH 3UTUH 2XXLA 2Y80A 2A4OA 1NRQH 2SGAA 1NRRH 2ZFSA 1DUAA 2AGIX 4Q2KA 1C1NA 3DFLA 4JK6A 2ZU5A 4YT6H 3HATH 5DP7A 2NU4E 1S5SA 1GGDB 3VB6A 3UPEA 1SOTA 4H4FA 3SJ8A 4DG4A 3F9EA 2R2WU 3M5MA 1C5UA 4FUBA 1LPGB 4O3UA 3UFAA 1P2QA 1HBTH 4CHAB 1Z71A 2ANYA 2AMPA 2ZCHP 1TQ0B 4B2CA 1D3DB 2RA0A 3DA9B 2GKVE 4CH8B 4U32A 1GHBF 1K9OE 2Y6TA 1ARBA 4I8GA 3UR6A 1VITG 1FN6A 4GHQA 1MZDA 1O3JA 4A92A 3MOCA 1QBOA 1AN1E 1S82A 4IN2A 1ETRH 3KQEA 3RXLA 2CF9H 1T8NA 2ZP0H 3A7XA 3T2NA 1SG8B 1V6DA 1O5AB 3LH3A 1BRCE 1CE5A 1H8IH 2B8OH 2ZQ2A 1FY4A 4K5ZA 2BMGB 1RXPA 1O3MA 1C5RA 4KTUA 2THFB 3MU5A 1FJSA 3SV6A 2FX4A 1C5QA 2V3HH 3N7OA 2J94A 3D62A 1KXDA 2ZPSA 4YO9A 1ZPCA 2BDBA 3RU4E 1C4Y2 1GVZA 1UK3A 3RXOA 1AUJA 1AVXA 2XC5A 1HJAC 1GVLA 1MTSA 1AKSB 1J14A 3SUFA 2ZGJA 3AAVA 4NZQA 7GCHF 3RXEA 2HGTH 4K1SA 1BITA 1UVUH 4X6NA 1V3XA 4XBCA 5EQRA 3RMMH 4NG9H 3ELAH 3MHWU 1TNGA 1XX9A 1C5ZB 3LDXH 1OP2A 1IHTH 2QC2A 1MBMA 1GBIA 1O5FH 4I32A 1C1QA 1SGFA 2ZC9H 1SPJA 1EB1H 2AGGX 1CGHA 4X8VH 1FXYA 2CF8H 1FI8A 1EOLA 1LVBA 1THPB 2ODPA 4BAHB 2SFAA 3OTJE 1NO9H 3F6UH 4GLYA 2ZU2A 5AFZH 2PUQH 3VFEA 1DLKB 2FDAA 1GI1A 3BIVH 1H8DH 3PLPA 2ZEBA 8LPRA 1P09A 1B5GH 1CHOF 1UVSH 2H5DA 2BTCE 1UVOA 2BD3A 1LHDH 1EXFA 4B2AA 2A5KA 2FM2A 1EAIA 1TE0A 3RXPA 3LJOA 1A0LA 1TMBH 2FZZA 2H5CA 3NUMA 1PJPA 4BTUB 3AASA 4INHA 1C1RA 5A8XA 2ZCLP 1ZMJA 1ZJKA 1G3DA 2A7CA 2AH4X 4BNRA 1W2KH 2VU8E 3MU1A 5GWZA 1PQ5A 1SGRE 1K1LA 2FLBH 2W3KA 1EB2A 3RLYH 1FUJA 1CT4E 2HLCA 1MQ5A 4TY6A 3T5FH 1QTFA 4ZH8A 2PKSB 3MH7A 4LOYH 2OINA 1O2NA 1C2EA 2V0BA 3M3TA 3RXIA 3W95A 4Q7XA 1LVMA 1SB1H 1ZTLA 1GCTC 1TGBA 5C5NA 1PQAA 1IAUA 3P92A 1O3CA 4JYTA 2ZHQH 4Y0ZE 4X8SH 2JH5D 1GJ9B 3RDZA 3SORA 2A7HA 3M5NA 1DDJA 3P6ZB 1QB9A 4AX9H 1JMOH 3ZZ8A 1MUEB 1S6FA 1TB6H 3ENSB 4WH8A 3VGCB 1BMNH 2PR3A 4UDWH 1DE7H 2XC4A 3E6PH 2VINA 2H9TH 4NFFA 4AGJA 3P8OA 1GHZA 1ZGVA 2FOMB 3O8CA 1VITF 1K1PA 1QJ7B 5IDKA 3NPSA 2BLVA 4Q7ZA 5DP5A 1FNIA 1GI9B 1K1NA 3SUGA 1DICA 1B0FA 3SJIA 4MPWA 1O2IA 2BX3A 2CXVA 3BTWE 1P06A 2OCVB 1TRMA 1GDUA 1HUTH 1EP5A 1MZAA 2AIQA 5GDSH 2BY9X 1C1PA 5DO4H 5HYOA 1VGCC 8KME2 2ALPA 1EUFA 2XBYA 3A8BA 1V2PT 2EEKA 3OSYA 1O32A 1GBCA 5C5OA 3SU4A 5LH8A 1A0HB 1S0RA 4TPYA 3UWJH 1P12E 2ZO3H 4Y71A 2Z3CA 1TNLA 1O30A 3D65E 5EQQA 3EE0B 2JETB 2ODQA 1TRYA 3FP7E 1NRSH 3RXHA 1Y3WA 1FPCH 1WBGB 4ISOA 2OXSA 4BANB 5EODA 4NCYA 1G36A 1NY22 3FFGA 6LPRA 4DIIH 1AY6H 2J34A 4ZKSU 3TH2H 1RJXB 1UTLM 3SU5A 5LPEA 2ZFRH 3URCA 4DVAU 2F9OA 2XBWA 1O3OA 1T32A 1ESBA 1BRUP 1KY9A 2NWNA 2ZI2H 2PHBA 4INLA 4DJZB 1O3AA 2V35A 5JBCS 4AFUA 1SGDE 4TWYA 1O2OA 1ZYOA 5EW1H 5EQSA 3GISB 4I33A 1GJBB 1YP9A 2SGQE 1Z6JH 3FZZA 3LONA 5GPIB 3TJVA 2KAIA 1C1OA 1EZUC 3M5OA 2AIPA 1V2ST 4Y8XA 2OC1A 1DXPA 1UMAH 2FEQH 4ZXXH 3A88A 3U8OH 2PKAB 1HDTH 2IN2A 4YOIA 1GHBG 5EPYA 1KYNA 2BOHB 4FUCA 1NN6A 1DFPA 1W11U 4CR5A 1K22H 1S6HA 2VGCC 3M7QA 5JBAS 1Q2WA 4B1TA 3A8AA 1S81A 4H42U 2Q6FA 5HM9A 3D49H 3PO1B 1FDPA 4WMDA 1EAUA 1ZHRA 2BD2A 3A7YA 2Z6BD 1UVPA 3LH1A 3QGJA 3KGPA 3V13A 2GCHG 1SMFE 2VIDA 1LDTT 3AW0A 2AYWA 2TPIZ 5H4IB 1O2YA 2J38A 1PYTD 2STBE 3TU7H 3P8NA 4D7FA 7LPRA 1FY8E 1HAHH 1WU1A 4F4OC 3KNXA 1A61H 1GI3A 1Y3VA 2Z9GA 3BEIB 1AO5A 2G55A 1O2HA 3S7HB 4OS2A 1SQAA 1G2LA 1GBTA 2PWXA 2GGVB 3A86A 3ZYDA 4CHAC 5C2ZA 1BRBE 3VB7A 4OS7A 4YT7H 4IBLH 2QF3A 4X1RU 1O38A 1SGPE 1AD8H 2RA3A 2ZFTA 3UR9A 1SOZA 3SV9A 3F9GA 2FTMA 3ZVDA 7GCHG 1CHGA 2AERH 1A5IA 3MU4A 8GCHG 1K1OA 2CV3A 1ZLRA 2ZNKH 2C90B 5CHAB 1F2SE 1A1RA 2UWPA 1UTMA 3UQVA 1TNJA 2ZTXA 1HRTH 1XM1A 1C5TA 1P57B 1NROH 1Q31A 5A09A 3UREA 1HAOH 4NZLA 2ZECA 4OS5A 3RMNH 3GDUA 3BIUH 4D7GA 2BZ6H 1FMGA 2C93B 1SSXA 1TX6A 3T27A 1ZOMA 3KQCA 3C1KA 4YTAA 2HNTF 1GHWH 3EGKH 4HGCA 2XBXA 1J15A 3R0FA 2HRVA 2OC8A 3T29A 1Q3XA 4DIHH 4U01A 1QFKH 2J95A 1AZZA 4Q7YA 1O3BA 1OX1A 3S0NA 2FOGA 3EAJA 4K60A 4U2WA 4NSVA 2V3OH 1P2KA 1IQHA 3G01A 4AFSA 3M3VA 2W5EA 1AKSA 2QXIA 1GJCB 3M37A 3M3SA 1AIXH 3URDA 1IQIA 1BMMH 1HAVA 2OLGA 2BY5X 1OWIA 4WXIA 1LKBA 5DG6A 2I6SA 4FUEA 4SGBE 5DP4A 2B7DH 2BHGA 1O2KA 1HJ8A 4X6MA 2LNCA 3L3TA 2O8MA 3EA9A 1B7XB 3RLWH 1OKXA 4NA9H 5FBIA 4B71A 2PKSC 3SJ9A 4CRAA 5FAHA 1CT0E 3A85A 3GY8A 2XNIA 4MG3A 4B2BA 2G52A 1KLJH 3ATMA 4NGAH 5FCRA 4AB8A 3FZDA 3U8RH 2WYJA 3ZVEA 2BVXH 1MU6B 2ESTE 3QGNB 1P8VC 1TRNA 4WMEA 2A2XH 4AN7A 1GG6B 1O2SA 1FONA 3MNBA 3RM2H 3ATWA 4UEHH 1GJ6A 4JZIA 1O35A 7ESTE 4ZXYH 1GI6A 1M9UA 3PMJA 2ZPRA 2GTBA 1P01A 2ZU4A 2P94A 2R9PA 2GCTB 3L6PA 1ANEA 1ZJDA 3PWBA 1WTGH 1ID5H 4UFDH 1DOJA 1YPHE 5GXPA 1VJAU 3V0XA 1HPGA 3QN7A 3BV9B 2FI3E 1P0SH 4RKJB 5T6DA 3E1XB 2ANWA 4BOHA 1MQ6A 3SZNA 1GBLA 2ASUB 1VCQA 2OBQA 5AHGH 2BD9A 4YLUA 5AVDA 1O2ZA 2FOFA 3HK6B 3A7ZA 2Q6DA 1WYKA 1OWHA 2SGEE 