8CA2A

Engineering the hydrophobic pocket of carbonic anhydrase ii
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
255
structure length
255
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAHLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering the hydrophobic pocket of carbonic anhydrase II.
pubmed doi rcsb
molecule keywords CARBONIC ANHYDRASE II
molecule tags Lyase(oxo-acid)
source organism Homo sapiens
total genus 73
structure length 255
sequence length 255
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1991-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 8ca2A00
1TEQX 1BNWA 1H9NA 3GZ0A 1KWQA 3IEOA 1HCBA 8CA2A 1ZGEA 1JD0A 5DSPA 4HF3A 5EHEA 3F8EA 1I9LA 3VBDA 3HKNA 3S76A 4HU1A 1H9QA 4QIYA 3S73B 4BF6A 3HKTA 1BNNA 3L14A 1BN1A 1RZCA 1HUHA 4L5UA 1HCAA 3N0NA 4FVNA 3D93A 4KNIA 3C7PA 1G1DA 4ZAOA 4RN4A 4E3GA 5AMGA 3CZVA 4HT0A 1THKA 5DSJA 4MLTA 1ZH9A 4RFDA 5E5UA 4JSSA 3MNHA 1T9NA 5E2KA 1JCZA 2POVA 4MDLA 4PZHA 1XPZA 4Q99A 1BCDA 3T84A 4ZX0A 1AM6A 4QK2A 4YX4A 2X7UA 3M2XA 4Q7SA 1TTMA 2OSFA 4KNMA 2NWYA 2CBDA 3OY0A 1DMXA 4Q7WA 4R5AA 1CNGA 4LP6A 3M98A 4G7AA 4KNJA 3S8XA 1G3ZA 3U47A 3FFPX 5FDIA 4Q87A 4COQA 1CA2A 1RZAA 4HEYA 4R5BA 3S71B 1G6VA 1MUAA 3OKUA 1UGFA 3OYQA 4KNNA 3D8WA 3IBNA 5IPZA 1H4NA 3S72B 2VVBX 3DA2A 5FL4A 5FL6A 5SZ0A 3RZ8A 3V3JA 4KAPA 2ZNCA 4Z1EA 2EU3A 4R59A 1XQ0A 4G0CA 2WEGA 3P55A 3Q31A 3D92A 4Z1NA 3M14A 3V2JA 1XEGA 4HT2A 3MZCA 3OKVA 4GL1X 3RYVB 5BYIA 4YXUA 1CAJA 1LUGA 3N2PA 1V9IC 4WW6A 4YGNA 5JESB 1ZSBA 5JG3B 1RJ6A 3RLDA 1HECA 1FSNA 3U3AX 1FQMA 3RYYA 1DCAA 5A6HA 4PYYA 5G01A 4Q90A 1CNWA 4KP5A 4QIZA 1HEAA 1BNUA 5E5RA 5FLRA 3M40A 3RG3A 3B1BA 4X5SA 4Q83A 3KS3A 4K13A 1XEVA 2NMXA 1CCTA 3EFIA 3MNJA 3T85A 1HEDA 5JEHB 3IBUA 5CACA 3V3IB 4CNXA 1RZDA 2CBCA 3P58A 4PQ7A 5G0BA 3T83A 1CNKA 1LG5A 3R16A 2CBAA 3IBLA 3HS4A 2FMZA 1KWRA 1CCSA 5BRWA 4LHIA 5DSIA 2CBBA 5EKJA 2GD8A 1UGBA 1KOQA 4FVOA 3EFTA 5DSKA 4ZWIA 4QJ0A 4FU5A 1CZMA 3BETA 4WR7A 5FNLA 3K34A 5G03A 1FQNA 5EH8A 5FDCA 4RFCA 3CAJA 2NNVA 3DD0A 3F7BA 1BV3A 2NXSA 4L5VA 4TWLA 5E28A 5FLOA 5EKMA 5EIJA 1IF6A 5JGSB 1CAMA 2WEOA 4JS6A 5EH7A 1MOOA 4KUYA 2H15A 2Q38A 4CNRA 5DOHA 5E2NA 3P3JA 5E2SA 4DZ9A 1TE3X 3P5AA 5HPJA 5G0CA 12CAA 1G0FA 4XZ5A 3HLJA 1OKMA 1CAHA 1BNTA 5JDVB 3K7KA 2X7TA 5C8IA 3S75B 5CLUA 5JQ0A 3S97A 3KWAA 5DSLA 1CVAA 1TB0X 5FLTA 1CNCA 3KONA 4BCWA 4PYXA 1IF7A 1BZMA 5SZ7A 3RJ7A 4ZWYA 5FNHA 2Q1BA 3RZ7A 3DC9A 1ZE8A 3MDZA 4QK3A 4C3TA 5FNKA 2HFWA 1FR7A 3P3HA 4JSWA 2FNMA 1FSQA 1AVNA 1I9PA 1TEUX 3V2MA 4JSAA 1FLJA 4K0ZA 4MDMA 3RYXB 5BRUA 3M2ZA 5SZ5A 2ILIA 1CVHA 4M2RA 2NXTA 4MLXA 1CALA 4QSIA 5FNGA 1UGEA 1URTA 1OKNA 2CA2A 4M2UA 1ZFQA 5FLQA 9CA2A 4IWZA 1RAYA 4QJMA 3RZ1B 5LMDA 3P44A 1CILA 1I9MA 5J8ZA 2OSMA 2FNNA 1G53A 3RYJB 1G4JA 1BN4A 3TVNX 1YDBA 4E3DA 4JSZA 5SZ6A 4E3HA 3RGEA 3M1WA 4CQ0A 4HEZA 2NN7A 5FNJA 1F2WA 4ZWXA 5E2RA 1RJ5A 3P4VA 3D0NA 3IAIA 4KUVA 5FNIA 3DVCA 5DSOA 1EOUA 3DC3A 1YO2A 4QK1A 4Q6DA 4QEFA 3HKUA 4K1QA 4QJWA 4KP8A 3KOIA 3DAZA 3KLDB 3RZ0B 5JGTB 4YXOA 1YO1A 1CNHA 1ZGFA 1CVFA 5L3OA 4ZX1A 4Q6EA 5E2MA 2AW1A 2FOYA 1FQLA 1AZMA 4YGKA 3T5UA 5AMDA 3SAPA 4FL7A 