8CA2A

Engineering the hydrophobic pocket of carbonic anhydrase ii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
255
structure length
255
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAHLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering the hydrophobic pocket of carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase(oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
total genus 73
structure length 255
sequence length 255
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1991-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 8ca2A00
3IBLA 1FR4A 5FNJA 5JG3B 2ILIA 1CRMA 4YHAA 5CJFA 1CINA 1G6VA 1TG3A 4G7AA 5FL6A 4XIWA 3S72B 4E49A 4JSAA 4ZWYA 1I9MA 1HEAA 5C8IA 3KONA 1CVCA 5FLRA 4UOVA 5EKJA 4PXXA 4RN4A 4MDGA 2FW4A 3OIKA 2WEJA 3ML2A 3B1BA 2NN1A 5FLSA 1IF8A 4PYYA 3RYVB 4WL4A 5AMGA 3DVCA 1ZSAA 3MHOA 1RZCA 1JV0A 2IT4A 3KOKA 1G48A 2QOAA 1TTMA 3P3HA 5CLUA 3M3XA 3F4XA 3F8EA 1DCAA 3CA2A 4BF1A 5SZ2A 1ZSBA 4QK1A 1BN3A 1ZNCA 2FOQA 3R16A 4LHIA 3M67A 1YO1A 4Q49A 4XE1A 3OYSA 3HFPA 3S78B 4K0ZA 3T5ZA 3CAJA 3DC9A 3F7UA 2FOSA 1BCDA 1AM6A 3KKXA 1RZEA 3MZCA 3V2JA 3VBDA 1BNNA 2NWPA 3FFPX 5SZ5A 1G54A 2NNGA 4X5SA 3V3HB 1Z93A 4HF3A 5AMDA 3KLDB 3IBUA 1OKLA 3P55A 3M2ZA 3S75B 1FR7A 5DSQA 5EKMA 4MDMA 3U3AX 5E2MA 1CNXA 1ZGFA 5FL5A 3TMJA 4FRCA 1TEQX 3PO6A 3V3IB 1G45A 5EH8A 3U47A 3V3JA 1CAYA 4CA2A 3DV7A 1I9PA 3RZ5A 4ZAOA 5SZ1A 3D0NA 5DSKA 1G0EA 3BL1A 3MMFA 4Q6EA 3MNJA 1IF4A 3L14A 2OSFA 1KWQA 3V2MA 4QJMA 3P44A 3S74B 5AMLA 1BICA 4E3HA 3SAPA 3GZ0A 2H15A 1IF9A 5DSPA 4QJXA 1BNWA 3FE4A 3OILA 1CCSA 5FL4A 4QTLA 5FNGA 3HLJA 1TG9A 4WUQA 4Q7WA 4L5WA 3RLDA 3S9TA 1HCBA 1HEBA 1CAOA 5E2SA 1HVAA 2ZNCA 3P4VA 3T84A 1IF6A 4QJPA 3MNHA 3CYUA 4YGFA 4XFWA 1G4JA 4RUYA 12CAA 4FVNA 1HUHA 5SZ7A 4FL7A 4KP8A 5FDCA 5LMDA 1CVDA 1I9NA 2X7SA 2WEHA 2HFWA 3OKVA 3MHIA 3V3FA 5SZ6A 1CA3A 5SZ0A 4E3GA 3FW3A 3RZ8A 4N16A 1H9NA 3RJ7A 2AX2A 4Q0LA 1JD0A 1UGEA 5E2RA 3JXGA 4ITOA 5E5RA 4YXIA 4Q90A 3M2YA 1I9LA 4KNIA 5E2KA 4MDLA 4C3TA 3S76A 1KOQA 4Q8ZA 5FLQA 1CA2A 1H4NA 3OKUA 1RJ6A 1RJ5A 4KNNA 4Q07A 4K1QA 4MLXA 1KOPA 4JS6A 5BYIA 2FOVA 2X7UA 1BNMA 4Q6DA 1CAIA 3S97A 1ZH9A 4R5BA 4DZ9A 4YVYA 3N2PA 3M1JA 1IF5A 5CACA 3F7BA 4COQA 1BZMA 5DSJA 3EFTA 4GL1X 4RFCA 1OKNA 1AVNA 5JGSB 3RYYA 4Z1JA 4KUVA 3MHCA 1OQ5A 2WD2A 3M5SA 1HUGA 4ZWZA 3MYQA 1XEVA 2FNKA 1HEDA 1I91A 5SZ3A 5L3OA 3RYJB 3RYXB 3IBNA 3MHMA 4PQ7A 1Y7WA 4HEYA 1HECA 2NNSA 3DA2A 1CNBA 3HS4A 4YYTA 1TE3X 3Q31A 5DSIA 3IEOA 5SZ4A 4CNXA 2W2JA 5FNMA 4Q7PA 1FLJA 5BRWA 2FMGA 1CNYA 1FSRA 2HNCA 3DAZA 5DSNA 3OYQA 1BV3A 4ZWXA 5JDVB 3P58A 4CNWA 1ZFQA 4M2VA 3DD0A 3LXEA 1I9QA 3M5EA 3RZ1B 1XEGA 3BL0A 1FQNA 1XQ0A 1FQLA 4QEFA 3DVBA 4E5QA 3RZ7A 1FQMA 3ZNCA 4LU3A 2WEOA 5EKHA 4TWLA 1H9QA 1ZFKA 2ABEA 3NI5A 5JQ0A 1FQRA 3KNEA 1FSQA 4WW8A 4M2WA 2VVBX 1LGDA 1G4OA 5JEHB 1DMXA 3DC3A 5J8ZA 3S71B 4HT0A 4Z1EA 2NN7A 5EZTX 5G03A 4YGNA 5EHVA 1JCZA 3DD8A 2FMZA 3M40A 1CNIA 4M2RA 2POVA 4WW6A 5A25A 3MNUA 3N4BA 1BNVA 1YDBA 5JQTA 3T85A 4Q83A 3N3JA 4QK3A 2NWOA 4Q7SA 1CNHA 3W6IA 4QJWA 5BRUA 1T9NA 3DCCA 1BN1A 4Q78A 2Q38A 4MTYA 3NJ9A 4R59A 1KEQA 3M96A 4K13A 4RIUA 4ETQC 2NWYA 3C7PA 3PYKA 3DVDA 4HEZA 3M14A 4JSZA 4E9OX 4QY3A 5G0CA 4FVOA 2CBDA 2NMXA 1CAJA 3QYKA 4KUYA 2AW1A 3U45X 3HKNA 3K34A 5DSRA 4Q87A 4KNMA 4Z1KA 1TEUX 5JG5B 4FU5A 1CNKA 2CBCA 3DCSA 1RAZA 3OIMA 5FNKA 3M1WA 2NNVA 2FOUA 4L5VA 1BNQA 3KIGA 4YGJA 2QO8A 2EU3A 4HU1A 5G0BA 3RYZA 4YXUA 5IPZA 1CCUA 3S73B 3DBUA 2NXTA 2CABA 1CVFA 4PZHA 2F14A 4E4AA 3S8XA 1V9EA 5FLPA 1MUAA 1TBTX 4RH2A 1RZAA 2CBAA 5E2NA 1G53A 3V3GB 4K0TA 5E28A 4Z0QA 3KOIA 1CVBA 1A42A 3D9ZA 4K0SA 1LG5A 2HOCA 5DVXA 5FNHA 4KUWA 2Q1QA 3KWAA 4Q8YA 4CACA 3DCWA 2GEHA 1CALA 1UGAA 1RAYA 1YO0A 2POUA 4QIYA 4ITPA 5CA2A 4YGKA 4QK2A 4HBAA 5FNLA 1THKA 4CQ0A 4BF6A 3M98A 5DSLA 5BRVA 5DRSA 2OSMA 4RFDA 5FLOA 4E3DA 3MNKA 2WD3A 4ZX1A 1RZDA 4QSJA 3HKUA 1CVAA 5HPJA 1UGBA 4Q06A 3HKTA 2NXSA 3N0NA 3RG3A 5JEGB 5DOHA 3MWOA 4XZ5A 1ZSCA 3IAIA 2VVAX 1CAMA 1G52A 1UGFA 1AZMA 1Z97A 1CNWA 1CVEA 1YDAA 4N0XB 4QJ0A 1UGGA 4WR7A 2FOYA 3TVNX 3UYNA 2HKKA 4Q99A 9CA2A 2O4ZA 1LZVA 3RGEA 1KWRA 1EOUA 6CA2A 1ZE8A 2GD8A 5L6KA 4Q08A 3K7KA 1CRAA 4PYXA 2NWZA 5DSMA 2POWA 3M1QA 1G3ZA 3SBIA 3TVOX 4E3FA 1IF7A 3EFIA 1BNUA 1CNCA 4MLTA 1CZMA 3IBIA 4Q9YA 4CNRA 4RUZA 3K2FA 4M2UA 4R5AA 3SBHA 3PJJA 3JXHC 1CNJA 1LUGA 3NB5A 5DSOA 4KAPA 1XPZA 2FNNA 2QP6A 4Q81A 1MOOA 5FNIA 2EU2A 3P3JA 4JSSA 3D92A 1HCAA 2H4NA 3P5LA 2Q1BA 5FLTA 3M2NA 4Q8XA 1CNGA 3BETA 3IGPA 4DZ7A 4YXOA 3MNAA 3CZVA 1J9WA 2FNMA 5A6HA 1G1DA 1ZGEA 