1XUJA 1HAGE 3NZIA 3GCTF 1G37A 1GBMA 1GBKA 5C1UA 2XTTB 4I7YH 2SGFE 1VCPA 1AB9C 3I78A 2QCYA 2QN5T 3BSQA 2F9NA 2G4TA 1MKWH 3TNSA 3GCHC 3ZVGA 4AFZA 2CMYA 1JXPA 3SNEA 1UVTH 1ANBA 2BXTH 2W3IA 1ANCA 2Z3EA 1AQ7A 1C9PA 1EPTA 2G00A 2BY6X 2BDGA 4KELA 3UNRA 1SFQB 5F8ZA 1ARCA 1DY8A 1BCUH 5EW2H 4GPGA 3RXTA 1A4WH 1QQUA 1UHBB 4X0WU 2ZGCA 4LZ4B 4CR9A 3BEUA 1KIGH 1OWJA 1BMLA 1IQMA 1G3EA 1QY6A 3LGWA 3CENA 4ABEA 2ZWLH 2TGAA 2ZHFH 5T6FA 1FAXA 3ZZCA 4ISLA 4JZEH 1P9SA 4X1QU 3MFJA 2XWBI 5F8TA 1QL7A 4F49A 1O2PA 4X1SU 2D1JA 3SJOA 1C1UH 5EOKA 3LGTA 2WPJS 2BD5A 3KQDA 2FYQA 1ELBA 2O8WA 2F9BH 2VVCA 4K2YA 3ZZ9A 3O8RA 2VH0A 1WQSA 1O3DA 1Z8GA 3VXEH 1TPOA 3OY6U 4IN1A 1W10U 2GP9B 5E0HA 5FBEA 1IQGA 1HLTH 1L2EA 3MI4A 3MTYA 1XKAC 4X6PA 1QQ4A 3QLPH 3RXKA 1BJVA 1EATA 1O33A 1OOKB 2O8UA 2F83A 2A7JA 4Y11E 3TGIE 3GCOA 1D3QB 5CE1A 5TCCA 4ABGA 3ODFA 2DE8A 2BQ6B 3RM0H 3EDXB 3C27B 3F1SB 5IYTA 2ZQ1A 2ILNA 4BAMB 1F5LA 2BDCA 3NKKA 2AMQA 2FI5E 1DANH 1OYTH 2B9LA 3EQ0H 1TOMH 3SU0A 1C2KA 2ZDNA 2FYRA 1EZXC 2FMJA 3D23A 2QXHA 1BDAA 3UY9A 3QWCH 2HPPH 2PW8H 1C2FA 1O3IA 6GCHF 4WXVA 2ZPQA 1K1JA 3RXDA 2GD4B 1O2VA 3R3GB 1A3BH 2A5AA 5T3HA 1V2MT 1SI5H 3NCLA 1GBAA 1GHYH 1UCYK 1EZQA 1JIRA 1HJ9A 1TX8A 2I6QA 2O8LA 1TOCB 3PMBB 4SGAE 1L1GA 1KDQB 1SLVB 2Y82A 3TGJE 1SQOA 4NA8A 3MNCA 1GJ4H 5J4SA 1TNIA 4B73A 1W13U 3KCGH 1O2TA 2RDLA 1EJAA 1XMNB 1W0ZU 4AYYB 1LPZB 2JKHA 2C4FH 2H2ZA 1MKXK 3SGBE 1TONA 4NFEA 1TLDA 4AG2A 4IS5A 1GDQA 2J9NA 1LPKB 1EJNA 1C5OH 2QF0A 2D26C 2XW9A 4Y79A 2VVUA 2R2MB 1GCDA 1MKXH 1BUIA 1NFUA 4NIWA 4Y8ZA 3RC6A 3GY6A 1GHAG 3V3MA 1INCA 2A31A 1K1IA 4MTBA 4FUDA 6CHAC 3MMGA 1O34A 1MCTA 5B6OA 3SGQE 3E3TA 1NM6A 2PV9B 2WPIS 4JYUH 3AAUA 1LHCH 3F9FA 2P93A 3PLBA 5GCHF 1U6QA 1ZPZA 1TX7A 2UWOA 2G5VA 3I29A 3KIDU 2F9PA 5A8ZA 1CSOE 1BIOA 2EC9H 1XKBC 5I46H 3PM3A 1SHYA 2QXGA 1A46H 3PTBA 3AW1A 4PROA 2NU1E 2UWLA 3BTHE 3RXSA 2TRMA 1IQEA 1NFYA 2OC7A 4IGDA 4D76A 1E0FD 2VIOA 1GBDA 1T31A 4XOJA 1O3GA 4AB9A 3PMAB 1P2NA 4NWKA 3P8FA 2GV6A 1TMTH 1N6XA 1PPBH 3JZ2B 5J4QA 2FI4E 1IHSH 3PROA 1QJ1B 2WPMS 4TYDA 1V2LT 4O97A 3T28A 3FP6E 1BB0B 1OXGA 4ZUHA 1NPMA 1C1SA 1BMAA 4K1EA 4OGYA 3FAOA 1WAYB 2GT7A 1YLCA 1ZTKA 2BQWB 2TGDA 4FUGA 2XBVA 2GVFA 5L6NH 1GJ5H 2GCTC 3A83A 3M36A 3UQOA 3LGUA 3SOSA 1D4PB 8ESTE 1DWEH 3E8LA 1MCVA 3PLKA 1TPPA 5SGAE 5HXFA 2PGQB 5CMXH 3SUEA 1PPGE 4E7RG 4IMZA 1ZRKA 2F9VA 1FIZA 3ZZBA 1F0RA 1C5WB 3B9FH 1XXFA 3BG8A 1KXEA 2W7SA 1AVGH 3LIWA 1SL3A 1O2XA 1YGCH 1FV9A 1F92A 1TALA 4MNWA 2BYAX 4LK4A 3ZVAA 1G3CA 3KEEA 5JBTA 5FCKA 1CU1A 1TYNA 3GOVB 1YPMH 1X7AC 1RTLA 3QDZB 3CS7A 4FUIA 5E0JA 2XC0A 3MH5A 3PWCA 2D8WA 2WINI 1VITH 5FXLA 3BTKE 4CREA 2PSXA 3QTVH 3SQEE 1MAXA 3HGPA 3Q77A 4JZDH 2K1QA 5C1XA 1UK4A 1O5EH 4XBDA 1UO6A 1GMHG 1GBHA 1KLTA 1P10A 1YCPK 1QBVH 1ANDA 3UNQA 4WVPE 4CH2B 1GI0A 4R8TB 2ZGBH 5JDUB 5ABWA 1HXFH 4YOJA 1FAKH 2BDHA 1TPAE 1KSNA 1SVPA 1O39A 1TBQH 3RMLH 1C9TA 4NSYA 4MNVA 4NIVA 4AZ2B 2XWAA 2ALVA 4O9VA 3O8DA 2R0LA 2A2QH 3SU2A 3TVJB 3PB1E 1GI4A 3V12A 2QV1A 4AOQA 2FOEA 2WPHS 1XVOA 4AGKA 1AI8H 3SNDA 2G81E 4E7NA 1P03A 3SI3H 1JIMA 1MAYA 1GJ8B 4AG1A 3ZV8A 1C5NH 1MTNC 1O2MA 2Z9IA 1ZHPA 3A82A 1F0TA 2R3UA 1Y3XA 4Z0KA 1KXBA 1UTQA 2PGBB 2GX4A 1HAPH 4A1XA 3O8BA 2A45B 4BXWA 3DHKH 1MH0A 3SU3A 2EI7A 1LO6A 1LHEH 1C1WH 1C5YB 3MO9A 1WUNH 4X2WA 1DPOA 2ZIQH 4I8HA 3K6ZA 3NWUA 2ZKSA 4AORA 1GG6C 1HAVB 1GMCG 1O0DH 5HMAA 4ABBA 1KDQA 3ZVCA 3TH3H 1PPHE 1SGNE 1WSSH 1F7ZA 4JZFH 5FX6A 1IQKA 2F9UA 1C5SA 1V2WT 2V6NA 1HJAB 2BLQA 5FPTA 3MU0A 4CRBA 4ZAEA 4ZHAA 1O3FA 2A1DB 2CGAA 2VWMA 1SQTA 4AYVB 3CS0A 3SUDA 4FUFA 1O5GH 2ZFQH 1QB1A 4ZHMU 5TCAA 2H9HA 1KXAA 3H7TA 1O5CB 3HGNA 3KQBA 1XXDA 2C8WB 1GBEA 1DM4B 4ISNA 1D9IA 1RIWC 1V2OT 2TGTA 3H5CB 3NXPA 1BTWA 1MTVA 5C1YA 1AFQB 1TGNA 2PLXA 2H6MA 4RN6A 3HPTB 2BDAA 3S69A 1AB9B 1GL0E 1CBWC 1Z8RA 5I25A 4THNH 4X2VA 1DWDH 4OS1A 1CHOG 4BTTB 5PTPA 1HGTH 3MO6A 1JOUB 3SU6A 3GDSA 2HNTC 4DURA 1LHFH 1AGJA 2FWWA 2J2UA 2ZA5A 4DGJA 2B5TB 1C1VH 5ESTE 1DWCH 1HFDA 2P8OB 1MTUA 1O2JA 2NU2E 1G30B 2BB4A 3LPRA 2TIOA 1UTOA 2VGCB 4FU8A 5EXMA 2FS8A 1EAWA 2ZGXH 1K2I1 1W12U 4GSOA 4TPIZ 2FESH 4VGCB 4DT7B 1HIAB 1SBWA 3EA8A 1BTHH 4JZ1A 1ZR0A 1BBRH 2OUAA 4Z6AH 1GGDC 1LVYA 1GHVH 1NZQH 3VXFH 3EYDA 4K8YA 2PSYA 1O36A 1Y5BT 1EX3A 4Y0YE 3GDVA 4Y7BA 1J8AA 2GZ9A 3RUOA 3SQHE 3GY4A 2OP9A 3RXAA 5E2OA 9LPRA 1P2OA 4XE4A 2XYAA 5AFYH 1CBWB 1C5LH 1Z8JB 3UWIA 2SNVA 4FVBA 1AVWA 1MD8A 1TBRH 5FHTA 4X1PU 1NFXA 4UFEH 1BQYA 4E05H 3H7OA 4D8NA 2BOKA 1O2LA 1Z7KA 2FODA 1O3PB 4HFPB 2JH6D 3F9HA 3IITA 1L4DA 3GICB 3ZZ3A 2BLOA 4UE7H 1JWTA 2FTLE 3K9XB 1AE8H 2R0KA 3BTDE 3KL6A 4X8TH 1Z1IA 1D6WA 5ESBA 1LHGH 4Y76A 4MVNA 2UUYA 4INKA 4AFQA 