4YWPA 1CRAA 4E9OX 1OKLA 2AX2A 2WD3A 2H4NA 2HL4A 1CVBA 3QYKA 3ZNCA 5EHWA 5DSMA 3M5SA 2NNGA 1V9EA 1CNYA 3RZ5A 1CA3A 1KOPA 1YDDA 3DCCA 1LG6A 4Q06A 2QP6A 4Q9YA 3D9ZA 3DV7A 2FOQA 1TG3A 3UYNA 4YYTA 1CRMA 4QSBA 3M1KA 1DCBA 3JXHC 3KIGA 4CNWA 3CA2A 3KOKA 4PXXA 1Z9YA 5SZ2A 3PO6A 5FNMA 2FOUA 1CAYA 4N16A 4Z1JA 5EZTX 5BNLA 4TWMA 1JV0A 4Q7PA 4Z0QA 2FNKA 3OYSA 2NWOA 1CAZA 5FLPA 4M2VA 1CNXA 4RH2A 1G54A 3SBHA 2WEHA 1LGDA 3PYKA 4RIVA 4XIWA 5JQTA 1IF4A 3UYQA 1G48A 4RIUA 1CINA 1FSRA 3MWOA 3MHCA 2HOCA 3M04A 3ML2A 1I91A 3JXFA 1CAOA 2CABA 4E3FA 4XIXA 2X7SA 3W6IA 4QSJA 3NI5A 3B4FA 3F4XA 1Z93A 3DCSA 3TMJA 5JG5B 1I9QA 4WUPA 3F7UA 3DVBA 4Q08A 3V5GA 3FW3A 4ITOA 1CVEA 4XFWA 2VVAX 1CVCA 4Q0LA 5SZ1A 4MO8A 4ETQC 1G0EA 4Q8XA 4RUXA 5DOGA 3V3HB 1J9WA 3OIKA 5EOIA 1HEBA 5EHVA 3KNEA 4L5WA 2NWZA 3DCWA 1HVAA 1UGAA 5JEPB 5JEGB 3K2FA 1Z97A 3M5TA 3S77B 4QJOA 5DVXA 4KUWA 3TVOX 1TBTX 4FPTA 1BNVA 1IF5A 1BICA 2CBEA 2IT4A 3V3FA 4CA2A 1CAIA 3CYUA 4YHAA 4Q8YA 4K0SA 3S78B 3MMFA 5CJFA 1ZNCA 3JXGA 5FLSA 2WEJA 4IDRX 3MNAA 6CA2A 2Q1QA 4HBAA 3IGPA 3MYQA 4RUYA 4ZWZA 1G4OA 3P5LA 2HKKA 2FW4A 1ZSCA 1I8ZA 5SZ3A 4Y0JA 2NNSA 4ITPA 5FL5A 1UGGA 1UGDA 1RZBA 3HKQA 3V3GB 3DD8A 4MTYA 3FE4A 4LU3A 3OIMA 4BF1A 1I9OA 3M2YA 4QY3A 3MHIA 4Q7VA 1BN3A 4Q81A 1DMYA 1YDAA 1G46A 3MNIA 1G45A 2EZ7A 5DSRA 3MHMA 1I9NA 3M1QA 1LZVA 1RAZA 1BNQA 5CA2A 2NWPA 4E49A 4YXIA 3U7CA 1ZFKA 2EU2A 2WD2A 3IBIA 4Q07A 4YGLA 3DVDA 4QJPA 1CNBA 3PJJA 4E4AA 4XE1A 3ML5A 1CIMA 2W2JA 4K0TA 4CNVA 4Q78A 1RZEA 1FR4A 2POWA 3N4BA 3W6HA 4WUQA 3RYZA 2NNOA 5SZ4A 4YGFA 4Q09A 2POUA 4FRCA 1YDCA 3MNUA 4E5QA 4DZ7A 1CCUA 1IF8A 2NN1A 5BRVA 5A25A 5EKHA 5DRSA 3NJ9A 1UGCA 1CNJA 3T82A 1BNMA 1FQRA 3HFPA 3BL0A 5AMLA 1TG9A 3M67A 2NXRA 1A42A 1IF9A 2QO8A 4YVYA 4YGJA 3SBIA 1Y7WA 3OILA 3M2NA 1CNIA 1CAKA 4QJXA 4WL4A 1ZSAA 2FMGA 2HNCA 1I90A 1G52A 3S74B 1TH9A 3M5EA 4KV0A 2FOVA 4Z1KA 3MHLA 2ABEA 3T5ZA 7CA2A 4QSAA 4FIKA 1HUGA 2GEHA 3LXEA 4RUZA 4M2WA 3M96A 2O4ZA 4WW8A 1KEQA 2HD6A 3ZP9A 1CANA 5L6KA 4Q49A 3R17B 5EH5A 4Q8ZA 3MHOA 1OQ5A 1YO0A 2FOSA 3KKXA 3NB5A 2F14A 4HEWA 3RG4A 3U45X 3MNKA 4ILXA 4MDGA 5DSNA 3DBUA 3M3XA 3V7XA 1CVDA 4N0XB 5DSQA 4CACA 2QOAA 4QTLA 4UOVA 3M1JA 3SAXA 3S9TA 3N3JA 3BL1A
chains in the Genus database with same CATH superfamily
1TEQX 1BNWA 1H9NA 3GZ0A 1KWQA 3IEOA 1HCBA 8CA2A 1ZGEA 1JD0A 5DSPA 4HF3A 5EHEA 3F8EA 1I9LA 3VBDA 3HKNA 3S76A 4HU1A 1H9QA 4QIYA 3S73B 4BF6A 3HKTA 1BNNA 3L14A 1BN1A 1RZCA 1HUHA 4L5UA 1HCAA 3N0NA 4FVNA 3D93A 4KNIA 3C7PA 1G1DA 4ZAOA 4RN4A 4E3GA 5AMGA 3CZVA 4HT0A 1THKA 5DSJA 4MLTA 1ZH9A 4RFDA 5E5UA 4JSSA 3MNHA 1T9NA 5E2KA 1JCZA 2POVA 4MDLA 4PZHA 1XPZA 4Q99A 1BCDA 3T84A 4ZX0A 1AM6A 4QK2A 4YX4A 2X7UA 3M2XA 4Q7SA 1TTMA 2OSFA 4KNMA 2NWYA 2CBDA 3OY0A 1DMXA 4Q7WA 4R5AA 1CNGA 4LP6A 3M98A 4G7AA 4KNJA 3S8XA 1G3ZA 3U47A 3FFPX 5FDIA 4Q87A 4COQA 1CA2A 1RZAA 4HEYA 4R5BA 3S71B 1G6VA 1MUAA 3OKUA 1UGFA 3OYQA 4KNNA 3D8WA 3IBNA 5IPZA 1H4NA 3S72B 2VVBX 3DA2A 5FL4A 5FL6A 5SZ0A 3RZ8A 3V3JA 4KAPA 2ZNCA 4Z1EA 2EU3A 4R59A 1XQ0A 4G0CA 2WEGA 3P55A 3Q31A 3D92A 4Z1NA 3M14A 3V2JA 1XEGA 4HT2A 3MZCA 3OKVA 4GL1X 3RYVB 5BYIA 4YXUA 1CAJA 1LUGA 3N2PA 1V9IC 