4HT2A 4LP6A 4Y0JA 2CBEA 3ML5A 4KV0A 3R17B 1CAHA 4QSBA 5EOIA 4QIZA 3V7XA 2NNOA 5FDIA 4QSIA 1LG6A 5EH7A 3JXFA 3P5AA 4MO8A 3HKQA 4KP5A 4YGLA 1CAZA 3T5UA 4FPTA 1CAKA 3SAXA 4QSAA 4G0CA 1YO2A 5EH5A 4KNJA 3S77B 1OKMA 4FIKA 4Q09A 1V9IC 2NXRA 5EHWA 3U7CA 1I8ZA 1Z9YA 1DCBA 3RZ0B 7CA2A 2CA2A 1DMYA 1BNTA 2X7TA 8CA2A 2HL4A 3B4FA 1CILA 5G01A 4TWMA 2HD6A 5BNLA 3MNIA 4QJOA 1BN4A 3MHLA 3T83A 1I90A 1I9OA 5JEPB 4RUXA 4ILXA 4ZWIA 1G0FA 1CVHA 4JSWA 1G46A 2EZ7A 4HEWA 5JGTB 3M5TA 3OY0A 4IWZA 3D93A 4YX4A 4RIVA 3D8WA 1FSNA 3W6HA 1RZBA 3M1KA 5DOGA 4BCWA 1CANA 3UYQA 4Z1NA 1CCTA 1YDCA 5E5UA 1UGDA 4CNVA 5JESB 4IDRX 1TB0X 3M2XA 3ZP9A 3M04A 1TH9A 1UGCA 3RG4A 1F2WA 3T82A 5EIJA 5EHEA 2CBBA 3KS3A 4L5UA 4YWPA 4ZX0A 1YDDA 3V5GA 4Q7VA 2WEGA 3MDZA 4XIXA 4WUPA 1URTA 1CIMA
chains in the Genus database with same CATH superfamily
3IBLA 1FR4A 5FNJA 5JG3B 2ILIA 1CRMA 4YHAA 5CJFA 1CINA 1G6VA 1TG3A 4G7AA 5FL6A 4XIWA 3S72B 4E49A 4JSAA 4ZWYA 1I9MA 1HEAA 5C8IA 3KONA 1CVCA 5FLRA 4UOVA 5EKJA 4PXXA 4RN4A 4MDGA 2FW4A 3OIKA 2WEJA 3ML2A 3B1BA 2NN1A 5FLSA 1IF8A 4PYYA 3RYVB 4WL4A 5AMGA 3DVCA 1ZSAA 3MHOA 1RZCA 1JV0A 2IT4A 3KOKA 1G48A 2QOAA 1TTMA 3P3HA 5CLUA 3M3XA 3F4XA 3F8EA 1DCAA 3CA2A 4BF1A 5SZ2A 1ZSBA 4QK1A 1BN3A 1ZNCA 2FOQA 3R16A 4LHIA 3M67A 1YO1A 4Q49A 4XE1A 3OYSA 3HFPA 3S78B 4K0ZA 3T5ZA 3CAJA 3DC9A 3F7UA 2FOSA 1BCDA 1AM6A 3KKXA 1RZEA 3MZCA 3V2JA 3VBDA 1BNNA 2NWPA 3FFPX 5SZ5A 1G54A 2NNGA 4X5SA 3V3HB 1Z93A 4HF3A 5AMDA 3KLDB 3IBUA 1OKLA 3P55A 3M2ZA 3S75B 1FR7A 5DSQA 5EKMA 4MDMA 3U3AX 5E2MA 1CNXA 1ZGFA 5FL5A 3TMJA 4FRCA 1TEQX 3PO6A 3V3IB 1G45A 5EH8A 3U47A 3V3JA 1CAYA 4CA2A 3DV7A 1I9PA 3RZ5A 4ZAOA 5SZ1A 3D0NA 5DSKA 1G0EA 3BL1A 3MMFA 4Q6EA 3MNJA 1IF4A 3L14A 2OSFA 1KWQA 3V2MA 4QJMA 3P44A 3S74B 5AMLA 1BICA 4E3HA 3SAPA 3GZ0A 2H15A 1IF9A 5DSPA 4QJXA 1BNWA 3FE4A 3OILA 1CCSA 5FL4A 4QTLA 5FNGA 3HLJA 1TG9A 4WUQA 4Q7WA 4L5WA 3RLDA 3S9TA 1HCBA 1HEBA 1CAOA 5E2SA 1HVAA 2ZNCA 3P4VA 3T84A 1IF6A 4QJPA 3MNHA 3CYUA 4YGFA 4XFWA 1G4JA 4RUYA 12CAA 4FVNA 1HUHA 5SZ7A 4FL7A 4KP8A 5FDCA 5LMDA 1CVDA 1I9NA 2X7SA 2WEHA 2HFWA 3OKVA 3MHIA 3V3FA 5SZ6A 1CA3A 5SZ0A 4E3GA 3FW3A 3RZ8A 4N16A 1H9NA 3RJ7A 2AX2A 4Q0LA 1JD0A 1UGEA 5E2RA 3JXGA 4ITOA 5E5RA 4YXIA 4Q90A 3M2YA 1I9LA 4KNIA 5E2KA 4MDLA 4C3TA 3S76A 1KOQA 4Q8ZA 5FLQA 1CA2A 1H4NA 3OKUA 1RJ6A 1RJ5A 4KNNA 4Q07A 4K1QA 4MLXA 1KOPA 4JS6A 5BYIA 2FOVA 2X7UA 1BNMA 4Q6DA 1CAIA 3S97A 1ZH9A 4R5BA 4DZ9A 4YVYA 3N2PA 3M1JA 1IF5A 5CACA 3F7BA 4COQA 1BZMA 5DSJA 3EFTA 4GL1X 4RFCA 1OKNA 1AVNA 5JGSB 3RYYA 4Z1JA 4KUVA 3MHCA 1OQ5A 2WD2A 3M5SA 1HUGA 4ZWZA 3MYQA 1XEVA 2FNKA 1HEDA 1I91A 5SZ3A 5L3OA 3RYJB 3RYXB 3IBNA 3MHMA 4PQ7A 1Y7WA 4HEYA 1HECA 2NNSA 3DA2A 1CNBA 3HS4A 4YYTA 1TE3X 3Q31A 5DSIA 3IEOA 5SZ4A 4CNXA 2W2JA 5FNMA 4Q7PA 1FLJA 5BRWA 2FMGA 1CNYA 1FSRA 2HNCA 3DAZA 5DSNA 3OYQA 1BV3A 4ZWXA 5JDVB 3P58A 4CNWA 1ZFQA 4M2VA 3DD0A 3LXEA 1I9QA 3M5EA 3RZ1B 1XEGA 3BL0A 1FQNA 1XQ0A 1FQLA 4QEFA 3DVBA 4E5QA 3RZ7A 1FQMA 3ZNCA 4LU3A 2WEOA 5EKHA 4TWLA 1H9QA 1ZFKA 2ABEA 3NI5A 5JQ0A 1FQRA 3KNEA 1FSQA 4WW8A 4M2WA 2VVBX 1LGDA 1G4OA 5JEHB 1DMXA 3DC3A 5J8ZA 3S71B 4HT0A 4Z1EA 2NN7A 5EZTX 5G03A 4YGNA 5EHVA 1JCZA 3DD8A 2FMZA 3M40A 1CNIA 4M2RA 2POVA 4WW6A 5A25A 3MNUA 3N4BA 1BNVA 1YDBA 5JQTA 3T85A 4Q83A 3N3JA 4QK3A 2NWOA 4Q7SA 1CNHA 3W6IA 4QJWA 5BRUA 1T9NA 3DCCA 1BN1A 4Q78A 2Q38A 4MTYA 3NJ9A 4R59A 1KEQA 3M96A 4K13A 4RIUA 4ETQC 2NWYA 3C7PA 3PYKA 3DVDA 4HEZA 3M14A 4JSZA 4E9OX 4QY3A 5G0CA 4FVOA 2CBDA 2NMXA 1CAJA 3QYKA 4KUYA 2AW1A 3U45X 3HKNA 3K34A 5DSRA 4Q87A 4KNMA 4Z1KA 1TEUX 5JG5B 4FU5A 1CNKA 2CBCA 3DCSA 1RAZA 3OIMA 5FNKA 3M1WA 2NNVA 2FOUA 4L5VA 1BNQA 3KIGA 4YGJA 2QO8A 2EU3A 4HU1A 5G0BA 3RYZA 4YXUA 5IPZA 1CCUA 3S73B 3DBUA 2NXTA 2CABA 1CVFA 4PZHA 2F14A 4E4AA 3S8XA 1V9EA 5FLPA 1MUAA 1TBTX 4RH2A 1RZAA 2CBAA 5E2NA 1G53A 3V3GB 4K0TA 5E28A 4Z0QA 3KOIA 1CVBA 1A42A 3D9ZA 4K0SA 1LG5A 2HOCA 5DVXA 5FNHA 4KUWA 2Q1QA 3KWAA 4Q8YA 4CACA 3DCWA 2GEHA 1CALA 1UGAA 1RAYA 1YO0A 2POUA 4QIYA 4ITPA 5CA2A 4YGKA 4QK2A 4HBAA 5FNLA 1THKA 4CQ0A 4BF6A 3M98A 5DSLA 5BRVA 5DRSA 2OSMA 4RFDA 5FLOA 4E3DA 3MNKA 2WD3A 4ZX1A 1RZDA 4QSJA 3HKUA 1CVAA 5HPJA 1UGBA 4Q06A 3HKTA 2NXSA 3N0NA 3RG3A 5JEGB 5DOHA 3MWOA 4XZ5A 1ZSCA 3IAIA 2VVAX 1CAMA 1G52A 1UGFA 1AZMA 1Z97A 1CNWA 1CVEA 1YDAA 4N0XB 4QJ0A 1UGGA 4WR7A 2FOYA 3TVNX 3UYNA 2HKKA 4Q99A 9CA2A 2O4ZA 1LZVA 3RGEA 1KWRA 1EOUA 6CA2A 1ZE8A 2GD8A 5L6KA 4Q08A 3K7KA 1CRAA 4PYXA 2NWZA 5DSMA 2POWA 3M1QA 1G3ZA 3SBIA 3TVOX 4E3FA 1IF7A 3EFIA 1BNUA 1CNCA 4MLTA 1CZMA 3IBIA 4Q9YA 4CNRA 4RUZA 3K2FA 4M2UA 4R5AA 