1W8BH 1CA0B 1THRH 3P17H 2GDDA 3VEQB 4OS6A 2VB0A 1ZMLA 3GCNA 3W94A 4K69A 2JH0D 1C4V2 3BTQE 1UK2A 1ZSLA 5LPRA 2FO9A 3U98H 1C5XB 1ABIH 2UUFB 1YM0A 5GIBA 4IC5A 4J2YB 2STAE 1O3EA 3TK9A 1FY1A 3MNXA 4YM9A 1SC8U 3OU0A 5EPNA 3ZV9A 5L2ZH 2D2DA 1F0UA 4X8UH 1A7SA 1F0SA 3DD2H 1C2GA 4ABIA 1AHTH 3A89A 3L33A 1PPEE 1D3PB 1O2UA 1ELEE 4GVUA 5A2MH 1Z1JA 3RMOH 1L0ZA 1P3CA 2Z9KA 4I8JA 2SNWA 2OD3B 1HB0B 1DWBH 1W7XH 2EA3A 4HI3A 4BAOB 7KMEH 2Y7XA 1NFWA 4GCHG 3TK5A 3Q3KA 4FXGH 1QRWA 2ZHWH 1P04A 1QRXA 1DLEA 5F8XA 4R0IA 1SLWB 1T4UH 3U1IB 1CQQA 2OQ5A 1WCZA 2CJIA 1QHRB 2GMTC 1O3HA 1DVAH 2TBSA 2ZDVH 3HK3B 2G5NA 2Z9LA 4B76A 2VWLA 1V2TT 2C8YB 4IW4E 5HGGA 5BPEA 2GT8A 1TA2A 2BM2A 1O3LA 2ZGHA 3HKIB 4ZMAH 4YOGA 1LKAA 2VWNA 4D9QA 3K6YA 1P02A 5JPMH 3WY8A 4DW2U 1V2QT 3RC4A 4E06H 1RS0A 3BN9A 3HKJB 1DXWA 1S0QA 2J92A 2BX4A 3SI4H 1QNJA 1YCPM 1ORFA 1UCYH 2BY7X 1BRAA 1ZSJA 4CBNA 1ZGIA 1BOQA 1ELVA 2FP7B 2FPZA 2VNTA 1GVKB 2H9EH 1V2JT 4WWYA 1P2IA 3A7TA 2AMDA 1EPTC 2CHAC 1MTWA 1XUIA 4A6LA 3QK1A 3UUZA 4TY7A 3ZZAA 3RXBA 1C2LA 4O03A 1T8MA 1TPSA 4HZHA 1QCPA 1E37B 2YNBA 1NRNH 2A32A 3A7WA 2IOTA 3LGVA 1E38B 3E90B 1LQEA 3VGCC 3PMHB 1YBWA 1Z6EA 3S7KB 2AEIH 3STIA 2HWLB 1N6YA 4CRGA 1D6RA 1GI2A 1GDNA 5EXNA 4FVDA 1TABE 3A87A 4WH6A 1C1MA 4D9RA 3VB3A 4NIXA 1CO7E 3MNSA 1T8OA 4MQAA 4ESTE 4ABFA 3IWMA 3BTEE 2VJ1A 1BHXF 2ZZUH 3S9CA 1ZTJA 1Y8TA 3SO3A 2FOBA 4FUJA 1IQFA 4BAKB 1T8LA 1BJUA 1XUGA 4Q80A 3U1JB 4DCDA 2GCHF 1V2RT 1HAIH 4X2YA 2P59A 2Q6GA 4Y10E 1G9IE 1DSTA 2WV5A 3ZZ5A 2QA9E 4YZUA 1SHHB 2BD7A 1DS2E 3SBKA 2H1UA 3QZRA 5JBBS 2ZDKA 2JETC 4MNXA 1FN8A 2YNAA 2KAIB 1OS8A 1EPTB 1ACBE 1QR3E 5E2PA 2DUCA 2HALA 4GAWA 3RXQA 2VVVA 4CBOA 1YC0A 1SLXB 3RXGA 2AGEX 5C3NA 1GMDG 1HIAA 1LTOA 4H6TA 4DY7B 4KP0A 3BTME 5A8YA 3ESTA 1SFIA 2XCFA 2UUJB 4ABAA 3A81A 1O2QA 2XRCA 1FPHH 2ZTZA 1QB6A 4DOQA 3ZVBA 1TQ7B 3S9AA 4MNYA 3ZYEA 1Y3UA 1HV7A 1K1MA 1W0YH 4Y7AA 1Z8IB 4ZROA 4CRDA 2FOHA 5HM2A 3UOPA 3MH4A 2Y5GA 1JRSA 1OSSA 1MD7A 1EOJA 1SGFG 1NRPH 3TNTA 4ZKOU 1PYTC 1FQ3A 5F03A 1TIOA 2ODYB 3VPKA 1ESAA 1H9LB 1MTNB 1H9HE 5F6MA 1GPZA 1EQ9A 1GBBA 4JYVH 1ZZZA 1A2CH 2VIWA 2QAAA 1DT2A 1EP6A 1L4ZA 3TGKE 2FLRH 1UTKA 2ZDLA 1NC6A 1C5VA 1CA0C 5A0CA 4ABJA 3TIUA 3RP2A 5JYIA 1N1LA 1NU7B 3BTGE 3OX7U 3F68H 3U69H 4RSPA 3STJA 2VIVA 5T6GA 1RTKA 1OP8A 3SV8A 3QZQA 5DPAA 3SNAA 3TPIZ 2WUCA 3RXCA 1B0EA 2LPRA 3PTNA 1W14U 3A84A 1N8OB 2PUXB 1PPZA 2ANKH 1O37A 5E8EH 1V2UT 1QA0A 3LC3A 1E34B 1BTUA 2QY0B 1TFXA 5L30H 5C20A 3TJUA 4U30A 3GYMA 3LGIA 3OYPA 4YLQH 2A5IA 2QYIA 1RIWB 2P95A 2EI6A 5K7RA 1FY3A 1EZSC 3GCHB 4FUHA 3U9AH 1BT7A 3M5LA 4MDSA 3LOXA 1T7CA 2EI8A 2J4IA 1AZ8A 1AWFH 2Y5HA 1T4VH 1A0JA 4JMYA 4MPUA 1UJ1A 1QL8A 1ELCA 3RC5A 1UTJA 4OGXA 1KLIH 2ZDMA 1ELTA 2Z9JA 2P8OC 2O8TA 2VIQA 3LGYA 1ZSKA 2F3CE 2G8TA 1BTYA 2AS9A 3LU9B 2GDEH 1YF4A 1ELAA 1P9UA 1WOFA 1AUTC 2PFEA 1W7GH 3P70B 3SHCH 1O5DH 5C67A 4ABDA 3MWIU 3SV7A 1Y5AT 1AFEH 5A0AE 1Y59T 3B23B 1ETTH 3GY5A 2HVXA 2YOLA 4M7GA 3RU4T 2VH6A 1YPJH 3UOUA 1QIXB 2OC0A 2Z3DA 4XFQA 2BZAA 3LC5A 1LQDB 2WPKS 4MPXA 4XBBA
chains in the Genus database with same CATH superfamily
1LVOA 3GYLB 2BDYA 1FIWA 4Y8YA 5DJ7A 3ZZ7A 3EA7A 4I8LA 4ZHLU 1QJ6B 1E35B 1S84A 2KZ4A 4X6OA 3AK5A 2CN0H 2HOBA 2P3TB 3RXFA 5EXLA 2Y81A 2OBOA 3VB4A 2FIRH 3IG6B 2GZ8A 1KTSB 1OP0A 2F91A 3PRBA 1V2NT 1YCPH 1YPEH 3GCTG 3RXUA 1C5MD 1MKWK 3KF2A 1GI5A 3Q3YA 2SGPE 4X2XA 3B8JA 1XUHA 4F48B 1GI8B 2ZU1A 3UIRA 3TLOA 1J9CH 2P16A 1IQJA 3P95A 5A0BA 1TNHA 3F2FA 2B0FA 5EG4A 2NU0E 4KGAA 1XUFA 5FPYA 4UD9H 3PO1C 2W7UA 1JRTA 1PQ8A 3UAIC 1TGCA 1EJMA 2BVRH 3U8TH 3E16B 2C8ZB 4ISHH 4XDEA 8GCHF 3E0PB 1Y5UT 1YYY1 1G32B 5JB8S 1YKTA 2IPQX 1BHXB 2GZ7A 4XRNA 1CA8B 1RFNA 3QX5H 1K21H 4B6FA 4IMQA 2AFQB 3QTOH 4ZKNU 4Y6DA 3E91A 1HCGA 4K8BA 4ASHA 3BG4C 3KYFA 1BTZA 2OQUA 4TWWA 1SR5C 2QGRA 1TAWA 1CVWH 2SGDE 4CRCA 4A5TS 1YPHC 2PTNA 2WHXA 1RTFB 2IJOB 1GBFA 4YESB 1ZRBA 5CHAC 1RD3B 5LPFA 3TJNA 3MU8A 5BRRE 3UNSA 1K0HA 3SU1A 1O3KA 2BDIA 1QURH 1JBUH 1C2MA 2YMSC 4RT1A 5DP3A 5DP6A 3Q76A 2DE9A 4ISIH 1DY9A 3A8CA 1O31A 4GCHF 4LZ1H 2BD8A 2M2AA 1HAYB 3GY2A 2QIQA 1TBZH 3ODDA 1NT1A 6GCHG 3BTTE 1BTXA 3PV4A 2C8XB 2GMTB 4I31A 3M7TA 5LGOA 1G2MA 3MYWA 4KTCA 2FS9A 2BXUH 5IK2D 2M5TA 4OS4A 2GV7A 1C2IA 4B75A 1H9IE 4UFFH 1BTPA 2ANMH 3ZZ4A 1ABJH 2A4GA 1HYLA 1AU8A 3SV2H 2L74A 4UFGH 3A8DA 5ETXA 1PPCE 5JB9S 5DGJA 4X1NU 2WV4A 3SHAH 3UB0A 1C2HA 1UTPA 1H4WA 1GJAB 5E0GA 2BVSH 2QF4A 1A5GH 1FY5A 1J17T 3LT3A 2WUBA 1KXCA 3SW2B 1AFQC 3NK8A 1EAXA 3Q3XA 2ZHDA 1OYQA 3MH6A 1IQLA 4XD7D 3SJKA 5GCHG 4MLFB 1BBRE 2CHAB 1P11E 3PV5A 4GUXA 5FX5A 1THSH 4ZKRU 1ELDE 1C2DA 2Q1JA 4WF8A 1WQVH 1IQNA 1XVMA 2P3UB 1J16A 3LKWA 