4WW6A 4YGNA 5JESB 1ZSBA 5JG3B 1RJ6A 3RLDA 1HECA 1FSNA 3U3AX 1FQMA 3RYYA 1DCAA 5A6HA 4PYYA 5G01A 4Q90A 1CNWA 4KP5A 4QIZA 1HEAA 1BNUA 5E5RA 5FLRA 3M40A 3RG3A 3B1BA 4X5SA 4Q83A 3KS3A 4K13A 1XEVA 2NMXA 1CCTA 3EFIA 3MNJA 3T85A 1HEDA 5JEHB 3IBUA 5CACA 3V3IB 4CNXA 1RZDA 2CBCA 3P58A 4PQ7A 5G0BA 3T83A 1CNKA 1LG5A 3R16A 2CBAA 3IBLA 3HS4A 2FMZA 1KWRA 1CCSA 5BRWA 4LHIA 5DSIA 2CBBA 5EKJA 2GD8A 1UGBA 1KOQA 4FVOA 3EFTA 5DSKA 4ZWIA 4QJ0A 4FU5A 1CZMA 3BETA 4WR7A 5FNLA 3K34A 5G03A 1FQNA 5EH8A 5FDCA 4RFCA 3CAJA 2NNVA 3DD0A 3F7BA 1BV3A 2NXSA 4L5VA 4TWLA 5E28A 5FLOA 5EKMA 5EIJA 1IF6A 5JGSB 1CAMA 2WEOA 4JS6A 5EH7A 1MOOA 4KUYA 2H15A 2Q38A 4CNRA 5DOHA 5E2NA 3P3JA 5E2SA 4DZ9A 1TE3X 3P5AA 5HPJA 5G0CA 12CAA 1G0FA 4XZ5A 3HLJA 1OKMA 1CAHA 1BNTA 5JDVB 3K7KA 2X7TA 5C8IA 3S75B 5CLUA 5JQ0A 3S97A 3KWAA 5DSLA 1CVAA 1TB0X 5FLTA 1CNCA 3KONA 4BCWA 4PYXA 1IF7A 1BZMA 5SZ7A 3RJ7A 4ZWYA 5FNHA 2Q1BA 3RZ7A 3DC9A 1ZE8A 3MDZA 4QK3A 4C3TA 5FNKA 2HFWA 1FR7A 3P3HA 4JSWA 2FNMA 1FSQA 1AVNA 1I9PA 1TEUX 3V2MA 4JSAA 1FLJA 4K0ZA 4MDMA 3RYXB 5BRUA 3M2ZA 5SZ5A 2ILIA 1CVHA 4M2RA 2NXTA 4MLXA 1CALA 4QSIA 5FNGA 1UGEA 1URTA 1OKNA 2CA2A 4M2UA 1ZFQA 5FLQA 9CA2A 4IWZA 1RAYA 4QJMA 3RZ1B 5LMDA 3P44A 1CILA 1I9MA 5J8ZA 2OSMA 2FNNA 1G53A 3RYJB 1G4JA 1BN4A 3TVNX 1YDBA 4E3DA 4JSZA 5SZ6A 4E3HA 3RGEA 3M1WA 4CQ0A 4HEZA 2NN7A 5FNJA 1F2WA 4ZWXA 5E2RA 1RJ5A 3P4VA 3D0NA 3IAIA 4KUVA 5FNIA 3DVCA 5DSOA 1EOUA 3DC3A 1YO2A 4QK1A 4Q6DA 4QEFA 3HKUA 4K1QA 4QJWA 4KP8A 3KOIA 3DAZA 3KLDB 3RZ0B 5JGTB 4YXOA 1YO1A 1CNHA 1ZGFA 1CVFA 5L3OA 4ZX1A 4Q6EA 5E2MA 2AW1A 2FOYA 1FQLA 1AZMA 4YGKA 3T5UA 5AMDA 3SAPA 4FL7A 4YWPA 1CRAA 4E9OX 1OKLA 2AX2A 2WD3A 2H4NA 2HL4A 1CVBA 3QYKA 3ZNCA 5EHWA 5DSMA 3M5SA 2NNGA 1V9EA 1CNYA 3RZ5A 1CA3A 1KOPA 1YDDA 3DCCA 1LG6A 4Q06A 2QP6A 4Q9YA 3D9ZA 3DV7A 2FOQA 1TG3A 3UYNA 4YYTA 1CRMA 4QSBA 3M1KA 1DCBA 3JXHC 3KIGA 4CNWA 3CA2A 3KOKA 4PXXA 1Z9YA 5SZ2A 3PO6A 5FNMA 2FOUA 1CAYA 4N16A 4Z1JA 5EZTX 5BNLA 4TWMA 1JV0A 4Q7PA 4Z0QA 2FNKA 3OYSA 2NWOA 1CAZA 5FLPA 4M2VA 1CNXA 4RH2A 1G54A 3SBHA 2WEHA 1LGDA 3PYKA 4RIVA 4XIWA 5JQTA 1IF4A 3UYQA 1G48A 4RIUA 1CINA 1FSRA 3MWOA 3MHCA 2HOCA 3M04A 3ML2A 1I91A 3JXFA 1CAOA 2CABA 4E3FA 4XIXA 2X7SA 3W6IA 4QSJA 3NI5A 3B4FA 3F4XA 1Z93A 3DCSA 3TMJA 5JG5B 1I9QA 4WUPA 3F7UA 3DVBA 4Q08A 3V5GA 3FW3A 4ITOA 1CVEA 4XFWA 2VVAX 1CVCA 4Q0LA 5SZ1A 4MO8A 4ETQC 1G0EA 4Q8XA 4RUXA 5DOGA 3V3HB 1J9WA 3OIKA 5EOIA 1HEBA 5EHVA 3KNEA 4L5WA 2NWZA 3DCWA 1HVAA 1UGAA 5JEPB 5JEGB 3K2FA 1Z97A 3M5TA 3S77B 4QJOA 5DVXA 4KUWA 3TVOX 1TBTX 4FPTA 1BNVA 1IF5A 1BICA 2CBEA 2IT4A 3V3FA 4CA2A 1CAIA 3CYUA 4YHAA 4Q8YA 4K0SA 3S78B 3MMFA 5CJFA 1ZNCA 3JXGA 5FLSA 2WEJA 4IDRX 3MNAA 6CA2A 2Q1QA 4HBAA 3IGPA 3MYQA 4RUYA 4ZWZA 1G4OA 3P5LA 2HKKA 2FW4A 1ZSCA 1I8ZA 5SZ3A 4Y0JA 2NNSA 4ITPA 5FL5A 1UGGA 1UGDA 1RZBA 3HKQA 3V3GB 3DD8A 4MTYA 3FE4A 4LU3A 3OIMA 4BF1A 1I9OA 3M2YA 4QY3A 3MHIA 4Q7VA 1BN3A 4Q81A 1DMYA 1YDAA 1G46A 3MNIA 1G45A 2EZ7A 5DSRA 3MHMA 1I9NA 3M1QA 1LZVA 1RAZA 1BNQA 5CA2A 2NWPA 4E49A 4YXIA 3U7CA 1ZFKA 2EU2A 2WD2A 3IBIA 4Q07A 4YGLA 3DVDA 4QJPA 1CNBA 3PJJA 4E4AA 4XE1A 3ML5A 1CIMA 2W2JA 4K0TA 4CNVA 4Q78A 1RZEA 1FR4A 