3SBHA 3PJJA 3JXHC 1CNJA 1LUGA 3NB5A 5DSOA 4KAPA 1XPZA 2FNNA 2QP6A 4Q81A 1MOOA 5FNIA 2EU2A 3P3JA 4JSSA 3D92A 1HCAA 2H4NA 3P5LA 2Q1BA 5FLTA 3M2NA 4Q8XA 1CNGA 3BETA 3IGPA 4DZ7A 4YXOA 3MNAA 3CZVA 1J9WA 2FNMA 5A6HA 1G1DA 1ZGEA 4HT2A 4LP6A 4Y0JA 2CBEA 3ML5A 4KV0A 3R17B 1CAHA 4QSBA 5EOIA 4QIZA 3V7XA 2NNOA 5FDIA 4QSIA 1LG6A 5EH7A 3JXFA 3P5AA 4MO8A 3HKQA 4KP5A 4YGLA 1CAZA 3T5UA 4FPTA 1CAKA 3SAXA 4QSAA 4G0CA 1YO2A 5EH5A 4KNJA 3S77B 1OKMA 4FIKA 4Q09A 1V9IC 2NXRA 5EHWA 3U7CA 1I8ZA 1Z9YA 1DCBA 3RZ0B 7CA2A 2CA2A 1DMYA 1BNTA 2X7TA 8CA2A 2HL4A 3B4FA 1CILA 5G01A 4TWMA 2HD6A 5BNLA 3MNIA 4QJOA 1BN4A 3MHLA 3T83A 1I90A 1I9OA 5JEPB 4RUXA 4ILXA 4ZWIA 1G0FA 1CVHA 4JSWA 1G46A 2EZ7A 4HEWA 5JGTB 3M5TA 3OY0A 4IWZA 3D93A 4YX4A 4RIVA 3D8WA 1FSNA 3W6HA 1RZBA 3M1KA 5DOGA 4BCWA 1CANA 3UYQA 4Z1NA 1CCTA 1YDCA 5E5UA 1UGDA 4CNVA 5JESB 4IDRX 1TB0X 3M2XA 3ZP9A 3M04A 1TH9A 1UGCA 3RG4A 1F2WA 3T82A 5EIJA 5EHEA 2CBBA 3KS3A 4L5UA 4YWPA 4ZX0A 1YDDA 3V5GA 4Q7VA 2WEGA 3MDZA 4XIXA 4WUPA 1URTA 1CIMA
chains in the Genus database with same CATH topology
3IBLA 1FR4A 5FNJA 5JG3B 2ILIA 1CRMA 4YHAA 5CJFA 1CINA 1G6VA 1TG3A 4G7AA 5FL6A 4XIWA 3S72B 4E49A 4JSAA 4ZWYA 1I9MA 1HEAA 5C8IA 3KONA 1CVCA 5FLRA 4UOVA 5EKJA 4PXXA 4RN4A 4MDGA 2FW4A 3OIKA 2WEJA 3ML2A 3B1BA 2NN1A 5FLSA 1IF8A 4PYYA 3RYVB 4WL4A 5AMGA 3DVCA 1ZSAA 3MHOA 1RZCA 1JV0A 2IT4A 3KOKA 1G48A 2QOAA 1TTMA 3P3HA 5CLUA 3M3XA 3F4XA 3F8EA 1DCAA 3CA2A 4BF1A 5SZ2A 1ZSBA 4QK1A 1BN3A 1ZNCA 2FOQA 3R16A 4LHIA 3M67A 1YO1A 4Q49A 4XE1A 3OYSA 3HFPA 3S78B 4K0ZA 3T5ZA 3CAJA 3DC9A 3F7UA 2FOSA 1BCDA 1AM6A 3KKXA 1RZEA 3MZCA 3V2JA 3VBDA 1BNNA 2NWPA 3FFPX 5SZ5A 1G54A 2NNGA 4X5SA 3V3HB 1Z93A 4HF3A 5AMDA 3KLDB 3IBUA 1OKLA 3P55A 3M2ZA 3S75B 1FR7A 5DSQA 5EKMA 4MDMA 3U3AX 5E2MA 1CNXA 1ZGFA 5FL5A 3TMJA 4FRCA 1TEQX 3PO6A 3V3IB 1G45A 5EH8A 3U47A 3V3JA 1CAYA 4CA2A 3DV7A 1I9PA 3RZ5A 4ZAOA 5SZ1A 3D0NA 5DSKA 1G0EA 3BL1A 3MMFA 4Q6EA 3MNJA 1IF4A 3L14A 2OSFA 1KWQA 3V2MA 4QJMA 3P44A 3S74B 5AMLA 1BICA 4E3HA 3SAPA 3GZ0A 2H15A 1IF9A 5DSPA 4QJXA 1BNWA 3FE4A 3OILA 1CCSA 5FL4A 4QTLA 5FNGA 3HLJA 1TG9A 4WUQA 4Q7WA 4L5WA 3RLDA 3S9TA 1HCBA 1HEBA 1CAOA 5E2SA 1HVAA 2ZNCA 3P4VA 3T84A 1IF6A 4QJPA 3MNHA 3CYUA 4YGFA 4XFWA 1G4JA 4RUYA 12CAA 4FVNA 1HUHA 5SZ7A 4FL7A 4KP8A 5FDCA 5LMDA 1CVDA 1I9NA 2X7SA 2WEHA 2HFWA 3OKVA 3MHIA 3V3FA 5SZ6A 1CA3A 5SZ0A 4E3GA 3FW3A 3RZ8A 4N16A 1H9NA 3RJ7A 2AX2A 4Q0LA 1JD0A 1UGEA 5E2RA 3JXGA 4ITOA 5E5RA 4YXIA 4Q90A 3M2YA 1I9LA 4KNIA 5E2KA 4MDLA 4C3TA 3S76A 1KOQA 4Q8ZA 5FLQA 1CA2A 1H4NA 3OKUA 1RJ6A 1RJ5A 4KNNA 4Q07A 4K1QA 4MLXA 1KOPA 4JS6A 5BYIA 2FOVA 2X7UA 1BNMA 4Q6DA 1CAIA 3S97A 1ZH9A 4R5BA 4DZ9A 4YVYA 3N2PA 3M1JA 1IF5A 5CACA 3F7BA 4COQA 1BZMA 5DSJA 3EFTA 4GL1X 4RFCA 1OKNA 1AVNA 5JGSB 3RYYA 4Z1JA 4KUVA 3MHCA 1OQ5A 2WD2A 3M5SA 1HUGA 4ZWZA 3MYQA 1XEVA 2FNKA 1HEDA 1I91A 5SZ3A 5L3OA 3RYJB 3RYXB 3IBNA 3MHMA 4PQ7A 1Y7WA 4HEYA 1HECA 2NNSA 3DA2A 1CNBA 3HS4A 4YYTA 1TE3X 3Q31A 5DSIA 3IEOA 5SZ4A 4CNXA 2W2JA 5FNMA 4Q7PA 1FLJA 5BRWA 2FMGA 1CNYA 1FSRA 2HNCA 3DAZA 5DSNA 3OYQA 1BV3A 4ZWXA 5JDVB 3P58A 4CNWA 1ZFQA 4M2VA 3DD0A 3LXEA 1I9QA 3M5EA 3RZ1B 1XEGA 3BL0A 1FQNA 1XQ0A 1FQLA 4QEFA 3DVBA 4E5QA 3RZ7A 1FQMA 3ZNCA 4LU3A 2WEOA 5EKHA 4TWLA 1H9QA 1ZFKA 2ABEA 3NI5A 5JQ0A 1FQRA 3KNEA 1FSQA 4WW8A 4M2WA 2VVBX 1LGDA 1G4OA 5JEHB 1DMXA 3DC3A 5J8ZA 3S71B 4HT0A 4Z1EA 2NN7A 5EZTX 5G03A 4YGNA 5EHVA 1JCZA 3DD8A 2FMZA 3M40A 1CNIA 4M2RA 2POVA 4WW6A 5A25A 3MNUA 3N4BA 1BNVA 1YDBA 5JQTA 3T85A 4Q83A 3N3JA 4QK3A 2NWOA 4Q7SA 1CNHA 3W6IA 4QJWA 5BRUA 1T9NA 3DCCA 1BN1A 4Q78A 2Q38A 4MTYA 3NJ9A 4R59A 1KEQA 3M96A 4K13A 4RIUA 4ETQC 2NWYA 3C7PA 3PYKA 3DVDA 4HEZA 3M14A 4JSZA 4E9OX 4QY3A 5G0CA 4FVOA 2CBDA 2NMXA 1CAJA 3QYKA 4KUYA 2AW1A 3U45X 3HKNA 3K34A 5DSRA 4Q87A 4KNMA 4Z1KA 1TEUX 5JG5B 4FU5A 1CNKA 2CBCA 3DCSA 1RAZA 3OIMA 5FNKA 3M1WA 2NNVA 2FOUA 4L5VA 1BNQA 3KIGA 4YGJA 2QO8A 2EU3A 4HU1A 5G0BA 3RYZA 4YXUA 5IPZA 1CCUA 3S73B 3DBUA 2NXTA 2CABA 1CVFA 4PZHA 2F14A 4E4AA 3S8XA 1V9EA 5FLPA 1MUAA 1TBTX 4RH2A 1RZAA 2CBAA 5E2NA 1G53A 3V3GB 4K0TA 5E28A 4Z0QA 3KOIA 1CVBA 1A42A 3D9ZA 4K0SA 1LG5A 2HOCA 5DVXA 5FNHA 4KUWA 2Q1QA 3KWAA 4Q8YA 4CACA 3DCWA 2GEHA 1CALA 1UGAA 1RAYA 1YO0A 2POUA 4QIYA 4ITPA 5CA2A 4YGKA 4QK2A 4HBAA 5FNLA 1THKA 4CQ0A 4BF6A 3M98A 5DSLA 5BRVA 5DRSA 2OSMA 4RFDA 5FLOA 4E3DA 3MNKA 2WD3A 4ZX1A 1RZDA 4QSJA 3HKUA 1CVAA 5HPJA 1UGBA 4Q06A 3HKTA 2NXSA 3N0NA 3RG3A 5JEGB 5DOHA 3MWOA 4XZ5A 1ZSCA 3IAIA 2VVAX 1CAMA 1G52A 1UGFA 1AZMA 1Z97A 1CNWA 1CVEA 1YDAA 4N0XB 4QJ0A 1UGGA 4WR7A 2FOYA 3TVNX 3UYNA 