1DSUA 2R3YA 3TK6A 1XUKA 2KCOA 1DX5M 1SGIB 2A4QA 2HNTE 2YMSB 3FVFB 3E0NB 1MMJN 1C2JA 1TMUH 1EFRD 1K28D 5EJZA 4B74A 4A1TA 2ZU3A 2C3SA 4A7IB 4I86A 1YPGH 1F5RA 1V2KT 2HPQH 1OWEA 1ZMNA 1AWHB 1N8OC 1EKBB 2OTVA 4QT8C 5DP8A 3TJOA 1PFXC 1ETSH 1UW7A 1GBJA 1OPHB 3TH4H 3DUXH 1F5KU 4CRFA 1GWAA 1BBRK 4YXWD 1GJDB 3ZVFA 1VGCB 1L1NA 1SGQE 1O2RA 2WPLS 4A1VA 1S83A 1TGTA 4RKOB 3ATIA 3AVZA 5GJ4B 4HTCH 1AMHA 4BTIB 1ZPBA 1ELFA 3OY5U 3QUMP 3V7TA 3A80A 1SGYE 1QBNA 1GMHF 1ELGA 1FLEE 1HAZB 4K3JA 2A0QB 2FOAA 2O9QA 1TA6A 1UCYE 3PYHA 3H09A 4IC6A 3VB5A 1QL9A 4WJG2 3K65B 1MU8B 1WXRA 2NU3E 1V2VT 5K0HA 2TGPZ 3T25A 4BAQB 4UONA 1YPKH 4WY3A 3CP7A 3FANA 4VGCC 1NTPA 1P2JA 1YLDA 2P3FH 3A7VA 1SGTA 1UHBA 2CK3D 2FX6A 2ZHEH 1TGSZ 1L1JA 4O3TA 2KCAA 2ZFFH 3ATKA 3KN2A 1O5BB 6CHAB 3ITIA 3DFJA 3JZ1B 4NWLA 3SNBA 3TITA 3SNCA 2PTCE 1QGFA 3M35A 1GJ7B 2G4UA 1C5PA 2G51A 3KHVA 6ESTA 1RRKA 2VIPA 1QRZA 1GMCF 2PKAA 2YMSD 1AE5A 3M61U 1HNEE 5DK1A 1CGIE 3RXJA 1NESE 3GY3A 2BLWA 2Z94A 2QXJA 1NU9A 4FU7A 1W3CA 1YPLH 1C1TA 4JCNA 1OWDA 4BXSA 1NS3A 1SGCA 1CT2E 4FETA 1COWD 1H1BA 3BG4B 1KXFA 1WV7H 3RXVA 3VG8A 3FP8E 1GI7B 1LMWB 1GHXH 3ZZ6A 2XNDD 2ZG0H 1D3TB 5DKMA 4XSKU 2RG3A 4MPVA 4ACAA 3DT0H 2QF5A 3RU4D 4KTSA 1WTHD 4H6SB 1UTNA 1TNKA 2W26A 4FU9A 2ZCKP 4JK5A 3RXRA 5EU8A 1P2MA 3BTFE 4ABHA 2RCEA 1KTTB 5L2YH 1A3EH 2BD4A 3ATLA 3BEFB 1PPFE 5AF9H 3LJJA 9ESTA 3ZZDA 1TWXB 2WYGA 4NIYA 1FZZA 4NA7A 3S9BA 5DP9A 1GL1A 2FXRA 2Z7FE 1G3BA 3K2UA 1IOEA 1A5HA 4ASUD 2BY8X 1QA7A 3MO3A 1P3EA 2VWOA 2ZF0H 3T62A 4K1TA 1GMDF 1CGJE 1LCYA 1O2GH 1C4U2 1PQ7A 2JIZD 4KKDA 2Y7ZA 1SLUB 2UUKB 1P05A 1DITH 3GY7A 2ULLA 3SGAE 1O3NA 1VJ9U 5EGMA 1EASA 2ZDAH 2ZFPH 3BF6H 1ZHMA 1MBQA 1VR1H 1HXEH 3QO6A 1VCWA 5G4BA 1DUEA 1ESTA 2WPDD 4J1YA 2ZTYA 3RXMA 1RGQA 1GHAF 1SGEE 1W0KD 1Y3YA 2A4RA 1VZQH 3SN8A 1GCTB 2BQ7B 3I77A 4HG6A 4I8KA 3P8GA 1HAXB 1OWKA 1BA8B 5FPSA 1BZXE 3Q00A 2FOCA 2XCNA 4WMFA 1E36B 1O2WA 2IPHA 3M7UA 4GHTA 2Y5FA 3T26A 1S85A 5TJXA 4LXBH 3UTUH 2XXLA 2Y80A 2A4OA 1NRQH 2SGAA 1NRRH 2ZFSA 1DUAA 2AGIX 4Q2KA 1C1NA 3DFLA 4JK6A 2ZU5A 4YT6H 3HATH 5DP7A 2NU4E 1S5SA 1GGDB 3VB6A 3UPEA 1SOTA 4H4FA 3SJ8A 3OE7D 4DG4A 3F9EA 2R2WU 3M5MA 1C5UA 5EIYA 4FUBA 1LPGB 4O3UA 3UFAA 1P2QA 1HBTH 4CHAB 1Z71A 2ANYA 2AMPA 2ZCHP 1TQ0B 4B2CA 1D3DB 2RA0A 3DA9B 2GKVE 4CH8B 4U32A 1GHBF 1K9OE 1ARBA 2Y6TA 4I8GA 3UR6A 1VITG 1FN6A 4GHQA 1MZDA 1O3JA 4A92A 3MOCA 1QBOA 1AN1E 1S82A 1MABB 4IN2A 1ETRH 3KQEA 2GJGA 3RXLA 2CF9H 1T8NA 2ZP0H 2W6ID 3A7XA 3T2NA 4B6EA 1SG8B 1V6DA 1O5AB 3LH3A 5DSFA 5KECA 1BRCE 1CE5A 1H8IH 2B8OH 2ZQ2A 1FY4A 4K5ZA 2BMGB 1RXPA 1O3MA 1C5RA 4KTUA 2THFB 3MU5A 1FJSA 3SV6A 2FX4A 1C5QA 2V3HH 3N7OA 2J94A 3D62A 1KXDA 2ZPSA 4YO9A 1ZPCA 2BDBA 3RU4E 1C4Y2 1GVZA 1UK3A 2KM0A 3RXOA 1AUJA 1AVXA 2XC5A 1HJAC 1GVLA 1MTSA 1AKSB 1J14A 3SUFA 2ZGJA 3AAVA 4NZQA 7GCHF 3RXEA 2HGTH 4K1SA 1BITA 1UVUH 4X6NA 1V3XA 4XBCA 5EQRA 3RMMH 4NG9H 3ELAH 3MHWU 3SYJA 1TNGA 1XX9A 1C5ZB 3LDXH 1OP2A 1IHTH 2QC2A 1MBMA 1GBIA 1O5FH 4I32A 1C1QA 1SGFA 2ZC9H 1SPJA 1EB1H 2AGGX 1CGHA 4X8VH 1FXYA 2CF8H 1FI8A 1EOLA 1LVBA 1THPB 2ODPA 4BAHB 2SFAA 3OTJE 1NO9H 3F6UH 4GLYA 2ZU2A 5AFZH 2PUQH 3VFEA 1DLKB 2FDAA 1GI1A 4TSFD 3BIVH 1H8DH 3PLPA 2ZEBA 8LPRA 1P09A 1B5GH 1CHOF 1H8ED 1UVSH 2H5DA 2KFWA 2BTCE 1UVOA 2BD3A 1LHDH 1EXFA 4B2AA 2A5KA 2FM2A 1EAIA 1TE0A 3RXPA 3LJOA 1A0LA 1TMBH 2FZZA 2H5CA 3NUMA 1PJPA 4BTUB 3AASA 4INHA 1C1RA 5A8XA 2ZCLP 1ZMJA 1ZJKA 1G3DA 2A7CA 2AH4X 4BNRA 1W2KH 2VU8E 3MU1A 5GWZA 1PQ5A 1SGRE 1K1LA 2FLBH 2W3KA 1EB2A 3RLYH 1FUJA 1CT4E 2HLCA 1MQ5A 4TY6A 3T5FH 3N7EA 1QTFA 4ZH8A 2PKSB 3MH7A 4LOYH 2OINA 1O2NA 1C2EA 1QZ8A 2V0BA 3M3TA 3RXIA 3W95A 1H8HD 4Q7XA 1LVMA 1SB1H 1ZTLA 1GCTC 1TGBA 5C5NA 1PQAA 1IAUA 3P92A 1O3CA 4JYTA 2ZHQH 4Y0ZE 4X8SH 2JH5D 1GJ9B 3RDZA 3SORA 2A7HA 3M5NA 1DDJA 3P6ZB 1QB9A 4Q63A 4AX9H 1JMOH 3ZZ8A 1MUEB 1S6FA 1TB6H 3ENSB 4WH8A 3VGCB 1BMNH 2PR3A 4UDWH 1DE7H 2XC4A 3E6PH 2VINA 2H9TH 4NFFA 2KX4A 4AGJA 3P8OA 5C94A 1GHZA 1ZGVA 3DSGA 2FOMB 3O8CA 1VITF 1K1PA 1QJ7B 5IDKA 3NPSA 2BLVA 4Q7ZA 5DP5A 1FNIA 1GI9B 1K1NA 3SUGA 1DICA 1B0FA 3SJIA 4MPWA 1O2IA 2BX3A 2CXVA 3BTWE 1P06A 2OCVB 1TRMA 1GDUA 1HUTH 1EP5A 1MZAA 2AIQA 5GDSH 2BY9X 1C1PA 5DO4H 5HYOA 1VGCC 3CNRA 8KME2 2ALPA 1EUFA 2XBYA 3A8BA 1V2PT 2EEKA 3OSYA 1O32A 1GBCA 5C5OA 3SU4A 5LH8A 1A0HB 1S0RA 2XOKD 4TPYA 3UWJH 1P12E 2ZO3H 4Y71A 2Z3CA 1TNLA 1O30A 3D65E 5EQQA 4FOUC 3EE0B 2JETB 2ODQA 1TRYA 3FP7E 1NRSH 3RXHA 1Y3WA 1FPCH 1WBGB 4ISOA 2OXSA 1E1QD 4BANB 5KGOA 5EODA 4NCYA 1G36A 1NY22 3FFGA 6LPRA 4DIIH 1AY6H 2J34A 4ZKSU 3TH2H 1RJXB 1UTLM 3SU5A 5LPEA 2ZFRH 3URCA 4DVAU 2F9OA 2XBWA 1O3OA 5HIZA 1T32A 5CHBA 1ESBA 1BRUP 1KY9A 2NWNA 2ZI2H 