2POWA 3N4BA 3W6HA 4WUQA 3RYZA 2NNOA 5SZ4A 4YGFA 4Q09A 2POUA 4FRCA 1YDCA 3MNUA 4E5QA 4DZ7A 1CCUA 1IF8A 2NN1A 5BRVA 5A25A 5EKHA 5DRSA 3NJ9A 1UGCA 1CNJA 3T82A 1BNMA 1FQRA 3HFPA 3BL0A 5AMLA 1TG9A 3M67A 2NXRA 1A42A 1IF9A 2QO8A 4YVYA 4YGJA 3SBIA 1Y7WA 3OILA 3M2NA 1CNIA 1CAKA 4QJXA 4WL4A 1ZSAA 2FMGA 2HNCA 1I90A 1G52A 3S74B 1TH9A 3M5EA 4KV0A 2FOVA 4Z1KA 3MHLA 2ABEA 3T5ZA 7CA2A 4QSAA 4FIKA 1HUGA 2GEHA 3LXEA 4RUZA 4M2WA 3M96A 2O4ZA 4WW8A 1KEQA 2HD6A 3ZP9A 1CANA 5L6KA 4Q49A 3R17B 5EH5A 4Q8ZA 3MHOA 1OQ5A 1YO0A 2FOSA 3KKXA 3NB5A 2F14A 4HEWA 3RG4A 3U45X 3MNKA 4ILXA 4MDGA 5DSNA 3DBUA 3M3XA 3V7XA 1CVDA 4N0XB 5DSQA 4CACA 2QOAA 4QTLA 4UOVA 3M1JA 3SAXA 3S9TA 3N3JA 3BL1A
chains in the Genus database with same CATH topology
1TEQX 1BNWA 1H9NA 3GZ0A 1KWQA 3IEOA 1HCBA 8CA2A 1ZGEA 1JD0A 5DSPA 4HF3A 5EHEA 3F8EA 1I9LA 3VBDA 3HKNA 3S76A 4HU1A 1H9QA 4QIYA 3S73B 4BF6A 3HKTA 1BNNA 3L14A 1BN1A 1RZCA 1HUHA 4L5UA 1HCAA 3N0NA 4FVNA 3D93A 4KNIA 3C7PA 1G1DA 4ZAOA 4RN4A 4E3GA 5AMGA 3CZVA 4HT0A 1THKA 5DSJA 4MLTA 1ZH9A 4RFDA 5E5UA 4JSSA 3MNHA 1T9NA 5E2KA 1JCZA 2POVA 4MDLA 4PZHA 1XPZA 4Q99A 1BCDA 3T84A 4ZX0A 1AM6A 4QK2A 4YX4A 2X7UA 3M2XA 4Q7SA 1TTMA 2OSFA 4KNMA 2NWYA 2CBDA 3OY0A 1DMXA 4Q7WA 4R5AA 1CNGA 4LP6A 3M98A 4G7AA 4KNJA 3S8XA 1G3ZA 3U47A 3FFPX 5FDIA 4Q87A 4COQA 1CA2A 1RZAA 4HEYA 4R5BA 3S71B 1G6VA 1MUAA 3OKUA 1UGFA 3OYQA 4KNNA 3D8WA 3IBNA 5IPZA 1H4NA 3S72B 2VVBX 3DA2A 5FL4A 5FL6A 5SZ0A 3RZ8A 3V3JA 4KAPA 2ZNCA 4Z1EA 2EU3A 4R59A 1XQ0A 4G0CA 2WEGA 3P55A 3Q31A 3D92A 4Z1NA 3M14A 3V2JA 1XEGA 4HT2A 3MZCA 3OKVA 4GL1X 3RYVB 5BYIA 4YXUA 1CAJA 1LUGA 3N2PA 1V9IC 4WW6A 4YGNA 5JESB 1ZSBA 5JG3B 1RJ6A 3RLDA 1HECA 1FSNA 3U3AX 1FQMA 3RYYA 1DCAA 5A6HA 4PYYA 5G01A 4Q90A 1CNWA 4KP5A 4QIZA 1HEAA 1BNUA 5E5RA 5FLRA 3M40A 3RG3A 3B1BA 4X5SA 4Q83A 3KS3A 4K13A 1XEVA 2NMXA 1CCTA 3EFIA 3MNJA 3T85A 1HEDA 5JEHB 3IBUA 5CACA 3V3IB 4CNXA 1RZDA 2CBCA 3P58A 4PQ7A 5G0BA 3T83A 1CNKA 1LG5A 3R16A 2CBAA 3IBLA 3HS4A 2FMZA 1KWRA 1CCSA 5BRWA 4LHIA 5DSIA 2CBBA 5EKJA 2GD8A 1UGBA 1KOQA 4FVOA 3EFTA 5DSKA 4ZWIA 4QJ0A 4FU5A 1CZMA 3BETA 4WR7A 5FNLA 3K34A 5G03A 1FQNA 5EH8A 5FDCA 4RFCA 3CAJA 2NNVA 3DD0A 3F7BA 1BV3A 2NXSA 4L5VA 4TWLA 5E28A 5FLOA 5EKMA 5EIJA 1IF6A 5JGSB 1CAMA 2WEOA 4JS6A 5EH7A 1MOOA 4KUYA 2H15A 2Q38A 4CNRA 5DOHA 5E2NA 3P3JA 5E2SA 4DZ9A 1TE3X 3P5AA 5HPJA 5G0CA 12CAA 1G0FA 4XZ5A 3HLJA 1OKMA 1CAHA 1BNTA 5JDVB 3K7KA 2X7TA 5C8IA 3S75B 5CLUA 5JQ0A 3S97A 3KWAA 5DSLA 1CVAA 1TB0X 5FLTA 1CNCA 3KONA 4BCWA 4PYXA 1IF7A 1BZMA 5SZ7A 3RJ7A 4ZWYA 5FNHA 2Q1BA 3RZ7A 3DC9A 1ZE8A 3MDZA 4QK3A 4C3TA 5FNKA 2HFWA 1FR7A 3P3HA 4JSWA 2FNMA 1FSQA 1AVNA 1I9PA 1TEUX 3V2MA 4JSAA 1FLJA 4K0ZA 4MDMA 3RYXB 5BRUA 3M2ZA 5SZ5A 2ILIA 1CVHA 4M2RA 2NXTA 4MLXA 1CALA 4QSIA 5FNGA 1UGEA 1URTA 1OKNA 2CA2A 4M2UA 1ZFQA 5FLQA 9CA2A 4IWZA 1RAYA 4QJMA 3RZ1B 5LMDA 3P44A 1CILA 1I9MA 5J8ZA 2OSMA 2FNNA 1G53A 3RYJB 1G4JA 1BN4A 3TVNX 1YDBA 4E3DA 4JSZA 5SZ6A 4E3HA 3RGEA 3M1WA 4CQ0A 4HEZA 2NN7A 5FNJA 1F2WA 4ZWXA 5E2RA 1RJ5A 3P4VA 3D0NA 3IAIA 4KUVA 5FNIA 3DVCA 5DSOA 1EOUA 3DC3A 1YO2A 4QK1A 4Q6DA 4QEFA 3HKUA 4K1QA 4QJWA 4KP8A 3KOIA 3DAZA 3KLDB 3RZ0B 