2HKKA 4Q99A 9CA2A 2O4ZA 1LZVA 3RGEA 1KWRA 1EOUA 6CA2A 1ZE8A 2GD8A 5L6KA 4Q08A 3K7KA 1CRAA 4PYXA 2NWZA 5DSMA 2POWA 3M1QA 1G3ZA 3SBIA 3TVOX 4E3FA 1IF7A 3EFIA 1BNUA 1CNCA 4MLTA 1CZMA 3IBIA 4Q9YA 4CNRA 4RUZA 3K2FA 4M2UA 4R5AA 3SBHA 3PJJA 3JXHC 1CNJA 1LUGA 3NB5A 5DSOA 4KAPA 1XPZA 2FNNA 2QP6A 4Q81A 1MOOA 5FNIA 2EU2A 3P3JA 4JSSA 3D92A 1HCAA 2H4NA 3P5LA 2Q1BA 5FLTA 3M2NA 4Q8XA 1CNGA 3BETA 3IGPA 4DZ7A 4YXOA 3MNAA 3CZVA 1J9WA 2FNMA 5A6HA 1G1DA 1ZGEA 4HT2A 4LP6A 4Y0JA 2CBEA 3ML5A 4KV0A 3R17B 1CAHA 4QSBA 5EOIA 4QIZA 3V7XA 2NNOA 5FDIA 4QSIA 1LG6A 5EH7A 3JXFA 3P5AA 4MO8A 3HKQA 4KP5A 4YGLA 1CAZA 3T5UA 4FPTA 1CAKA 3SAXA 4QSAA 4G0CA 1YO2A 5EH5A 4KNJA 3S77B 1OKMA 4FIKA 4Q09A 1V9IC 2NXRA 5EHWA 3U7CA 1I8ZA 1Z9YA 1DCBA 3RZ0B 7CA2A 2CA2A 1DMYA 1BNTA 2X7TA 8CA2A 2HL4A 3B4FA 1CILA 5G01A 4TWMA 2HD6A 5BNLA 3MNIA 4QJOA 1BN4A 3MHLA 3T83A 1I90A 1I9OA 5JEPB 4RUXA 4ILXA 4ZWIA 1G0FA 1CVHA 4JSWA 1G46A 2EZ7A 4HEWA 5JGTB 3M5TA 3OY0A 4IWZA 3D93A 4YX4A 4RIVA 3D8WA 1FSNA 3W6HA 1RZBA 3M1KA 5DOGA 4BCWA 1CANA 3UYQA 4Z1NA 1CCTA 1YDCA 5E5UA 1UGDA 4CNVA 5JESB 4IDRX 1TB0X 3M2XA 3ZP9A 3M04A 1TH9A 1UGCA 3RG4A 1F2WA 3T82A 5EIJA 5EHEA 2CBBA 3KS3A 4L5UA 4YWPA 4ZX0A 1YDDA 3V5GA 4Q7VA 2WEGA 3MDZA 4XIXA 4WUPA 1URTA 1CIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBL A;  1FR4 A;  5FNJ A;  5JG3 B;  2ILI A;  1CRM A;  4YHA A;  5CJF A;  1CIN A;  1G6V A;  1TG3 A;  4G7A A;  5FL6 A;  4XIW A;  3S72 B;  4E49 A;  4JSA A;  4ZWY A;  1I9M A;  1HEA A;  5C8I A;  3KON A;  1CVC A;  5FLR A;  4UOV A;  5EKJ A;  4PXX A;  4RN4 A;  4MDG A;  2FW4 A;  3OIK A;  2WEJ A;  3ML2 A;  3B1B A;  2NN1 A;  5FLS A;  1IF8 A;  4PYY A;  3RYV B;  4WL4 A;  5AMG A;  3DVC A;  1ZSA A;  3MHO A;  1RZC A;  1JV0 A;  2IT4 A;  3KOK A;  1G48 A;  2QOA A;  1TTM A;  3P3H A;  5CLU A;  3M3X A;  3F4X A;  3F8E A;  1DCA A;  3CA2 A;  4BF1 A;  5SZ2 A;  1ZSB A;  4QK1 A;  1BN3 A;  1ZNC A;  2FOQ A;  3R16 A;  4LHI A;  3M67 A;  1YO1 A;  4Q49 A;  4XE1 A;  3OYS A;  3HFP A;  3S78 B;  4K0Z A;  3T5Z A;  3CAJ A;  3DC9 A;  3F7U A;  2FOS A;  1BCD A;  1AM6 A;  3KKX A;  1RZE A;  3MZC A;  3V2J A;  3VBD A;  1BNN A;  2NWP A;  3FFP X;  5SZ5 A;  1G54 A;  2NNG A;  4X5S A;  3V3H B;  1Z93 A;  4HF3 A;  5AMD A;  3KLD B;  3IBU A;  1OKL A;  3P55 A;  3M2Z A;  3S75 B;  1FR7 A;  5DSQ A;  5EKM A;  4MDM A;  3U3A X;  5E2M A;  1CNX A;  1ZGF A;  5FL5 A;  3TMJ A;  4FRC A;  1TEQ X;  3PO6 A;  3V3I B;  1G45 A;  5EH8 A;  3U47 A;  3V3J A;  1CAY A;  4CA2 A;  3DV7 A;  1I9P A;  3RZ5 A;  4ZAO A;  5SZ1 A;  3D0N A;  5DSK A;  1G0E A;  3BL1 A;  3MMF A;  4Q6E A;  3MNJ A;  1IF4 A;  3L14 A;  2OSF A;  1KWQ A;  3V2M A;  4QJM A;  3P44 A;  3S74 B;  5AML A;  1BIC A;  4E3H A;  3SAP A;  3GZ0 A;  2H15 A;  1IF9 A;  5DSP A;  4QJX A;  1BNW A;  3FE4 A;  3OIL A;  1CCS A;  5FL4 A;  4QTL A;  5FNG A;  3HLJ A;  1TG9 A;  4WUQ A;  4Q7W A;  4L5W A;  3RLD A;  3S9T A;  1HCB A;  1HEB A;  1CAO A;  5E2S A;  1HVA A;  2ZNC A;  3P4V A;  3T84 A;  1IF6 A;  4QJP A;  3MNH A;  3CYU A;  4YGF A;  4XFW A;  1G4J A;  4RUY A;  12CA A;  4FVN A;  1HUH A;  5SZ7 A;  4FL7 A;  4KP8 A;  5FDC A;  5LMD A;  1CVD A;  1I9N A;  2X7S A;  2WEH A;  2HFW A;  3OKV A;  3MHI A;  3V3F A;  5SZ6 A;  1CA3 A;  5SZ0 A;  4E3G A;  3FW3 A;  3RZ8 A;  4N16 A;  1H9N A;  3RJ7 A;  2AX2 A;  4Q0L A;  1JD0 A;  1UGE A;  5E2R A;  3JXG A;  4ITO A;  5E5R A;  4YXI A;  4Q90 A;  3M2Y A;  1I9L A;  4KNI A;  5E2K A;  4MDL A;  4C3T A;  3S76 A;  1KOQ A;  4Q8Z A;  5FLQ A;  1CA2 A;  1H4N A;  3OKU A;  1RJ6 A;  1RJ5 A;  4KNN A;  4Q07 A;  4K1Q A;  4MLX A;  1KOP A;  4JS6 A;  5BYI A;  2FOV A;  2X7U A;  1BNM A;  4Q6D A;  1CAI A;  3S97 A;  1ZH9 A;  4R5B A;  4DZ9 A;  4YVY A;  3N2P A;  3M1J A;  1IF5 A;  5CAC A;  3F7B A;  4COQ A;  1BZM A;  5DSJ A;  3EFT A;  4GL1 X;  4RFC A;  1OKN A;  1AVN A;  5JGS B;  3RYY A;  4Z1J A;  4KUV A;  3MHC A;  1OQ5 A;  2WD2 A;  3M5S A;  1HUG A;  4ZWZ A;  3MYQ A;  1XEV A;  2FNK A;  1HED A;  1I91 A;  5SZ3 A;  5L3O A;  3RYJ B;  3RYX B;  3IBN A;  3MHM A;  4PQ7 A;  1Y7W A;  4HEY A;  1HEC A;  2NNS A;  3DA2 A;  1CNB A;  3HS4 A;  4YYT A;  1TE3 X;  3Q31 A;  5DSI A;  3IEO A;  5SZ4 A;  4CNX A;  2W2J A;  5FNM A;  4Q7P A;  1FLJ A;  5BRW A;  2FMG A;  1CNY A;  1FSR A;  2HNC A;  3DAZ A;  5DSN A;  3OYQ A;  1BV3 A;  4ZWX A;  5JDV B;  3P58 A;  4CNW A;  1ZFQ A;  4M2V A;  3DD0 A;  3LXE A;  1I9Q A;  3M5E A;  3RZ1 B;  1XEG A;  3BL0 A;  1FQN A;  1XQ0 A;  1FQL A;  4QEF A;  3DVB A;  4E5Q A;  3RZ7 A;  1FQM A;  3ZNC A;  4LU3 A;  2WEO A;  5EKH A;  4TWL A;  1H9Q A;  1ZFK