2PHBA 4INLA 4DJZB 1O3AA 2V35A 5JBCS 4AFUA 1SGDE 4TWYA 1O2OA 1ZYOA 5EW1H 5EQSA 3GISB 4I33A 1GJBB 1YP9A 2SGQE 1Z6JH 3FZZA 3LONA 5GPIB 3TJVA 2KAIA 1C1OA 1EZUC 3M5OA 2AIPA 1V2ST 4Y8XA 2HLDD 2J5UA 2OC1A 1DXPA 1UMAH 2FEQH 4ZXXH 3A88A 3U8OH 2PKAB 1HDTH 2IN2A 4YOIA 1GHBG 5EPYA 1KYNA 2BOHB 4FUCA 1NN6A 2AHME 1DFPA 1W11U 4CR5A 1K22H 1S6HA 2VGCC 3M7QA 5JBAS 1Q2WA 4B1TA 3A8AA 3PV2A 1S81A 4H42U 2Q6FA 5HM9A 3D49H 3PO1B 1FDPA 4WMDA 1EAUA 1ZHRA 2BD2A 3A7YA 2Z6BD 1UVPA 3LH1A 3QGJA 3KGPA 3V13A 2GCHG 1SMFE 1LDTT 2VIDA 3AW0A 2AYWA 2TPIZ 5H4IB 1O2YA 2J38A 1PYTD 2STBE 3TU7H 3P8NA 4D7FA 7LPRA 1FY8E 1HAHH 1WU1A 4F4OC 3KNXA 1A61H 1GI3A 1Y3VA 2Z9GA 3BEIB 1AO5A 2G55A 1O2HA 2KCYA 3S7HB 4OS2A 1SQAA 1G2LA 3FO8D 1GBTA 2PWXA 2GGVB 3A86A 3ZYDA 4CHAC 5C2ZA 1BRBE 4TT3D 3VB7A 4OS7A 4YT7H 4IBLH 2QF3A 4X1RU 1O38A 1SGPE 1AD8H 2RA3A 2ZFTA 3UR9A 2KR7A 1SOZA 3SV9A 3SZEA 3F9GA 2FTMA 3ZVDA 7GCHG 1CHGA 2AERH 3PRDA 1A5IA 3MU4A 3DSPA 8GCHG 1K1OA 2CV3A 1ZLRA 2ZNKH 2C90B 5CHAB 1F2SE 1A1RA 2UWPA 1UTMA 2V7QD 3UQVA 1TNJA 2ZTXA 1HRTH 1XM1A 1C5TA 1P57B 1NROH 1Q31A 5A09A 3UREA 1HAOH 4NZLA 2ZECA 4OS5A 3RMNH 3GDUA 3BIUH 4D7GA 2BZ6H 1FMGA 2C93B 1SSXA 1TX6A 3F0PA 3T27A 1ZOMA 3KQCA 3C1KA 4YTAA 2HNTF 1GHWH 3EGKH 4HGCA 2XBXA 1J15A 3R0FA 2HRVA 2OC8A 5FL7D 3T29A 1Q3XA 4DIHH 4U01A 1QFKH 2J95A 1AZZA 4Q7YA 1O3BA 5GNDA 1OX1A 3S0NA 2FOGA 3EAJA 4K60A 4U2WA 4NSVA 2V3OH 5EJLA 1P2KA 1IQHA 3G01A 4AFSA 3M3VA 2W5EA 1AKSA 2QXIA 1GJCB 3M37A 3M3SA 1AIXH 3URDA 1IQIA 1BMMH 1HAVA 2OLGA 3GS9A 2BY5X 1OWIA 4WXIA 1LKBA 5DG6A 2I6SA 4FUEA 4SGBE 5DP4A 2B7DH 2BHGA 1O2KA 2K0QA 1HJ8A 4X6MA 2LNCA 1NBMD 3F2HA 3L3TA 2O8MA 3EA9A 1B7XB 3RLWH 1OKXA 4NA9H 5FBIA 4B71A 2PKSC 3SJ9A 4CRAA 5FAHA 1CT0E 3A85A 3GY8A 2XNIA 4MG3A 4B2BA 2G52A 1KLJH 3ATMA 4NGAH 5FCRA 4AB8A 3FZDA 3U8RH 2WYJA 3ZVEA 2BVXH 1MU6B 2ESTE 2F43B 3QGNB 1P8VC 1TRNA 4WMEA 2A2XH 4AN7A 1GG6B 1O2SA 1FONA 3MNBA 3RM2H 3ATWA 4UEHH 1GJ6A 4JZIA 1O35A 7ESTE 4ZXYH 1GI6A 1M9UA 3PMJA 3N7DA 2ZPRA 2GTBA 1P01A 2ZU4A 2P94A 3EE7A 2R9PA 2GCTB 3L6PA 1ANEA 1ZJDA 3PWBA 1WTGH 5C0UA 1ID5H 4UFDH 1DOJA 1YPHE 5GXPA 1VJAU 3V0XA 1HPGA 3QN7A 3BV9B 2FI3E 1P0SH 4RKJB 5T6DA 3E1XB 2ANWA 4BOHA 1MQ6A 3SZNA 1GBLA 2ASUB 2OBQA 1VCQA 2KCPA 5AHGH 2BD9A 4YLUA 5AVDA 1O2ZA 2FOFA 3HK6B 3A7ZA 2Q6DA 1WYKA 1OWHA 2SGEE 1XUJA 1HAGE 3NZIA 3GCTF 1G37A 1GBMA 1GBKA 5C1UA 1FX0B 2XTTB 3W1EA 2SGFE 4I7YH 1VCPA 1AB9C 3I78A 2EY4C 2QCYA 2QN5T 3BSQA 2F9NA 2G4TA 1MKWH 3TNSA 3GCHC 3ZVGA 4AFZA 2CMYA 4OM9A 1JXPA 3SNEA 1UVTH 1ANBA 2BXTH 2W3IA 1ANCA 2Z3EA 1AQ7A 1C9PA 1EPTA 2G00A 2BY6X 2BDGA 4KELA 3UNRA 1SFQB 5F8ZA 1ARCA 1DY8A 1BCUH 3OFND 4GPGA 3RXTA 5EW2H 1A4WH 1QQUA 1UHBB 4X0WU 2ZGCA 4LZ4B 4CR9A 3BEUA 1KIGH 1OWJA 1BMLA 1IQMA 1G3EA 1QY6A 3LGWA 3CENA 4ABEA 2ZWLH 2TGAA 2ZHFH 5T6FA 1FAXA 3ZZCA 4ISLA 4JZEH 1P9SA 4X1QU 3MFJA 2XWBI 5F8TA 1QL7A 4F49A 1O2PA 4X1SU 2D1JA 3SJOA 1C1UH 5EOKA 2HVYB 1SQRA 2WV9A 3LGTA 2WPJS 2BD5A 3KQDA 2FYQA 1ELBA 2O8WA 2F9BH 2VVCA 4K2YA 3ZZ9A 3O8RA 2VH0A 1WQSA 1O3DA 1Z8GA 3VXEH 1TPOA 3OY6U 4IN1A 1W10U 2GP9B 5E0HA 5FBEA 1IQGA 1HLTH 1L2EA 3MI4A 3MTYA 1XKAC 4X6PA 1QQ4A 3QLPH 3RXKA 1BJVA 1EATA 1O33A 1OOKB 2O8UA 2F83A 2A7JA 4Y11E 3TGIE 3GCOA 1D3QB 5CE1A 5TCCA 4ABGA 3ODFA 2DE8A 2BQ6B 3RM0H 3EDXB 3C27B 3F1SB 5IYTA 2ZQ1A 2ILNA 4BAMB 1F5LA 2BDCA 3NKKA 2AMQA 5C17A 2FI5E 1DANH 1OYTH 2B9LA 3EQ0H 1TOMH 3SU0A 1C2KA 2ZDNA 2FYRA 1EZXC 2FMJA 3D23A 2QXHA 1BDAA 3UY9A 3QWCH 2HPPH 2PW8H 1C2FA 1O3IA 6GCHF 4WXVA 2ZPQA 1K1JA 3RXDA 2GD4B 1O2VA 3R3GB 1A3BH 2A5AA 5T3HA 1V2MT 1SI5H 1S6LA 3NCLA 1GBAA 1GHYH 1UCYK 1EZQA 1JIRA 1HJ9A 1TX8A 2I6QA 2O8LA 1TOCB 3PMBB 4SGAE 1L1GA 1KDQB 1SLVB 2Y82A 3TGJE 1SQOA 4NA8A 3MNCA 1GJ4H 5J4SA 1TNIA 4B73A 1W13U 3KCGH 1O2TA 2RDLA 1EJAA 1XMNB 4P00A 1W0ZU 4AYYB 4DT4A 1LPZB 2JKHA 2C4FH 2H2ZA 1MKXK 3SGBE 1TONA 4NFEA 1TLDA 4AG2A 4IS5A 1GDQA 2J9NA 1LPKB 1EJNA 1C5OH 2QF0A 2D26C 2XW9A 4Y79A 2VVUA 2R2MB 1GCDA 1MKXH 1BUIA 1NFUA 4NIWA 4Y8ZA 3RC6A 3GY6A 1GHAG 3V3MA 1INCA 2A31A 1K1IA 4MTBA 4FUDA 6CHAC 3MMGA 1O34A 1MCTA 5B6OA 3SGQE 5KEDA 3E3TA 1NM6A 2PV9B 2JJ2D 2WPIS 4JYUH 3AAUA 1LHCH 3F9FA 2P93A 3PLBA 5GCHF 1U6QA 1ZPZA 1TX7A 2UWOA 2G5VA 3I29A 3KIDU 2F9PA 5A8ZA 1CSOE 1BIOA 2EC9H 1XKBC 5I46H 3PM3A 1SHYA 2QXGA 1A46H 3PTBA 3AW1A 4PROA 2NU1E 2UWLA 3BTHE 3RXSA 2TRMA 1IQEA 1NFYA 2OC7A 4IGDA 4D76A 1E0FD 2VIOA 1GBDA 1T31A 4XOJA 1O3GA 4AB9A 3PMAB 1P2NA 4NWKA 3P8FA 2GV6A 1TMTH 1N6XA 1PPBH 3JZ2B 4RT0A 5J4QA 2FI4E 1IHSH 3PROA 1QJ1B 2WPMS 4TYDA 1V2LT 4O97A 1BMFD 2IJD1 3T28A 3FP6E 1BB0B 1OXGA 4ZUHA 1NPMA 1C1SA 1BMAA 4K1EA 4OGYA 3FAOA 1WAYB 2GT7A 1W0JD 1YLCA 1ZTKA 2BQWB 2TGDA 3F0OA 4FUGA 2XBVA 2GVFA 5L6NH 