5JGTB 4YXOA 1YO1A 1CNHA 1ZGFA 1CVFA 5L3OA 4ZX1A 4Q6EA 5E2MA 2AW1A 2FOYA 1FQLA 1AZMA 4YGKA 3T5UA 5AMDA 3SAPA 4FL7A 4YWPA 1CRAA 4E9OX 1OKLA 2AX2A 2WD3A 2H4NA 2HL4A 1CVBA 3QYKA 3ZNCA 5EHWA 5DSMA 3M5SA 2NNGA 1V9EA 1CNYA 3RZ5A 1CA3A 1KOPA 1YDDA 3DCCA 1LG6A 4Q06A 2QP6A 4Q9YA 3D9ZA 3DV7A 2FOQA 1TG3A 3UYNA 4YYTA 1CRMA 4QSBA 3M1KA 1DCBA 3JXHC 3KIGA 4CNWA 3CA2A 3KOKA 4PXXA 1Z9YA 5SZ2A 3PO6A 5FNMA 2FOUA 1CAYA 4N16A 4Z1JA 5EZTX 5BNLA 4TWMA 1JV0A 4Q7PA 4Z0QA 2FNKA 3OYSA 2NWOA 1CAZA 5FLPA 4M2VA 1CNXA 4RH2A 1G54A 3SBHA 2WEHA 1LGDA 3PYKA 4RIVA 4XIWA 5JQTA 1IF4A 3UYQA 1G48A 4RIUA 1CINA 1FSRA 3MWOA 3MHCA 2HOCA 3M04A 3ML2A 1I91A 3JXFA 1CAOA 2CABA 4E3FA 4XIXA 2X7SA 3W6IA 4QSJA 3NI5A 3B4FA 3F4XA 1Z93A 3DCSA 3TMJA 5JG5B 1I9QA 4WUPA 3F7UA 3DVBA 4Q08A 3V5GA 3FW3A 4ITOA 1CVEA 4XFWA 2VVAX 1CVCA 4Q0LA 5SZ1A 4MO8A 4ETQC 1G0EA 4Q8XA 4RUXA 5DOGA 3V3HB 1J9WA 3OIKA 5EOIA 1HEBA 5EHVA 3KNEA 4L5WA 2NWZA 3DCWA 1HVAA 1UGAA 5JEPB 5JEGB 3K2FA 1Z97A 3M5TA 3S77B 4QJOA 5DVXA 4KUWA 3TVOX 1TBTX 4FPTA 1BNVA 1IF5A 1BICA 2CBEA 2IT4A 3V3FA 4CA2A 1CAIA 3CYUA 4YHAA 4Q8YA 4K0SA 3S78B 3MMFA 5CJFA 1ZNCA 3JXGA 5FLSA 2WEJA 4IDRX 3MNAA 6CA2A 2Q1QA 4HBAA 3IGPA 3MYQA 4RUYA 4ZWZA 1G4OA 3P5LA 2HKKA 2FW4A 1ZSCA 1I8ZA 5SZ3A 4Y0JA 2NNSA 4ITPA 5FL5A 1UGGA 1UGDA 1RZBA 3HKQA 3V3GB 3DD8A 4MTYA 3FE4A 4LU3A 3OIMA 4BF1A 1I9OA 3M2YA 4QY3A 3MHIA 4Q7VA 1BN3A 4Q81A 1DMYA 1YDAA 1G46A 3MNIA 1G45A 2EZ7A 5DSRA 3MHMA 1I9NA 3M1QA 1LZVA 1RAZA 1BNQA 5CA2A 2NWPA 4E49A 4YXIA 3U7CA 1ZFKA 2EU2A 2WD2A 3IBIA 4Q07A 4YGLA 3DVDA 4QJPA 1CNBA 3PJJA 4E4AA 4XE1A 3ML5A 1CIMA 2W2JA 4K0TA 4CNVA 4Q78A 1RZEA 1FR4A 2POWA 3N4BA 3W6HA 4WUQA 3RYZA 2NNOA 5SZ4A 4YGFA 4Q09A 2POUA 4FRCA 1YDCA 3MNUA 4E5QA 4DZ7A 1CCUA 1IF8A 2NN1A 5BRVA 5A25A 5EKHA 5DRSA 3NJ9A 1UGCA 1CNJA 3T82A 1BNMA 1FQRA 3HFPA 3BL0A 5AMLA 1TG9A 3M67A 2NXRA 1A42A 1IF9A 2QO8A 4YVYA 4YGJA 3SBIA 1Y7WA 3OILA 3M2NA 1CNIA 1CAKA 4QJXA 4WL4A 1ZSAA 2FMGA 2HNCA 1I90A 1G52A 3S74B 1TH9A 3M5EA 4KV0A 2FOVA 4Z1KA 3MHLA 2ABEA 3T5ZA 7CA2A 4QSAA 4FIKA 1HUGA 2GEHA 3LXEA 4RUZA 4M2WA 3M96A 2O4ZA 4WW8A 1KEQA 2HD6A 3ZP9A 1CANA 5L6KA 4Q49A 3R17B 5EH5A 4Q8ZA 3MHOA 1OQ5A 1YO0A 2FOSA 3KKXA 3NB5A 2F14A 4HEWA 3RG4A 3U45X 3MNKA 4ILXA 4MDGA 5DSNA 3DBUA 3M3XA 3V7XA 1CVDA 4N0XB 5DSQA 4CACA 2QOAA 4QTLA 4UOVA 3M1JA 3SAXA 3S9TA 3N3JA 3BL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TEQ X;  1BNW A;  1H9N A;  3GZ0 A;  1KWQ A;  3IEO A;  1HCB A;  8CA2 A;  1ZGE A;  1JD0 A;  5DSP A;  4HF3 A;  5EHE A;  3F8E A;  1I9L A;  3VBD A;  3HKN A;  3S76 A;  4HU1 A;  1H9Q A;  4QIY A;  3S73 B;  4BF6 A;  3HKT A;  1BNN A;  3L14 A;  1BN1 A;  1RZC A;  1HUH A;  4L5U A;  1HCA A;  3N0N A;  4FVN A;  3D93 A;  4KNI A;  3C7P A;  1G1D A;  4ZAO A;  4RN4 A;  4E3G A;  5AMG A;  3CZV A;  4HT0 A;  1THK A;  5DSJ A;  4MLT A;  1ZH9 A;  4RFD A;  5E5U A;  4JSS A;  3MNH A;  1T9N A;  5E2K A;  1JCZ A;  2POV A;  4MDL A;  4PZH A;  1XPZ A;  4Q99 A;  1BCD A;  3T84 A;  4ZX0 A;  1AM6 A;  4QK2 A;  4YX4 A;  2X7U A;  3M2X A;  4Q7S A;  1TTM A;  2OSF A;  4KNM A;  2NWY A;  2CBD A;  3OY0 A;  1DMX A;  4Q7W A;  4R5A A;  1CNG A;  4LP6 A;  3M98 A;  