A;  2ABE A;  3NI5 A;  5JQ0 A;  1FQR A;  3KNE A;  1FSQ A;  4WW8 A;  4M2W A;  2VVB X;  1LGD A;  1G4O A;  5JEH B;  1DMX A;  3DC3 A;  5J8Z A;  3S71 B;  4HT0 A;  4Z1E A;  2NN7 A;  5EZT X;  5G03 A;  4YGN A;  5EHV A;  1JCZ A;  3DD8 A;  2FMZ A;  3M40 A;  1CNI A;  4M2R A;  2POV A;  4WW6 A;  5A25 A;  3MNU A;  3N4B A;  1BNV A;  1YDB A;  5JQT A;  3T85 A;  4Q83 A;  3N3J A;  4QK3 A;  2NWO A;  4Q7S A;  1CNH A;  3W6I A;  4QJW A;  5BRU A;  1T9N A;  3DCC A;  1BN1 A;  4Q78 A;  2Q38 A;  4MTY A;  3NJ9 A;  4R59 A;  1KEQ A;  3M96 A;  4K13 A;  4RIU A;  4ETQ C;  2NWY A;  3C7P A;  3PYK A;  3DVD A;  4HEZ A;  3M14 A;  4JSZ A;  4E9O X;  4QY3 A;  5G0C A;  4FVO A;  2CBD A;  2NMX A;  1CAJ A;  3QYK A;  4KUY A;  2AW1 A;  3U45 X;  3HKN A;  3K34 A;  5DSR A;  4Q87 A;  4KNM A;  4Z1K A;  1TEU X;  5JG5 B;  4FU5 A;  1CNK A;  2CBC A;  3DCS A;  1RAZ A;  3OIM A;  5FNK A;  3M1W A;  2NNV A;  2FOU A;  4L5V A;  1BNQ A;  3KIG A;  4YGJ A;  2QO8 A;  2EU3 A;  4HU1 A;  5G0B A;  3RYZ A;  4YXU A;  5IPZ A;  1CCU A;  3S73 B;  3DBU A;  2NXT A;  2CAB A;  1CVF A;  4PZH A;  2F14 A;  4E4A A;  3S8X A;  1V9E A;  5FLP A;  1MUA A;  1TBT X;  4RH2 A;  1RZA A;  2CBA A;  5E2N A;  1G53 A;  3V3G B;  4K0T A;  5E28 A;  4Z0Q A;  3KOI A;  1CVB A;  1A42 A;  3D9Z A;  4K0S A;  1LG5 A;  2HOC A;  5DVX A;  5FNH A;  4KUW A;  2Q1Q A;  3KWA A;  4Q8Y A;  4CAC A;  3DCW A;  2GEH A;  1CAL A;  1UGA A;  1RAY A;  1YO0 A;  2POU A;  4QIY A;  4ITP A;  5CA2 A;  4YGK A;  4QK2 A;  4HBA A;  5FNL A;  1THK A;  4CQ0 A;  4BF6 A;  3M98 A;  5DSL A;  5BRV A;  5DRS A;  2OSM A;  4RFD A;  5FLO A;  4E3D A;  3MNK A;  2WD3 A;  4ZX1 A;  1RZD A;  4QSJ A;  3HKU A;  1CVA A;  5HPJ A;  1UGB A;  4Q06 A;  3HKT A;  2NXS A;  3N0N A;  3RG3 A;  5JEG B;  5DOH A;  3MWO A;  4XZ5 A;  1ZSC A;  3IAI A;  2VVA X;  1CAM A;  1G52 A;  1UGF A;  1AZM A;  1Z97 A;  1CNW A;  1CVE A;  1YDA A;  4N0X B;  4QJ0 A;  1UGG A;  4WR7 A;  2FOY A;  3TVN X;  3UYN A;  2HKK A;  4Q99 A;  9CA2 A;  2O4Z A;  1LZV A;  3RGE A;  1KWR A;  1EOU A;  6CA2 A;  1ZE8 A;  2GD8 A;  5L6K A;  4Q08 A;  3K7K A;  1CRA A;  4PYX A;  2NWZ A;  5DSM A;  2POW A;  3M1Q A;  1G3Z A;  3SBI A;  3TVO X;  4E3F A;  1IF7 A;  3EFI A;  1BNU A;  1CNC A;  4MLT A;  1CZM A;  3IBI A;  4Q9Y A;  4CNR A;  4RUZ A;  3K2F A;  4M2U A;  4R5A A;  3SBH A;  3PJJ A;  3JXH C;  1CNJ A;  1LUG A;  3NB5 A;  5DSO A;  4KAP A;  1XPZ A;  2FNN A;  2QP6 A;  4Q81 A;  1MOO A;  5FNI A;  2EU2 A;  3P3J A;  4JSS A;  3D92 A;  1HCA A;  2H4N A;  3P5L A;  2Q1B A;  5FLT A;  3M2N A;  4Q8X A;  1CNG A;  3BET A;  3IGP A;  4DZ7 A;  4YXO A;  3MNA A;  3CZV A;  1J9W A;  2FNM A;  5A6H A;  1G1D A;  1ZGE A;  4HT2 A;  4LP6 A;  4Y0J A;  2CBE A;  3ML5 A;  4KV0 A;  3R17 B;  1CAH A;  4QSB A;  5EOI A;  4QIZ A;  3V7X A;  2NNO A;  5FDI A;  4QSI A;  1LG6 A;  5EH7 A;  3JXF A;  3P5A A;  4MO8 A;  3HKQ A;  4KP5 A;  4YGL A;  1CAZ A;  3T5U A;  4FPT A;  1CAK A;  3SAX A;  4QSA A;  4G0C A;  1YO2 A;  5EH5 A;  4KNJ A;  3S77 B;  1OKM A;  4FIK A;  4Q09 A;  1V9I C;  2NXR A;  5EHW A;  3U7C A;  1I8Z A;  1Z9Y A;  1DCB A;  3RZ0 B;  7CA2 A;  2CA2 A;  1DMY A;  1BNT A;  2X7T A;  8CA2 A;  2HL4 A;  3B4F A;  1CIL A;  5G01 A;  4TWM A;  2HD6 A;  5BNL A;  3MNI A;  4QJO A;  1BN4 A;  3MHL A;  3T83 A;  1I90 A;  1I9O A;  5JEP B;  4RUX A;  4ILX A;  4ZWI A;  1G0F A;  1CVH A;  4JSW A;  1G46 A;  2EZ7 A;  4HEW A;  5JGT B;  3M5T A;  3OY0 A;  4IWZ A;  3D93 A;  4YX4 A;  4RIV A;  3D8W A;  1FSN A;  3W6H A;  1RZB A;  3M1K A;  5DOG A;  4BCW A;  1CAN A;  3UYQ A;  4Z1N A;  1CCT A;  1YDC A;  5E5U A;  1UGD A;  4CNV A;  5JES B;  4IDR X;  1TB0 X;  3M2X A;  3ZP9 A;  3M04 A;  1TH9 A;  1UGC A;  3RG4 A;  1F2W A;  3T82 A;  5EIJ A;  5EHE A;  2CBB A;  3KS3 A;  4L5U A;  4YWP A;  4ZX0 A;  1YDD A;  3V5G A;  4Q7V A;  2WEG A;  3MDZ A;  4XIX A;  4WUP A;  1URT A;  1CIM A; 
#chains in the Genus database with same CATH topology