1GJ5H 2WSSD 2GCTC 3A83A 3M36A 3UQOA 3LGUA 3SOSA 1D4PB 8ESTE 1DWEH 3E8LA 1MCVA 3PLKA 1TPPA 5SGAE 5HXFA 1YY3A 2PGQB 5CMXH 1YWUA 3SUEA 1PPGE 4E7RG 4IMZA 3ZIAD 2WPKS 1ZRKA 2F9VA 1FIZA 3ZZBA 1F0RA 1C5WB 3B9FH 1XXFA 3BG8A 1KXEA 2W7SA 4ACBA 1AVGH 3LIWA 1SL3A 1O2XA 1YGCH 1FV9A 1F92A 1TALA 4MNWA 2BYAX 4LK4A 3ZVAA 1G3CA 3KEEA 5JBTA 5FCKA 1CU1A 1TYNA 3GOVB 1YPMH 1X7AC 1RTLA 3QDZB 3CS7A 4FUIA 5E0JA 2XC0A 1WDIA 3MH5A 2D8WA 3PWCA 2WINI 3U28C 1VITH 5FXLA 3BTKE 4CREA 2PSXA 3QTVH 3SQEE 1MAXA 3HGPA 3Q77A 4JZDH 2K1QA 5C1XA 1UK4A 1O5EH 4XBDA 1UO6A 1GMHG 1GBHA 1KLTA 1P10A 1YCPK 1QBVH 2QE7D 1ANDA 3UNQA 4WVPE 4CH2B 1GI0A 4R8TB 2ZGBH 5JDUB 5ABWA 1HXFH 4YOJA 1FAKH 2BDHA 1TPAE 1KSNA 1SVPA 1O39A 3RMLH 1C9TA 4NSYA 4MNVA 4NIVA 4AZ2B 2J98A 2XWAA 2L6OA 2ALVA 4O9VA 3O8DA 2K8IA 2R0LA 2A2QH 1VKYA 3SU2A 3TVJB 3PB1E 1GI4A 3V12A 2QV1A 4AOQA 2FOEA 2WPHS 1XVOA 4AGKA 1AI8H 3SNDA 2G81E 4E7NA 1P03A 3SI3H 2W6JD 1JIMA 1MAYA 1GJ8B 4AG1A 3ZV8A 1C5NH 3FKSD 1MTNC 1O2MA 2Z9IA 1ZHPA 3A82A 1F0TA 2R3UA 1Y3XA 4Z0KA 1KXBA 1UTQA 2PGBB 2GX4A 1HAPH 4A1XA 3O8BA 2A45B 4BXWA 3DHKH 1MH0A 3SU3A 2EI7A 1LO6A 1LHEH 1C1WH 1C5YB 3MO9A 2WZQA 1WUNH 4X2WA 1DPOA 2ZIQH 4I8HA 3K6ZA 3NWUA 2ZKSA 4AORA 1GG6C 1HAVB 1GMCG 1O0DH 5HMAA 4ABBA 1KDQA 3ZVCA 3TH3H 1PPHE 1SGNE 1WSSH 1F7ZA 4JZFH 5HKKD 5FX6A 1IQKA 2F9UA 1C5SA 2F4LA 1V2WT 2V6NA 1HJAB 2BLQA 5FPTA 3MU0A 3OEHD 4CRBA 4ZAEA 4ZHAA 3OAAD 1O3FA 5F53A 5B6LA 2A1DB 2CGAA 2VWMA 1SQTA 4AYVB 3CS0A 3SUDA 2RDEA 4FUFA 1O5GH 2ZFQH 1QB1A 4ZHMU 5TCAA 2H9HA 1KXAA 3H7TA 1O5CB 2J98B 3HGNA 3KQBA 1XXDA 2C8WB 1GBEA 1DM4B 4ISNA 1D9IA 1RIWC 1V2OT 2TGTA 3H5CB 3NXPA 1BTWA 1MTVA 5C1YA 1AFQB 1TGNA 2PLXA 3KQ5A 2H6MA 4RN6A 3HPTB 2BDAA 3S69A 1AB9B 1GL0E 1CBWC 1Z8RA 5I25A 4THNH 4X2VA 1DWDH 4OS1A 1CHOG 4BTTB 5PTPA 1HGTH 3MO6A 1JOUB 3SU6A 3GDSA 2HNTC 4DURA 2J2UA 1LHFH 1AGJA 2FWWA 2ZA5A 4DGJA 2B5TB 1C1VH 5ESTE 1DWCH 1HFDA 2P8OB 1MTUA 1O2JA 2NU2E 1G30B 2BB4A 3LPRA 2TIOA 1UTOA 2VGCB 4FU8A 2PP6A 2FS8A 5EXMA 1EAWA 2ZGXH 1K2I1 1W12U 3N99A 4GSOA 2FESH 4TPIZ 4VGCB 4DT7B 1HIAB 1SBWA 3EA8A 1YLNA 1BTHH 4JZ1A 1ZR0A 1BBRH 2OUAA 4Z6AH 1GGDC 1LVYA 1GHVH 2LELA 1NZQH 3VXFH 2VBCA 3EYDA 4K8YA 2PSYA 1O36A 1Y5BT 1EX3A 4Y0YE 3GDVA 4Y7BA 1J8AA 2GZ9A 3NRLA 3RUOA 3SQHE 3GY4A 2OP9A 3RXAA 5E2OA 9LPRA 1P2OA 4XE4A 2XYAA 5AFYH 1CBWB 1C5LH 1Z8JB 3UWIA 2SNVA 4FVBA 1AVWA 1MD8A 3FOAA 1TBRH 5FHTA 4X1PU 1NFXA 4UFEH 1BQYA 4E05H 3H7OA 4D8NA 2BOKA 1O2LA 1Z7KA 1E1RD 1O3PB 2FODA 4HFPB 2JH6D 3F9HA 3IITA 1L4DA 3GICB 3ZZ3A 2BLOA 4UE7H 1JWTA 2FTLE 3K9XB 1AE8H 2R0KA 3BTDE 3KL6A 4X8TH 5EJ1A 1Z1IA 1D6WA 5ESBA 1LHGH 4Y76A 4MVNA 2UUYA 4INKA 4AFQA 1W8BH 1CA0B 1THRH 3P17H 2GDDA 3VEQB 2JJ1D 4OS6A 2VB0A 1ZMLA 3GCNA 3W94A 4K69A 2J97A 2JH0D 1C4V2 3BTQE 1UK2A 1ZSLA 5LPRA 2FO9A 4F55A 3U98H 3MQKC 1C5XB 1ABIH 2UUFB 1YM0A 5GIBA 4IC5A 4J2YB 2STAE 1O3EA 3TK9A 1FY1A 3MNXA 4YM9A 1SC8U 3OU0A 5EPNA 3ZV9A 5L2ZH 2D2DA 1F0UA 4X8UH 1A7SA 1F0SA 5T1VA 3DD2H 1C2GA 4ABIA 1AHTH 3A89A 3L33A 3F2GA 1PPEE 1D3PB 1O2UA 1ELEE 4GVUA 5A2MH 1Z1JA 3RMOH 1L0ZA 1P3CA 2Z9KA 4I8JA 2SNWA 2RFKC 2OD3B 1HB0B 1DWBH 1W7XH 2EA3A 4HI3A 4BAOB 7KMEH 2Y7XA 1NFWA 4GCHG 3TK5A 3Q3KA 4FXGH 1QRWA 2ZHWH 1P04A 1QRXA 1DLEA 5F8XA 4R0IA 1SLWB 1T4UH 3U1IB 1CQQA 2OQ5A 1WCZA 2CJIA 1QHRB 2GMTC 1O3HA 1DVAH 4P02A 2TBSA 2ZDVH 3HK3B 2G5NA 3WW7A 2Z9LA 4B76A 2VWLA 1V2TT 4RI0A 2C8YB 4IW4E 5HGGA 5BPEA 2GT8A 1TA2A 2BM2A 1O3LA 2ZGHA 3HKIB 4ZMAH 4YOGA 3KYGA 1LKAA 2VWNA 4D9QA 3K6YA 1P02A 5JPMH 3WY8A 4DW2U 1V2QT 3RC4A 4E06H 1RS0A 3BN9A 3HKJB 1DXWA 1S0QA 2J92A 2BX4A 3SI4H 1QNJA 1YCPM 1ORFA 1UCYH 2BY7X 1BRAA 1ZSJA 4CBNA 1ZGIA 1BOQA 1ELVA 2FP7B 2FPZA 1GVKB 2VNTA 2H9EH 1V2JT 4WWYA 2LP6A 1P2IA 3A7TA 5C0TA 2AMDA 1EPTC 2CHAC 1MTWA 1XUIA 4A6LA 3QK1A 3UUZA 4TY7A 3ZZAA 3RXBA 1C2LA 4O03A 1T8MA 1TPSA 4HZHA 4ZCNA 1QCPA 1E37B 2YNBA 1NRNH 2A32A 3A7WA 2IOTA 3LGVA 1E38B 3E90B 1LQEA 3VGCC 4Q4LA 3PMHB 1YBWA 1Z6EA 3S7KB 1E79D 2AEIH 3STIA 2HWLB 1N6YA 4CRGA 1D6RA 1GI2A 3DCLA 1GDNA 5EXNA 4FVDA 1TABE 3A87A 4WH6A 4M9FA 1C1MA 4D9RA 3VB3A 4NIXA 1CO7E 3MNSA 1T8OA 4MQAA 4ESTE 4ABFA 3IWMA 3BTEE 2VJ1A 1BHXF 2ZZUH 3S9CA 1ZTJA 1Y8TA 3SO3A 2FOBA 4FUJA 1IQFA 4BAKB 1T8LA 1BJUA 1XUGA 4Q80A 2EQNA 3U1JB 4DCDA 2GCHF 1V2RT 1OHHD 1HAIH 4X2YA 2P59A 2Q6GA 4Y10E 1G9IE 1DSTA 2WV5A 3ZZ5A 2QA9E 4YZUA 1SHHB 2BD7A 1DS2E 3SBKA 2H1UA 3QZRA 5JBBS 2ZDKA 2JETC 4MNXA 1FN8A 2YNAA 2KAIB 1OS8A 1EPTB 1ACBE 1QR3E 5E2PA 2DUCA 2HALA 4GAWA 3RXQA 2VVVA 4CBOA 1YC0A 1SLXB 3RXGA 2AGEX 5C3NA 1GMDG 1HIAA 1LTOA 4H6TA 4DY7B 4KP0A 3BTME 5A8YA 3ESTA 1SFIA 2XCFA 2UUJB 4ABAA 2JDID 3DSOA 3A81A 1O2QA 2XRCA 1FPHH 2ZTZA 1QB6A 4DOQA 3FN8A 3ZVBA 1TQ7B 3S9AA 