4G7A A;  4KNJ A;  3S8X A;  1G3Z A;  3U47 A;  3FFP X;  5FDI A;  4Q87 A;  4COQ A;  1CA2 A;  1RZA A;  4HEY A;  4R5B A;  3S71 B;  1G6V A;  1MUA A;  3OKU A;  1UGF A;  3OYQ A;  4KNN A;  3D8W A;  3IBN A;  5IPZ A;  1H4N A;  3S72 B;  2VVB X;  3DA2 A;  5FL4 A;  5FL6 A;  5SZ0 A;  3RZ8 A;  3V3J A;  4KAP A;  2ZNC A;  4Z1E A;  2EU3 A;  4R59 A;  1XQ0 A;  4G0C A;  2WEG A;  3P55 A;  3Q31 A;  3D92 A;  4Z1N A;  3M14 A;  3V2J A;  1XEG A;  4HT2 A;  3MZC A;  3OKV A;  4GL1 X;  3RYV B;  5BYI A;  4YXU A;  1CAJ A;  1LUG A;  3N2P A;  1V9I C;  4WW6 A;  4YGN A;  5JES B;  1ZSB A;  5JG3 B;  1RJ6 A;  3RLD A;  1HEC A;  1FSN A;  3U3A X;  1FQM A;  3RYY A;  1DCA A;  5A6H A;  4PYY A;  5G01 A;  4Q90 A;  1CNW A;  4KP5 A;  4QIZ A;  1HEA A;  1BNU A;  5E5R A;  5FLR A;  3M40 A;  3RG3 A;  3B1B A;  4X5S A;  4Q83 A;  3KS3 A;  4K13 A;  1XEV A;  2NMX A;  1CCT A;  3EFI A;  3MNJ A;  3T85 A;  1HED A;  5JEH B;  3IBU A;  5CAC A;  3V3I B;  4CNX A;  1RZD A;  2CBC A;  3P58 A;  4PQ7 A;  5G0B A;  3T83 A;  1CNK A;  1LG5 A;  3R16 A;  2CBA A;  3IBL A;  3HS4 A;  2FMZ A;  1KWR A;  1CCS A;  5BRW A;  4LHI A;  5DSI A;  2CBB A;  5EKJ A;  2GD8 A;  1UGB A;  1KOQ A;  4FVO A;  3EFT A;  5DSK A;  4ZWI A;  4QJ0 A;  4FU5 A;  1CZM A;  3BET A;  4WR7 A;  5FNL A;  3K34 A;  5G03 A;  1FQN A;  5EH8 A;  5FDC A;  4RFC A;  3CAJ A;  2NNV A;  3DD0 A;  3F7B A;  1BV3 A;  2NXS A;  4L5V A;  4TWL A;  5E28 A;  5FLO A;  5EKM A;  5EIJ A;  1IF6 A;  5JGS B;  1CAM A;  2WEO A;  4JS6 A;  5EH7 A;  1MOO A;  4KUY A;  2H15 A;  2Q38 A;  4CNR A;  5DOH A;  5E2N A;  3P3J A;  5E2S A;  4DZ9 A;  1TE3 X;  3P5A A;  5HPJ A;  5G0C A;  12CA A;  1G0F A;  4XZ5 A;  3HLJ A;  1OKM A;  1CAH A;  1BNT A;  5JDV B;  3K7K A;  2X7T A;  5C8I A;  3S75 B;  5CLU A;  5JQ0 A;  3S97 A;  3KWA A;  5DSL A;  1CVA A;  1TB0 X;  5FLT A;  1CNC A;  3KON A;  4BCW A;  4PYX A;  1IF7 A;  1BZM A;  5SZ7 A;  3RJ7 A;  4ZWY A;  5FNH A;  2Q1B A;  3RZ7 A;  3DC9 A;  1ZE8 A;  3MDZ A;  4QK3 A;  4C3T A;  5FNK A;  2HFW A;  1FR7 A;  3P3H A;  4JSW A;  2FNM A;  1FSQ A;  1AVN A;  1I9P A;  1TEU X;  3V2M A;  4JSA A;  1FLJ A;  4K0Z A;  4MDM A;  3RYX B;  5BRU A;  3M2Z A;  5SZ5 A;  2ILI A;  1CVH A;  4M2R A;  2NXT A;  4MLX A;  1CAL A;  4QSI A;  5FNG A;  1UGE A;  1URT A;  1OKN A;  2CA2 A;  4M2U A;  1ZFQ A;  5FLQ A;  9CA2 A;  4IWZ A;  1RAY A;  4QJM A;  3RZ1 B;  5LMD A;  3P44 A;  1CIL A;  1I9M A;  5J8Z A;  2OSM A;  2FNN A;  1G53 A;  3RYJ B;  1G4J A;  1BN4 A;  3TVN X;  1YDB A;  4E3D A;  4JSZ A;  5SZ6 A;  4E3H A;  3RGE A;  3M1W A;  4CQ0 A;  4HEZ A;  2NN7 A;  5FNJ A;  1F2W A;  4ZWX A;  5E2R A;  1RJ5 A;  3P4V A;  3D0N A;  3IAI A;  4KUV A;  5FNI A;  3DVC A;  5DSO A;  1EOU A;  3DC3 A;  1YO2 A;  4QK1 A;  4Q6D A;  4QEF A;  3HKU A;  4K1Q A;  4QJW A;  4KP8 A;  3KOI A;  3DAZ A;  3KLD B;  3RZ0 B;  5JGT B;  4YXO A;  1YO1 A;  1CNH A;  1ZGF A;  1CVF A;  5L3O A;  4ZX1 A;  4Q6E A;  5E2M A;  2AW1 A;  2FOY A;  1FQL A;  1AZM A;  4YGK A;  3T5U A;  5AMD A;  3SAP A;  4FL7 A;  4YWP A;  1CRA A;  4E9O X;  1OKL A;  2AX2 A;  2WD3 A;  2H4N A;  2HL4 A;  1CVB A;  3QYK A;  3ZNC A;  5EHW A;  5DSM A;  3M5S A;  2NNG A;  