 3IBL A;  1FR4 A;  5FNJ A;  5JG3 B;  2ILI A;  1CRM A;  4YHA A;  5CJF A;  1CIN A;  1G6V A;  1TG3 A;  4G7A A;  5FL6 A;  4XIW A;  3S72 B;  4E49 A;  4JSA A;  4ZWY A;  1I9M A;  1HEA A;  5C8I A;  3KON A;  1CVC A;  5FLR A;  4UOV A;  5EKJ A;  4PXX A;  4RN4 A;  4MDG A;  2FW4 A;  3OIK A;  2WEJ A;  3ML2 A;  3B1B A;  2NN1 A;  5FLS A;  1IF8 A;  4PYY A;  3RYV B;  4WL4 A;  5AMG A;  3DVC A;  1ZSA A;  3MHO A;  1RZC A;  1JV0 A;  2IT4 A;  3KOK A;  1G48 A;  2QOA A;  1TTM A;  3P3H A;  5CLU A;  3M3X A;  3F4X A;  3F8E A;  1DCA A;  3CA2 A;  4BF1 A;  5SZ2 A;  1ZSB A;  4QK1 A;  1BN3 A;  1ZNC A;  2FOQ A;  3R16 A;  4LHI A;  3M67 A;  1YO1 A;  4Q49 A;  4XE1 A;  3OYS A;  3HFP A;  3S78 B;  4K0Z A;  3T5Z A;  3CAJ A;  3DC9 A;  3F7U A;  2FOS A;  1BCD A;  1AM6 A;  3KKX A;  1RZE A;  3MZC A;  3V2J A;  3VBD A;  1BNN A;  2NWP A;  3FFP X;  5SZ5 A;  1G54 A;  2NNG A;  4X5S A;  3V3H B;  1Z93 A;  4HF3 A;  5AMD A;  3KLD B;  3IBU A;  1OKL A;  3P55 A;  3M2Z A;  3S75 B;  1FR7 A;  5DSQ A;  5EKM A;  4MDM A;  3U3A X;  5E2M A;  1CNX A;  1ZGF A;  5FL5 A;  3TMJ A;  4FRC A;  1TEQ X;  3PO6 A;  3V3I B;  1G45 A;  5EH8 A;  3U47 A;  3V3J A;  1CAY A;  4CA2 A;  3DV7 A;  1I9P A;  3RZ5 A;  4ZAO A;  5SZ1 A;  3D0N A;  5DSK A;  1G0E A;  3BL1 A;  3MMF A;  4Q6E A;  3MNJ A;  1IF4 A;  3L14 A;  2OSF A;  1KWQ A;  3V2M A;  4QJM A;  3P44 A;  3S74 B;  5AML A;  1BIC A;  4E3H A;  3SAP A;  3GZ0 A;  2H15 A;  1IF9 A;  5DSP A;  4QJX A;  1BNW A;  3FE4 A;  3OIL A;  1CCS A;  5FL4 A;  4QTL A;  5FNG A;  3HLJ A;  1TG9 A;  4WUQ A;  4Q7W A;  4L5W A;  3RLD A;  3S9T A;  1HCB A;  1HEB A;  1CAO A;  5E2S A;  1HVA A;  2ZNC A;  3P4V A;  3T84 A;  1IF6 A;  4QJP A;  3MNH A;  3CYU A;  4YGF A;  4XFW A;  1G4J A;  4RUY A;  12CA A;  4FVN A;  1HUH A;  5SZ7 A;  4FL7 A;  4KP8 A;  5FDC A;  5LMD A;  1CVD A;  1I9N A;  2X7S A;  2WEH A;  2HFW A;  3OKV A;  3MHI A;  3V3F A;  5SZ6 A;  1CA3 A;  5SZ0 A;  4E3G A;  3FW3 A;  3RZ8 A;  4N16 A;  1H9N A;  3RJ7 A;  2AX2 A;  4Q0L A;  1JD0 A;  1UGE A;  5E2R A;  3JXG A;  4ITO A;  5E5R A;  4YXI A;  4Q90 A;  3M2Y A;  1I9L A;  4KNI A;  5E2K A;  4MDL A;  4C3T A;  3S76 A;  1KOQ A;  4Q8Z A;  5FLQ A;  1CA2 A;  1H4N A;  3OKU A;  1RJ6 A;  1RJ5 A;  4KNN A;  4Q07 A;  4K1Q A;  4MLX A;  1KOP A;  4JS6 A;  5BYI A;  2FOV A;  2X7U A;  1BNM A;  4Q6D A;  1CAI A;  3S97 A;  1ZH9 A;  4R5B A;  4DZ9 A;  4YVY A;  3N2P A;  3M1J A;  1IF5 A;  5CAC A;  3F7B A;  4COQ A;  1BZM A;  5DSJ A;  3EFT A;  4GL1 X;  4RFC A;  1OKN A;  1AVN A;  5JGS B;  3RYY A;  4Z1J A;  4KUV A;  3MHC A;  1OQ5 A;  2WD2 A;  3M5S A;  1HUG A;  4ZWZ A;  3MYQ A;  1XEV A;  2FNK A;  1HED A;  1I91 A;  5SZ3 A;  5L3O A;  3RYJ B;  3RYX B;  3IBN A;  3MHM A;  4PQ7 A;  1Y7W A;  4HEY A;  1HEC A;  2NNS A;  3DA2 A;  1CNB A;  3HS4 A;  4YYT A;  1TE3 X;  3Q31 A;  5DSI A;  3IEO A;  5SZ4 A;  4CNX A;  2W2J A;  5FNM A;  4Q7P A;  1FLJ A;  5BRW A;  2FMG A;  1CNY A;  1FSR A;  2HNC A;  3DAZ A;  5DSN A;  3OYQ A;  1BV3 A;  4ZWX A;  5JDV B;  3P58 A;  4CNW A;  1ZFQ A;  4M2V A;  3DD0 A;  3LXE A;  1I9Q A;  3M5E A;  3RZ1 B;  1XEG A;  3BL0 A;  1FQN A;  1XQ0 A;  1FQL A;  4QEF A;  3DVB A;  4E5Q A;  3RZ7 A;  1FQM A;  3ZNC A;  4LU3 A;  2WEO A;  5EKH A;  4TWL A;  1H9Q A;  1ZFK A;  2ABE A;  3NI5 A;  5JQ0 A;  1FQR A;  3KNE A;  1FSQ A;  4WW8 A;  4M2W A;  2VVB X;  1LGD A;  1G4O A;  5JEH B;  1DMX A;  3DC3 A;  5J8Z A;  3S71 B;  4HT0 A;  4Z1E A;  2NN7 A;  5EZT X;  5G03 A;  4YGN A;  5EHV A;  1JCZ A;  3DD8 A;  2FMZ A;  3M40 A;  1CNI A;  4M2R A;  2POV A;  4WW6 A;  5A25 A;  3MNU A;  3N4B A;  1BNV A;  1YDB A;  5JQT A;  3T85 A;  4Q83 A;  3N3J A;  4QK3 A;  2NWO A;  4Q7S A;  1CNH A;  3W6I A;  4QJW A;  5BRU A;  1T9N A;  3DCC A;  1BN1 A;  4Q78 A;  2Q38 A;  4MTY A;  3NJ9 A;  4R59 A;  1KEQ A;  3M96 A;  4K13 A;  4RIU A;  4ETQ C;  2NWY A;  3C7P A;  3PYK A;  3DVD A;  4HEZ A;  3M14 A;  4JSZ A;  4E9O X;  4QY3 A;  5G0C A;  4FVO A;  2CBD A;  2NMX A;  1CAJ A;  3QYK A;  4KUY A;  2AW1 A;  3U45 X;  3HKN A;  3K34 A;  5DSR A;  4Q87 A;  4KNM A;  4Z1K A;  1TEU X;  5JG5 B;  4FU5 A;  1CNK A;  2CBC A;  3DCS A;  1RAZ A;  3OIM A;  5FNK A;  3M1W A;  2NNV A;  2FOU A;  4L5V A;  1BNQ A;  3KIG A;  4YGJ A;  2QO8 A;  2EU3 A;  4HU1 A;  5G0B A;  3RYZ A;  4YXU A;  5IPZ A;  1CCU A;  3S73 B;  3DBU A;  2NXT A;  2CAB A;  1CVF A;  4PZH A;  2F14 A;  4E4A A;  3S8X A;  1V9E A;  5FLP A;  1MUA A;  1TBT X;  4RH2 A;  1RZA A;  2CBA A;  5E2N A;  1G53 A;  3V3G B;  4K0T A;  5E28 A;  4Z0Q A;  3KOI A;  1CVB A;  1A42 A;  3D9Z A;  4K0S A;  1LG5 A;  2HOC A;  5DVX A;  5FNH A;  4KUW A;  2Q1Q A;  3KWA A;  4Q8Y A;  4CAC A;  3DCW A;  2GEH A;  1CAL A;  1UGA A;  1RAY A;  1YO0 A;  2POU A;  4QIY A;  4ITP A;  5CA2 A;  4YGK A;  4QK2 A;  4HBA A;  5FNL A;  1THK A;  4CQ0 A;  4BF6 A;  3M98 A;  5DSL A;  5BRV A;  5DRS A;  2OSM A;  4RFD A;  5FLO A;  4E3D A;  3MNK A;  2WD3 A;  4ZX1 A;  1RZD A;  4QSJ A;  3HKU A;  1CVA A;  5HPJ A;  1UGB A;  4Q06 A;  3HKT A;  2NXS A;  3N0N A;  3RG3 A;  5JEG B;  5DOH A;  3MWO A;  4XZ5 A;  1ZSC A;  3IAI A;  2VVA X;  1CAM A;  1G52 A;  1UGF A;  1AZM A;  1Z97 A;  1CNW A;  1CVE A;  1YDA A;  4N0X B;  4QJ0 A;  1UGG A;  4WR7 A;  2FOY A;  3TVN X;  