4MNYA 3ZYEA 1Y3UA 1HV7A 3WWBA 1K1MA 3OTPA 1W0YH 4Y7AA 1Z8IB 4ZROA 4CRDA 2FOHA 5HM2A 3UOPA 3MH4A 2Y5GA 1JRSA 1OSSA 1MD7A 1EOJA 1SGFG 1NRPH 3TNTA 4ZKOU 1PYTC 1FQ3A 5F03A 1TIOA 2ODYB 3VPKA 1ESAA 1H9LB 1MTNB 1H9HE 5F6MA 1GPZA 1EQ9A 1GBBA 4JYVH 1ZZZA 1A2CH 2VIWA 2QAAA 1DT2A 1EP6A 1L4ZA 3TGKE 2FLRH 1UTKA 2ZDLA 2OK5A 1NC6A 1C5VA 1CA0C 5A0CA 4ABJA 3TIUA 3RP2A 5JYIA 1N1LA 1NU7B 3BTGE 3OX7U 3F68H 3U69H 4RSPA 3STJA 2VIVA 5T6GA 1RTKA 1KMHB 1OP8A 3SV8A 3QZQA 5DPAA 3SNAA 3TPIZ 2WUCA 3RXCA 1B0EA 2LPRA 3PTNA 1W14U 3A84A 1N8OB 2PUXB 1PPZA 2ANKH 1O37A 5E8EH 1V2UT 1QA0A 3LC3A 1E34B 4AC9A 1BTUA 2QY0B 1TFXA 5L30H 5C20A 3TJUA 4U30A 3GYMA 3LGIA 3OYPA 4YLQH 2A5IA 2QYIA 1RIWB 2P95A 2EI6A 5K7RA 1FY3A 1EZSC 1SKYE 3GCHB 4FUHA 3U9AH 1BT7A 3M5LA 4MDSA 3LOXA 1T7CA 2EI8A 3WWFA 2J4IA 1AZ8A 1AWFH 2Y5HA 1T4VH 1A0JA 4JMYA 4MPUA 1UJ1A 3F3BA 1QL8A 1ELCA 3RC5A 5CDFE 1UTJA 4OGXA 1KLIH 2ZDMA 1ELTA 5HIYA 2Z9JA 2P8OC 2O8TA 2VIQA 3LGYA 1ZSKA 2F3CE 2G8TA 1BTYA 2AS9A 3LU9B 2GDEH 4Z1MD 1YF4A 1ELAA 1P9UA 1WOFA 1AUTC 2PFEA 1W7GH 2V3MA 3P70B 3SHCH 1O5DH 5C67A 4ABDA 5DN6D 3MWIU 3SV7A 1Y5AT 1AFEH 5A0AE 1Y59T 3B23B 1ETTH 3GY5A 2HVXA 2YOLA 4M7GA 3RU4T 2VH6A 1YPJH 3UOUA 1QIXB 2OC0A 1NBME 2Z3DA 4XFQA 3OEED 2BZAA 3LC5A 1LQDB 1TBQH 4MPXA 4XBBA
chains in the Genus database with same CATH topology
1LVOA 3GYLB 2BDYA 1FIWA 4Y8YA 5DJ7A 3ZZ7A 3EA7A 4I8LA 4ZHLU 1QJ6B 1E35B 1S84A 4X6OA 2CN0H 2HOBA 2P3TB 3RXFA 5EXLA 2Y81A 2OBOA 3VB4A 2FIRH 3IG6B 2GZ8A 1KTSB 1OP0A 2F91A 1V2NT 1YCPH 1YPEH 3GCTG 3RXUA 1C5MD 1MKWK 3KF2A 1GI5A 3Q3YA 2SGPE 4X2XA 3B8JA 1XUHA 1GI8B 2ZU1A 3UIRA 3TLOA 1J9CH 2P16A 1IQJA 3P95A 5A0BA 1TNHA 2B0FA 5EG4A 2NU0E 4KGAA 1XUFA 5FPYA 4UD9H 3PO1C 2W7UA 1JRTA 1PQ8A 1TGCA 1EJMA 2BVRH 3U8TH 3E16B 2C8ZB 4ISHH 4XDEA 8GCHF 3E0PB 1Y5UT 1YYY1 1G32B 5JB8S 1YKTA 1BHXB 2GZ7A 1CA8B 1RFNA 3QX5H 1K21H 4IMQA 2AFQB 3QTOH 4ZKNU 4Y6DA 3E91A 1HCGA 4K8BA 4ASHA 3BG4C 1BTZA 2OQUA 4TWWA 1SR5C 2QGRA 1TAWA 1CVWH 2SGDE 4CRCA 4A5TS 1YPHC 2PTNA 1RTFB 2IJOB 1GBFA 4YESB 1ZRBA 5CHAC 1RD3B 5LPFA 3TJNA 3MU8A 5BRRE 3UNSA 3SU1A 1O3KA 2BDIA 1QURH 1JBUH 1C2MA 5DP6A 5DP3A 3Q76A 2DE9A 4ISIH 1DY9A 3A8CA 1O31A 4GCHF 4LZ1H 2BD8A 1HAYB 3GY2A 2QIQA 1TBZH 3ODDA 1NT1A 6GCHG 3BTTE 1BTXA 3PV4A 2C8XB 2GMTB 4I31A 3M7TA 5LGOA 1G2MA 3MYWA 4KTCA 2FS9A 2BXUH 2M5TA 4OS4A 2GV7A 1C2IA 4B75A 1H9IE 4UFFH 1BTPA 2ANMH 3ZZ4A 1ABJH 2A4GA 1HYLA 1AU8A 3SV2H 4UFGH 3A8DA 5ETXA 1PPCE 5JB9S 5DGJA 4X1NU 2WV4A 3SHAH 1C2HA 1UTPA 1H4WA 1GJAB 5E0GA 2BVSH 1A5GH 1FY5A 1J17T 3LT3A 2WUBA 1KXCA 3SW2B 1AFQC 3NK8A 1EAXA 3Q3XA 2ZHDA 1OYQA 3MH6A 1IQLA 3SJKA 5GCHG 4MLFB 1BBRE 2CHAB 1P11E 4GUXA 5FX5A 1THSH 4ZKRU 1ELDE 1C2DA 2Q1JA 4WF8A 1WQVH 1IQNA 1XVMA 2P3UB 1J16A 3LKWA 1DSUA 2R3YA 3TK6A 1XUKA 1DX5M 1SGIB 2A4QA 2HNTE 3FVFB 3E0NB 1MMJN 1C2JA 1TMUH 1K28D 4B74A 4A1TA 2ZU3A 2C3SA 4A7IB 1YPGH 1F5RA 1V2KT 2HPQH 1OWEA 1ZMNA 1AWHB 1N8OC 1EKBB 2OTVA 4QT8C 5DP8A 3TJOA 1PFXC 1ETSH 1GBJA 1OPHB 3TH4H 3DUXH 1F5KU 4CRFA 1GWAA 1BBRK 1GJDB 3ZVFA 1VGCB 1L1NA 1SGQE 1O2RA 2WPLS 4A1VA 1S83A 1TGTA 4RKOB 3ATIA 3AVZA 5GJ4B 4HTCH 1AMHA 4BTIB 1ZPBA 1ELFA 3OY5U 3QUMP 3V7TA 3A80A 1SGYE 1QBNA 1GMHF 1ELGA 1FLEE 1HAZB 4K3JA 2A0QB 2FOAA 2O9QA 1TA6A 1UCYE 3PYHA 4IC6A 3VB5A 1QL9A 4WJG2 3K65B 1MU8B 2NU3E 1V2VT 5K0HA 2TGPZ 3T25A 4BAQB 4UONA 1YPKH 4WY3A 3CP7A 3FANA 4VGCC 1NTPA 1P2JA 1YLDA 2P3FH 3A7VA 1SGTA 1UHBA 2FX6A 2ZHEH 1TGSZ 1L1JA 4O3TA 3KN2A 2ZFFH 3ATKA 1O5BB 6CHAB 3ITIA 3DFJA 3JZ1B 4NWLA 3SNBA 3TITA 3SNCA 2PTCE 1QGFA 3M35A 1GJ7B 2G4UA 1C5PA 2G51A 3KHVA 6ESTA 1RRKA 2VIPA 1QRZA 1GMCF 2PKAA 1AE5A 3M61U 1HNEE 5DK1A 1CGIE 3RXJA 1NESE 3GY3A 2BLWA 2Z94A 2QXJA 1NU9A 4FU7A 1W3CA 1YPLH 1C1TA 4JCNA 1OWDA 4BXSA 1NS3A 1SGCA 1CT2E 1H1BA 3BG4B 1KXFA 1WV7H 3RXVA 3FP8E 1GI7B 1LMWB 1GHXH 3ZZ6A 2ZG0H 1D3TB 5DKMA 4XSKU 2RG3A 4MPVA 3DT0H 3RU4D 4KTSA 1WTHD 4H6SB 1UTNA 1TNKA 2W26A 4FU9A 2ZCKP 4JK5A 3RXRA 5EU8A 1P2MA 3BTFE 4ABHA 2RCEA 1KTTB 5L2YH 1A3EH 2BD4A 3ATLA 3BEFB 1PPFE 5AF9H 3LJJA 9ESTA 3ZZDA 1TWXB 2WYGA 4NIYA 1FZZA 4NA7A 3S9BA 5DP9A 1GL1A 2FXRA 2Z7FE 1G3BA 3K2UA 1IOEA 1A5HA 2BY8X 1QA7A 3MO3A 1P3EA 2VWOA 2ZF0H 3T62A 4K1TA 1GMDF 1CGJE 1LCYA 1O2GH 1C4U2 1PQ7A 4KKDA 2Y7ZA 1SLUB 2UUKB 1P05A 1DITH 3GY7A 2ULLA 3SGAE 1O3NA 1VJ9U 5EGMA 1EASA 2ZDAH 2ZFPH 3BF6H 1ZHMA 1MBQA 1VR1H 1HXEH 3QO6A 1VCWA 5G4BA 1DUEA 1ESTA 4J1YA 2ZTYA 3RXMA 1RGQA 1GHAF 1SGEE 2A4RA 1Y3YA 1VZQH 3SN8A 1GCTB 2BQ7B 3I77A 4I8KA 3P8GA 1HAXB 1OWKA 1BA8B 5FPSA 1BZXE 3Q00A 2FOCA 2XCNA 4WMFA 1E36B 1O2WA 2IPHA 3M7UA 4GHTA 2Y5FA 3T26A 1S85A 5TJXA 4LXBH 3UTUH 2XXLA 2Y80A 2A4OA 1NRQH 2SGAA 1NRRH 2ZFSA 1DUAA 2AGIX 4Q2KA 1C1NA 3DFLA 