1V9E A;  1CNY A;  3RZ5 A;  1CA3 A;  1KOP A;  1YDD A;  3DCC A;  1LG6 A;  4Q06 A;  2QP6 A;  4Q9Y A;  3D9Z A;  3DV7 A;  2FOQ A;  1TG3 A;  3UYN A;  4YYT A;  1CRM A;  4QSB A;  3M1K A;  1DCB A;  3JXH C;  3KIG A;  4CNW A;  3CA2 A;  3KOK A;  4PXX A;  1Z9Y A;  5SZ2 A;  3PO6 A;  5FNM A;  2FOU A;  1CAY A;  4N16 A;  4Z1J A;  5EZT X;  5BNL A;  4TWM A;  1JV0 A;  4Q7P A;  4Z0Q A;  2FNK A;  3OYS A;  2NWO A;  1CAZ A;  5FLP A;  4M2V A;  1CNX A;  4RH2 A;  1G54 A;  3SBH A;  2WEH A;  1LGD A;  3PYK A;  4RIV A;  4XIW A;  5JQT A;  1IF4 A;  3UYQ A;  1G48 A;  4RIU A;  1CIN A;  1FSR A;  3MWO A;  3MHC A;  2HOC A;  3M04 A;  3ML2 A;  1I91 A;  3JXF A;  1CAO A;  2CAB A;  4E3F A;  4XIX A;  2X7S A;  3W6I A;  4QSJ A;  3NI5 A;  3B4F A;  3F4X A;  1Z93 A;  3DCS A;  3TMJ A;  5JG5 B;  1I9Q A;  4WUP A;  3F7U A;  3DVB A;  4Q08 A;  3V5G A;  3FW3 A;  4ITO A;  1CVE A;  4XFW A;  2VVA X;  1CVC A;  4Q0L A;  5SZ1 A;  4MO8 A;  4ETQ C;  1G0E A;  4Q8X A;  4RUX A;  5DOG A;  3V3H B;  1J9W A;  3OIK A;  5EOI A;  1HEB A;  5EHV A;  3KNE A;  4L5W A;  2NWZ A;  3DCW A;  1HVA A;  1UGA A;  5JEP B;  5JEG B;  3K2F A;  1Z97 A;  3M5T A;  3S77 B;  4QJO A;  5DVX A;  4KUW A;  3TVO X;  1TBT X;  4FPT A;  1BNV A;  1IF5 A;  1BIC A;  2CBE A;  2IT4 A;  3V3F A;  4CA2 A;  1CAI A;  3CYU A;  4YHA A;  4Q8Y A;  4K0S A;  3S78 B;  3MMF A;  5CJF A;  1ZNC A;  3JXG A;  5FLS A;  2WEJ A;  4IDR X;  3MNA A;  6CA2 A;  2Q1Q A;  4HBA A;  3IGP A;  3MYQ A;  4RUY A;  4ZWZ A;  1G4O A;  3P5L A;  2HKK A;  2FW4 A;  1ZSC A;  1I8Z A;  5SZ3 A;  4Y0J A;  2NNS A;  4ITP A;  5FL5 A;  1UGG A;  1UGD A;  1RZB A;  3HKQ A;  3V3G B;  3DD8 A;  4MTY A;  3FE4 A;  4LU3 A;  3OIM A;  4BF1 A;  1I9O A;  3M2Y A;  4QY3 A;  3MHI A;  4Q7V A;  1BN3 A;  4Q81 A;  1DMY A;  1YDA A;  1G46 A;  3MNI A;  1G45 A;  2EZ7 A;  5DSR A;  3MHM A;  1I9N A;  3M1Q A;  1LZV A;  1RAZ A;  1BNQ A;  5CA2 A;  2NWP A;  4E49 A;  4YXI A;  3U7C A;  1ZFK A;  2EU2 A;  2WD2 A;  3IBI A;  4Q07 A;  4YGL A;  3DVD A;  4QJP A;  1CNB A;  3PJJ A;  4E4A A;  4XE1 A;  3ML5 A;  1CIM A;  2W2J A;  4K0T A;  4CNV A;  4Q78 A;  1RZE A;  1FR4 A;  2POW A;  3N4B A;  3W6H A;  4WUQ A;  3RYZ A;  2NNO A;  5SZ4 A;  4YGF A;  4Q09 A;  2POU A;  4FRC A;  1YDC A;  3MNU A;  4E5Q A;  4DZ7 A;  1CCU A;  1IF8 A;  2NN1 A;  5BRV A;  5A25 A;  5EKH A;  5DRS A;  3NJ9 A;  1UGC A;  1CNJ A;  3T82 A;  1BNM A;  1FQR A;  3HFP A;  3BL0 A;  5AML A;  1TG9 A;  3M67 A;  2NXR A;  1A42 A;  1IF9 A;  2QO8 A;  4YVY A;  4YGJ A;  3SBI A;  1Y7W A;  3OIL A;  3M2N A;  1CNI A;  1CAK A;  4QJX A;  4WL4 A;  1ZSA A;  2FMG A;  2HNC A;  1I90 A;  1G52 A;  3S74 B;  1TH9 A;  3M5E A;  4KV0 A;  2FOV A;  4Z1K A;  3MHL A;  2ABE A;  3T5Z A;  7CA2 A;  4QSA A;  4FIK A;  1HUG A;  2GEH A;  3LXE A;  4RUZ A;  4M2W A;  3M96 A;  2O4Z A;  4WW8 A;  1KEQ A;  2HD6 A;  3ZP9 A;  1CAN A;  5L6K A;  4Q49 A;  3R17 B;  5EH5 A;  4Q8Z A;  3MHO A;  1OQ5 A;  1YO0 A;  2FOS A;  3KKX A;  3NB5 A;  2F14 A;  4HEW A;  3RG4 A;  3U45 X;  3MNK A;  4ILX A;  4MDG A;  5DSN A;  3DBU A;  3M3X A;  3V7X A;  1CVD A;  4N0X B;  5DSQ A;  4CAC A;  2QOA A;  4QTL A;  4UOV A;  3M1J A;  3SAX A;  3S9T A;  3N3J A;  3BL1 A; 