3UYN A;  2HKK A;  4Q99 A;  9CA2 A;  2O4Z A;  1LZV A;  3RGE A;  1KWR A;  1EOU A;  6CA2 A;  1ZE8 A;  2GD8 A;  5L6K A;  4Q08 A;  3K7K A;  1CRA A;  4PYX A;  2NWZ A;  5DSM A;  2POW A;  3M1Q A;  1G3Z A;  3SBI A;  3TVO X;  4E3F A;  1IF7 A;  3EFI A;  1BNU A;  1CNC A;  4MLT A;  1CZM A;  3IBI A;  4Q9Y A;  4CNR A;  4RUZ A;  3K2F A;  4M2U A;  4R5A A;  3SBH A;  3PJJ A;  3JXH C;  1CNJ A;  1LUG A;  3NB5 A;  5DSO A;  4KAP A;  1XPZ A;  2FNN A;  2QP6 A;  4Q81 A;  1MOO A;  5FNI A;  2EU2 A;  3P3J A;  4JSS A;  3D92 A;  1HCA A;  2H4N A;  3P5L A;  2Q1B A;  5FLT A;  3M2N A;  4Q8X A;  1CNG A;  3BET A;  3IGP A;  4DZ7 A;  4YXO A;  3MNA A;  3CZV A;  1J9W A;  2FNM A;  5A6H A;  1G1D A;  1ZGE A;  4HT2 A;  4LP6 A;  4Y0J A;  2CBE A;  3ML5 A;  4KV0 A;  3R17 B;  1CAH A;  4QSB A;  5EOI A;  4QIZ A;  3V7X A;  2NNO A;  5FDI A;  4QSI A;  1LG6 A;  5EH7 A;  3JXF A;  3P5A A;  4MO8 A;  3HKQ A;  4KP5 A;  4YGL A;  1CAZ A;  3T5U A;  4FPT A;  1CAK A;  3SAX A;  4QSA A;  4G0C A;  1YO2 A;  5EH5 A;  4KNJ A;  3S77 B;  1OKM A;  4FIK A;  4Q09 A;  1V9I C;  2NXR A;  5EHW A;  3U7C A;  1I8Z A;  1Z9Y A;  1DCB A;  3RZ0 B;  7CA2 A;  2CA2 A;  1DMY A;  1BNT A;  2X7T A;  8CA2 A;  2HL4 A;  3B4F A;  1CIL A;  5G01 A;  4TWM A;  2HD6 A;  5BNL A;  3MNI A;  4QJO A;  1BN4 A;  3MHL A;  3T83 A;  1I90 A;  1I9O A;  5JEP B;  4RUX A;  4ILX A;  4ZWI A;  1G0F A;  1CVH A;  4JSW A;  1G46 A;  2EZ7 A;  4HEW A;  5JGT B;  3M5T A;  3OY0 A;  4IWZ A;  3D93 A;  4YX4 A;  4RIV A;  3D8W A;  1FSN A;  3W6H A;  1RZB A;  3M1K A;  5DOG A;  4BCW A;  1CAN A;  3UYQ A;  4Z1N A;  1CCT A;  1YDC A;  5E5U A;  1UGD A;  4CNV A;  5JES B;  4IDR X;  1TB0 X;  3M2X A;  3ZP9 A;  3M04 A;  1TH9 A;  1UGC A;  3RG4 A;  1F2W A;  3T82 A;  5EIJ A;  5EHE A;  2CBB A;  3KS3 A;  4L5U A;  4YWP A;  4ZX0 A;  1YDD A;  3V5G A;  4Q7V A;  2WEG A;  3MDZ A;  4XIX A;  4WUP A;  1URT A;  1CIM A; 
#chains in the Genus database with same CATH homology
 3IBL A;  1FR4 A;  5FNJ A;  5JG3 B;  2ILI A;  1CRM A;  4YHA A;  5CJF A;  1CIN A;  1G6V A;  1TG3 A;  4G7A A;  5FL6 A;  4XIW A;  3S72 B;  4E49 A;  4JSA A;  4ZWY A;  1I9M A;  1HEA A;  5C8I A;  3KON A;  1CVC A;  5FLR A;  4UOV A;  5EKJ A;  4PXX A;  4RN4 A;  4MDG A;  2FW4 A;  3OIK A;  2WEJ A;  3ML2 A;  3B1B A;  2NN1 A;  5FLS A;  1IF8 A;  4PYY A;  3RYV B;  4WL4 A;  5AMG A;  3DVC A;  1ZSA A;  3MHO A;  1RZC A;  1JV0 A;  2IT4 A;  3KOK A;  1G48 A;  2QOA A;  1TTM A;  3P3H A;  5CLU A;  3M3X A;  3F4X A;  3F8E A;  1DCA A;  3CA2 A;  4BF1 A;  5SZ2 A;  1ZSB A;  4QK1 A;  1BN3 A;  1ZNC A;  2FOQ A;  3R16 A;  4LHI A;  3M67 A;  1YO1 A;  4Q49 A;  4XE1 A;  3OYS A;  3HFP A;  3S78 B;  4K0Z A;  3T5Z A;  3CAJ A;  3DC9 A;  3F7U A;  2FOS A;  1BCD A;  1AM6 A;  3KKX A;  1RZE A;  3MZC A;  3V2J A;  3VBD A;  1BNN A;  2NWP A;  3FFP X;  5SZ5 A;  1G54 A;  2NNG A;  4X5S A;  3V3H B;  1Z93 A;  4HF3 A;  5AMD A;  3KLD B;  3IBU A;  1OKL A;  3P55 A;  3M2Z A;  3S75 B;  1FR7 A;  5DSQ A;  5EKM A;  4MDM A;  3U3A X;  5E2M A;  1CNX A;  1ZGF A;  5FL5 A;  3TMJ A;  4FRC A;  1TEQ X;  3PO6 A;  3V3I B;  1G45 A;  5EH8 A;  3U47 A;  3V3J A;  1CAY A;  4CA2 A;  3DV7 A;  1I9P A;  3RZ5 A;  4ZAO A;  5SZ1 A;  3D0N A;  5DSK A;  1G0E A;  3BL1 A;  3MMF A;  4Q6E A;  3MNJ A;  1IF4 A;  3L14 A;  2OSF A;  1KWQ A;  3V2M A;  4QJM A;  3P44 A;  3S74 B;  5AML A;  1BIC A;  4E3H A;  3SAP A;  3GZ0 A;  2H15 A;  1IF9 A;  5DSP A;  4QJX A;  1BNW A;  3FE4 A;  3OIL A;  1CCS A;  5FL4 A;  4QTL A;  5FNG A;  3HLJ A;  1TG9 A;  4WUQ A;  4Q7W A;  4L5W A;  3RLD A;  3S9T A;  1HCB A;  1HEB A;  1CAO A;  5E2S A;  1HVA A;  2ZNC A;  3P4V A;  3T84 A;  1IF6 A;  4QJP A;  3MNH A;  3CYU A;  4YGF A;  4XFW A;  1G4J A;  4RUY A;  12CA A;  4FVN A;  1HUH A;  5SZ7 A;  4FL7 A;  4KP8 A;  5FDC A;  5LMD A;  1CVD A;  1I9N A;  2X7S A;  2WEH A;  2HFW A;  3OKV A;  3MHI A;  3V3F A;  5SZ6 A;  1CA3 A;  5SZ0 A;  4E3G A;  3FW3 A;  3RZ8 A;  4N16 A;  1H9N A;  3RJ7 A;  2AX2 A;  4Q0L A;  1JD0 A;  1UGE A;  5E2R A;  3JXG A;  4ITO A;  5E5R A;  4YXI A;  4Q90 A;  3M2Y A;  1I9L A;  4KNI A;  5E2K A;  4MDL A;  4C3T A;  3S76 A;  1KOQ A;  4Q8Z A;  5FLQ A;  1CA2 A;  1H4N A;  3OKU A;  1RJ6 A;  1RJ5 A;  4KNN A;  4Q07 A;  4K1Q A;  4MLX A;  1KOP A;  4JS6 A;  5BYI A;  2FOV A;  2X7U A;  1BNM A;  4Q6D A;  1CAI A;  3S97 A;  1ZH9 A;  4R5B A;  4DZ9 A;  4YVY A;  3N2P A;  3M1J A;  1IF5 A;  5CAC A;  3F7B A;  4COQ A;  1BZM A;  5DSJ A;  3EFT A;  4GL1 X;  4RFC A;  1OKN A;  1AVN A;  5JGS B;  3RYY A;  4Z1J A;  4KUV A;  3MHC A;  1OQ5 A;  2WD2 A;  3M5S A;  1HUG