4JK6A 2ZU5A 4YT6H 3HATH 5DP7A 2NU4E 1S5SA 1GGDB 3VB6A 3UPEA 1SOTA 4H4FA 3SJ8A 4DG4A 3F9EA 2R2WU 3M5MA 1C5UA 4FUBA 1LPGB 4O3UA 3UFAA 1P2QA 1HBTH 4CHAB 1Z71A 2ANYA 2AMPA 2ZCHP 1TQ0B 4B2CA 1D3DB 2RA0A 3DA9B 2GKVE 4CH8B 4U32A 1GHBF 1K9OE 2Y6TA 1ARBA 4I8GA 3UR6A 1VITG 1FN6A 4GHQA 1MZDA 1O3JA 4A92A 3MOCA 1QBOA 1AN1E 1S82A 4IN2A 1ETRH 3KQEA 3RXLA 2CF9H 1T8NA 2ZP0H 3A7XA 3T2NA 1SG8B 1V6DA 1O5AB 3LH3A 1BRCE 1CE5A 1H8IH 2B8OH 2ZQ2A 1FY4A 4K5ZA 2BMGB 1RXPA 1O3MA 1C5RA 4KTUA 2THFB 3MU5A 1FJSA 3SV6A 2FX4A 1C5QA 2V3HH 3N7OA 2J94A 3D62A 1KXDA 2ZPSA 4YO9A 1ZPCA 2BDBA 3RU4E 1C4Y2 1GVZA 1UK3A 3RXOA 1AUJA 1AVXA 2XC5A 1HJAC 1GVLA 1MTSA 1AKSB 1J14A 3SUFA 2ZGJA 3AAVA 4NZQA 7GCHF 3RXEA 2HGTH 4K1SA 1BITA 1UVUH 4X6NA 1V3XA 4XBCA 5EQRA 3RMMH 4NG9H 3ELAH 3MHWU 1TNGA 1XX9A 1C5ZB 3LDXH 1OP2A 1IHTH 2QC2A 1MBMA 1GBIA 1O5FH 4I32A 1C1QA 1SGFA 2ZC9H 1SPJA 1EB1H 2AGGX 1CGHA 4X8VH 1FXYA 2CF8H 1FI8A 1EOLA 1LVBA 1THPB 2ODPA 4BAHB 2SFAA 3OTJE 1NO9H 3F6UH 4GLYA 2ZU2A 5AFZH 2PUQH 3VFEA 1DLKB 2FDAA 1GI1A 3BIVH 1H8DH 3PLPA 2ZEBA 8LPRA 1P09A 1B5GH 1CHOF 1UVSH 2H5DA 2BTCE 1UVOA 2BD3A 1LHDH 1EXFA 4B2AA 2A5KA 2FM2A 1EAIA 1TE0A 3RXPA 3LJOA 1A0LA 1TMBH 2FZZA 2H5CA 3NUMA 1PJPA 4BTUB 3AASA 4INHA 1C1RA 5A8XA 2ZCLP 1ZMJA 1ZJKA 1G3DA 2A7CA 2AH4X 4BNRA 1W2KH 2VU8E 3MU1A 5GWZA 1PQ5A 1SGRE 1K1LA 2FLBH 2W3KA 1EB2A 3RLYH 1FUJA 1CT4E 2HLCA 1MQ5A 4TY6A 3T5FH 1QTFA 4ZH8A 2PKSB 3MH7A 4LOYH 2OINA 1O2NA 1C2EA 2V0BA 3M3TA 3RXIA 3W95A 4Q7XA 1LVMA 1SB1H 1ZTLA 1GCTC 1TGBA 5C5NA 1PQAA 1IAUA 3P92A 1O3CA 4JYTA 2ZHQH 4Y0ZE 4X8SH 2JH5D 1GJ9B 3RDZA 3SORA 2A7HA 3M5NA 1DDJA 3P6ZB 1QB9A 4AX9H 1JMOH 3ZZ8A 1MUEB 1S6FA 1TB6H 3ENSB 4WH8A 3VGCB 1BMNH 2PR3A 4UDWH 1DE7H 2XC4A 3E6PH 2VINA 2H9TH 4NFFA 4AGJA 3P8OA 1GHZA 1ZGVA 2FOMB 3O8CA 1VITF 1K1PA 1QJ7B 5IDKA 3NPSA 2BLVA 4Q7ZA 5DP5A 1FNIA 1GI9B 1K1NA 3SUGA 1DICA 1B0FA 3SJIA 4MPWA 1O2IA 2BX3A 2CXVA 3BTWE 1P06A 2OCVB 1TRMA 1GDUA 1HUTH 1EP5A 1MZAA 2AIQA 5GDSH 2BY9X 1C1PA 5DO4H 5HYOA 1VGCC 8KME2 2ALPA 1EUFA 2XBYA 3A8BA 1V2PT 2EEKA 3OSYA 1O32A 1GBCA 5C5OA 3SU4A 5LH8A 1A0HB 1S0RA 4TPYA 3UWJH 1P12E 2ZO3H 4Y71A 2Z3CA 1TNLA 1O30A 3D65E 5EQQA 3EE0B 2JETB 2ODQA 1TRYA 3FP7E 1NRSH 3RXHA 1Y3WA 1FPCH 1WBGB 4ISOA 2OXSA 4BANB 5EODA 4NCYA 1G36A 1NY22 3FFGA 6LPRA 4DIIH 1AY6H 2J34A 4ZKSU 3TH2H 1RJXB 1UTLM 3SU5A 5LPEA 2ZFRH 3URCA 4DVAU 2F9OA 2XBWA 1O3OA 1T32A 1ESBA 1BRUP 1KY9A 2NWNA 2ZI2H 2PHBA 4INLA 4DJZB 1O3AA 2V35A 5JBCS 4AFUA 1SGDE 4TWYA 1O2OA 1ZYOA 5EW1H 5EQSA 3GISB 4I33A 1GJBB 1YP9A 2SGQE 1Z6JH 3FZZA 3LONA 5GPIB 3TJVA 2KAIA 1C1OA 1EZUC 3M5OA 2AIPA 1V2ST 4Y8XA 2OC1A 1DXPA 1UMAH 2FEQH 4ZXXH 3A88A 3U8OH 2PKAB 1HDTH 2IN2A 4YOIA 1GHBG 5EPYA 1KYNA 2BOHB 4FUCA 1NN6A 1DFPA 1W11U 4CR5A 1K22H 1S6HA 2VGCC 3M7QA 5JBAS 1Q2WA 4B1TA 3A8AA 1S81A 4H42U 2Q6FA 5HM9A 3D49H 3PO1B 1FDPA 4WMDA 1EAUA 1ZHRA 2BD2A 3A7YA 2Z6BD 1UVPA 3LH1A 3QGJA 3KGPA 3V13A 2GCHG 1SMFE 2VIDA 1LDTT 3AW0A 2AYWA 2TPIZ 5H4IB 1O2YA 2J38A 1PYTD 2STBE 3TU7H 3P8NA 4D7FA 7LPRA 1FY8E 1HAHH 1WU1A 4F4OC 3KNXA 1A61H 1GI3A 1Y3VA 2Z9GA 3BEIB 1AO5A 2G55A 1O2HA 3S7HB 4OS2A 1SQAA 1G2LA 1GBTA 2PWXA 2GGVB 3A86A 3ZYDA 4CHAC 5C2ZA 1BRBE 3VB7A 4OS7A 4YT7H 4IBLH 2QF3A 4X1RU 1O38A 1SGPE 1AD8H 2RA3A 2ZFTA 3UR9A 1SOZA 3SV9A 3F9GA 2FTMA 3ZVDA 7GCHG 1CHGA 2AERH 1A5IA 3MU4A 8GCHG 1K1OA 2CV3A 1ZLRA 2ZNKH 2C90B 5CHAB 1F2SE 1A1RA 2UWPA 1UTMA 3UQVA 1TNJA 2ZTXA 1HRTH 1XM1A 1C5TA 1P57B 1NROH 1Q31A 5A09A 3UREA 1HAOH 4NZLA 2ZECA 4OS5A 3RMNH 3GDUA 3BIUH 4D7GA 2BZ6H 1FMGA 2C93B 1SSXA 1TX6A 3T27A 1ZOMA 3KQCA 3C1KA 4YTAA 2HNTF 1GHWH 3EGKH 4HGCA 2XBXA 1J15A 3R0FA 2HRVA 2OC8A 3T29A 1Q3XA 4DIHH 4U01A 1QFKH 2J95A 1AZZA 4Q7YA 1O3BA 1OX1A 3S0NA 2FOGA 3EAJA 4K60A 4U2WA 4NSVA 2V3OH 1P2KA 1IQHA 3G01A 4AFSA 3M3VA 2W5EA 1AKSA 2QXIA 1GJCB 3M37A 3M3SA 1AIXH 3URDA 1IQIA 1BMMH 1HAVA 2OLGA 2BY5X 1OWIA 4WXIA 1LKBA 5DG6A 2I6SA 4FUEA 4SGBE 5DP4A 2B7DH 2BHGA 1O2KA 1HJ8A 4X6MA 2LNCA 3L3TA 2O8MA 3EA9A 1B7XB 3RLWH 1OKXA 4NA9H 5FBIA 4B71A 2PKSC 3SJ9A 4CRAA 5FAHA 1CT0E 3A85A 3GY8A 2XNIA 4MG3A 4B2BA 2G52A 1KLJH 3ATMA 4NGAH 5FCRA 4AB8A 3FZDA 3U8RH 2WYJA 3ZVEA 2BVXH 1MU6B 2ESTE 3QGNB 1P8VC 1TRNA 4WMEA 2A2XH 4AN7A 1GG6B 1O2SA 1FONA 3MNBA 3RM2H 3ATWA 4UEHH 1GJ6A 4JZIA 1O35A 7ESTE 4ZXYH 1GI6A 1M9UA 3PMJA 2ZPRA 2GTBA 1P01A 2ZU4A 2P94A 2R9PA 2GCTB 3L6PA 1ANEA 1ZJDA 3PWBA 1WTGH 1ID5H 4UFDH 1DOJA 1YPHE 5GXPA 1VJAU 3V0XA 1HPGA 3QN7A 3BV9B 2FI3E 1P0SH 4RKJB 5T6DA 3E1XB 2ANWA 4BOHA 1MQ6A 3SZNA 1GBLA 2ASUB 1VCQA 2OBQA 5AHGH 2BD9A 4YLUA 5AVDA 1O2ZA 2FOFA 3HK6B 3A7ZA 2Q6DA 1WYKA 1OWHA 2SGEE 1XUJA 1HAGE 3NZIA 3GCTF 1G37A 1GBMA 1GBKA 5C1UA 2XTTB 4I7YH 2SGFE 1VCPA 1AB9