A;  4ZWZ A;  3MYQ A;  1XEV A;  2FNK A;  1HED A;  1I91 A;  5SZ3 A;  5L3O A;  3RYJ B;  3RYX B;  3IBN A;  3MHM A;  4PQ7 A;  1Y7W A;  4HEY A;  1HEC A;  2NNS A;  3DA2 A;  1CNB A;  3HS4 A;  4YYT A;  1TE3 X;  3Q31 A;  5DSI A;  3IEO A;  5SZ4 A;  4CNX A;  2W2J A;  5FNM A;  4Q7P A;  1FLJ A;  5BRW A;  2FMG A;  1CNY A;  1FSR A;  2HNC A;  3DAZ A;  5DSN A;  3OYQ A;  1BV3 A;  4ZWX A;  5JDV B;  3P58 A;  4CNW A;  1ZFQ A;  4M2V A;  3DD0 A;  3LXE A;  1I9Q A;  3M5E A;  3RZ1 B;  1XEG A;  3BL0 A;  1FQN A;  1XQ0 A;  1FQL A;  4QEF A;  3DVB A;  4E5Q A;  3RZ7 A;  1FQM A;  3ZNC A;  4LU3 A;  2WEO A;  5EKH A;  4TWL A;  1H9Q A;  1ZFK A;  2ABE A;  3NI5 A;  5JQ0 A;  1FQR A;  3KNE A;  1FSQ A;  4WW8 A;  4M2W A;  2VVB X;  1LGD A;  1G4O A;  5JEH B;  1DMX A;  3DC3 A;  5J8Z A;  3S71 B;  4HT0 A;  4Z1E A;  2NN7 A;  5EZT X;  5G03 A;  4YGN A;  5EHV A;  1JCZ A;  3DD8 A;  2FMZ A;  3M40 A;  1CNI A;  4M2R A;  2POV A;  4WW6 A;  5A25 A;  3MNU A;  3N4B A;  1BNV A;  1YDB A;  5JQT A;  3T85 A;  4Q83 A;  3N3J A;  4QK3 A;  2NWO A;  4Q7S A;  1CNH A;  3W6I A;  4QJW A;  5BRU A;  1T9N A;  3DCC A;  1BN1 A;  4Q78 A;  2Q38 A;  4MTY A;  3NJ9 A;  4R59 A;  1KEQ A;  3M96 A;  4K13 A;  4RIU A;  4ETQ C;  2NWY A;  3C7P A;  3PYK A;  3DVD A;  4HEZ A;  3M14 A;  4JSZ A;  4E9O X;  4QY3 A;  5G0C A;  4FVO A;  2CBD A;  2NMX A;  1CAJ A;  3QYK A;  4KUY A;  2AW1 A;  3U45 X;  3HKN A;  3K34 A;  5DSR A;  4Q87 A;  4KNM A;  4Z1K A;  1TEU X;  5JG5 B;  4FU5 A;  1CNK A;  2CBC A;  3DCS A;  1RAZ A;  3OIM A;  5FNK A;  3M1W A;  2NNV A;  2FOU A;  4L5V A;  1BNQ A;  3KIG A;  4YGJ A;  2QO8 A;  2EU3 A;  4HU1 A;  5G0B A;  3RYZ A;  4YXU A;  5IPZ A;  1CCU A;  3S73 B;  3DBU A;  2NXT A;  2CAB A;  1CVF A;  4PZH A;  2F14 A;  4E4A A;  3S8X A;  1V9E A;  5FLP A;  1MUA A;  1TBT X;  4RH2 A;  1RZA A;  2CBA A;  5E2N A;  1G53 A;  3V3G B;  4K0T A;  5E28 A;  4Z0Q A;  3KOI A;  1CVB A;  1A42 A;  3D9Z A;  4K0S A;  1LG5 A;  2HOC A;  5DVX A;  5FNH A;  4KUW A;  2Q1Q A;  3KWA A;  4Q8Y A;  4CAC A;  3DCW A;  2GEH A;  1CAL A;  1UGA A;  1RAY A;  1YO0 A;  2POU A;  4QIY A;  4ITP A;  5CA2 A;  4YGK A;  4QK2 A;  4HBA A;  5FNL A;  1THK A;  4CQ0 A;  4BF6 A;  3M98 A;  5DSL A;  5BRV A;  5DRS A;  2OSM A;  4RFD A;  5FLO A;  4E3D A;  3MNK A;  2WD3 A;  4ZX1 A;  1RZD A;  4QSJ A;  3HKU A;  1CVA A;  5HPJ A;  1UGB A;  4Q06 A;  3HKT A;  2NXS A;  3N0N A;  3RG3 A;  5JEG B;  5DOH A;  3MWO A;  4XZ5 A;  1ZSC A;  3IAI A;  2VVA X;  1CAM A;  1G52 A;  1UGF A;  1AZM A;  1Z97 A;  1CNW A;  1CVE A;  1YDA A;  4N0X B;  4QJ0 A;  1UGG A;  4WR7 A;  2FOY A;  3TVN X;  3UYN A;  2HKK A;  4Q99 A;  9CA2 A;  2O4Z A;  1LZV A;  3RGE A;  1KWR A;  1EOU A;  6CA2 A;  1ZE8 A;  2GD8 A;  5L6K A;  4Q08 A;  3K7K A;  1CRA A;  4PYX A;  2NWZ A;  5DSM A;  2POW A;  3M1Q A;  1G3Z A;  3SBI A;  3TVO X;  4E3F A;  1IF7 A;  3EFI A;  1BNU A;  1CNC A;  4MLT A;  1CZM A;  3IBI A;  4Q9Y A;  4CNR A;  4RUZ A;  3K2F A;  4M2U A;  4R5A A;  3SBH A;  3PJJ A;  3JXH C;  1CNJ A;  1LUG A;  3NB5 A;  5DSO A;  4KAP A;  1XPZ A;  2FNN A;  2QP6 A;  4Q81 A;  1MOO A;  5FNI A;  2EU2 A;  3P3J A;  4JSS A;  3D92 A;  1HCA A;  2H4N A;  3P5L A;  2Q1B A;  5FLT A;  3M2N A;  4Q8X A;  1CNG A;  3BET A;  3IGP A;  4DZ7 A;  4YXO A;  3MNA A;  3CZV A;  1J9W A;  2FNM A;  5A6H A;  1G1D A;  1ZGE A;  4HT2 A;  4LP6 A;  4Y0J A;  2CBE A;  3ML5 A;  4KV0 A;  3R17 B;  1CAH A;  4QSB A;  5EOI A;  4QIZ A;  3V7X A;  2NNO A;  5FDI A;  4QSI A;  1LG6 A;  5EH7 A;  3JXF A;  3P5A A;  4MO8 A;  3HKQ A;  4KP5 A;  4YGL A;  1CAZ A;  3T5U A;  4FPT A;  1CAK A;  3SAX A;  4QSA A;  4G0C A;  1YO2 A;  5EH5 A;  4KNJ A;  3S77 B;  1OKM A;  4FIK A;  4Q09 A;  1V9I C;  2NXR A;  5EHW A;  3U7C A;  1I8Z A;  1Z9Y A;  1DCB A;  3RZ0 B;  7CA2 A;  2CA2 A;  1DMY A;  1BNT A;  2X7T A;  8CA2 A;  2HL4 A;  3B4F A;  1CIL A;  5G01 A;  4TWM A;  2HD6 A;  5BNL A;  3MNI A;  4QJO A;  1BN4 A;  3MHL A;  3T83 A;  1I90 A;  1I9O A;  5JEP B;  4RUX A;  4ILX A;  4ZWI A;  1G0F A;  1CVH A;  4JSW A;  1G46 A;  2EZ7 A;  4HEW A;  5JGT B;  3M5T A;  3OY0 A;  4IWZ A;  3D93 A;  4YX4 A;  4RIV A;  3D8W A;  1FSN A;  3W6H A;  1RZB A;  3M1K A;  5DOG A;  4BCW A;  1CAN A;  3UYQ A;  4Z1N A;  1CCT A;  1YDC A;  5E5U A;  1UGD A;  4CNV A;  5JES B;  4IDR X;  1TB0 X;  3M2X A;  3ZP9 A;  3M04 A;  1TH9 A;  1UGC A;  3RG4 A;  1F2W A;  3T82 A;  5EIJ A;  5EHE A;  2CBB A;  3KS3 A;  4L5U A;  4YWP A;  4ZX0 A;  1YDD A;  3V5G A;  4Q7V A;  2WEG A;  3MDZ A;  4XIX A;  4WUP A;  1URT A;  1CIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...