#chains in the Genus database with same CATH topology
 1TEQ X;  1BNW A;  1H9N A;  3GZ0 A;  1KWQ A;  3IEO A;  1HCB A;  8CA2 A;  1ZGE A;  1JD0 A;  5DSP A;  4HF3 A;  5EHE A;  3F8E A;  1I9L A;  3VBD A;  3HKN A;  3S76 A;  4HU1 A;  1H9Q A;  4QIY A;  3S73 B;  4BF6 A;  3HKT A;  1BNN A;  3L14 A;  1BN1 A;  1RZC A;  1HUH A;  4L5U A;  1HCA A;  3N0N A;  4FVN A;  3D93 A;  4KNI A;  3C7P A;  1G1D A;  4ZAO A;  4RN4 A;  4E3G A;  5AMG A;  3CZV A;  4HT0 A;  1THK A;  5DSJ A;  4MLT A;  1ZH9 A;  4RFD A;  5E5U A;  4JSS A;  3MNH A;  1T9N A;  5E2K A;  1JCZ A;  2POV A;  4MDL A;  4PZH A;  1XPZ A;  4Q99 A;  1BCD A;  3T84 A;  4ZX0 A;  1AM6 A;  4QK2 A;  4YX4 A;  2X7U A;  3M2X A;  4Q7S A;  1TTM A;  2OSF A;  4KNM A;  2NWY A;  2CBD A;  3OY0 A;  1DMX A;  4Q7W A;  4R5A A;  1CNG A;  4LP6 A;  3M98 A;  4G7A A;  4KNJ A;  3S8X A;  1G3Z A;  3U47 A;  3FFP X;  5FDI A;  4Q87 A;  4COQ A;  1CA2 A;  1RZA A;  4HEY A;  4R5B A;  3S71 B;  1G6V A;  1MUA A;  3OKU A;  1UGF A;  3OYQ A;  4KNN A;  3D8W A;  3IBN A;  5IPZ A;  1H4N A;  3S72 B;  2VVB X;  3DA2 A;  5FL4 A;  5FL6 A;  5SZ0 A;  3RZ8 A;  3V3J A;  4KAP A;  2ZNC A;  4Z1E A;  2EU3 A;  4R59 A;  1XQ0 A;  4G0C A;  2WEG A;  3P55 A;  3Q31 A;  3D92 A;  4Z1N A;  3M14 A;  3V2J A;  1XEG A;  4HT2 A;  3MZC A;  3OKV A;  4GL1 X;  3RYV B;  5BYI A;  4YXU A;  1CAJ A;  1LUG A;  3N2P A;  1V9I C;  4WW6 A;  4YGN A;  5JES B;  1ZSB A;  5JG3 B;  1RJ6 A;  3RLD A;  1HEC A;  1FSN A;  3U3A X;  1FQM A;  3RYY A;  1DCA A;  5A6H A;  4PYY A;  5G01 A;  4Q90 A;  1CNW A;  4KP5 A;  4QIZ A;  1HEA A;  1BNU A;  5E5R A;  5FLR A;  3M40 A;  3RG3 A;  3B1B A;  4X5S A;  4Q83 A;  3KS3 A;  4K13 A;  1XEV A;  2NMX A;  1CCT A;  3EFI A;  3MNJ A;  3T85 A;  1HED A;  5JEH B;  3IBU A;  5CAC A;  3V3I B;  4CNX A;  1RZD A;  2CBC A;  3P58 A;  4PQ7 A;  5G0B A;  3T83 A;  1CNK A;  1LG5 A;  3R16 A;  2CBA A;  3IBL A;  3HS4 A;  2FMZ A;  1KWR A;  1CCS A;  5BRW A;  4LHI A;  5DSI A;  2CBB A;  5EKJ A;  2GD8 A;  1UGB A;  1KOQ A;  4FVO A;  3EFT A;  5DSK A;  4ZWI A;  4QJ0 A;  4FU5 A;  1CZM A;  3BET A;  4WR7 A;  5FNL A;  3K34 A;  5G03 A;  1FQN A;  5EH8 A;  5FDC A;  4RFC A;  3CAJ A;  2NNV A;  3DD0 A;  3F7B A;  1BV3 A;  2NXS A;  4L5V A;  4TWL A;  5E28 A;  5FLO A;  5EKM A;  5EIJ A;  1IF6 A;  5JGS B;  1CAM A;  2WEO A;  4JS6 A;  5EH7 A;  1MOO A;  4KUY A;  2H15 A;  2Q38 A;  4CNR A;  5DOH A;  5E2N A;  3P3J A;  5E2S A;  4DZ9 A;  1TE3 X;  3P5A A;  5HPJ A;  5G0C A;  12CA A;  1G0F A;  4XZ5 A;  3HLJ A;  1OKM A;  1CAH A;  1BNT A;  5JDV B;  3K7K A;  2X7T A;  5C8I A;  3S75 B;  5CLU A;  5JQ0 A;  3S97 A;  3KWA A;  5DSL A;  1CVA A;  1TB0 X;  5FLT A;  1CNC A;  3KON A;  4BCW A;  4PYX A;  1IF7 A;  1BZM A;  5SZ7 A;  3RJ7 A;  4ZWY A;  5FNH A;  2Q1B A;  3RZ7 A;  3DC9 A;  1ZE8 A;  3MDZ A;  4QK3 A;  4C3T A;  5FNK A;  2HFW A;  1FR7 A;  3P3H A;  4JSW A;  2FNM A;  1FSQ A;  1AVN A;  1I9P A;  1TEU X;  3V2M A;  4JSA A;  1FLJ A;  4K0Z A;  4MDM A;  3RYX B;  5BRU A;  3M2Z A;  5SZ5 A;  2ILI A;  1CVH A;  4M2R A;  2NXT A;  4MLX A;  1CAL A;  4QSI A;  5FNG A;  1UGE A;  1URT A;  1OKN A;  2CA2 A;  4M2U A;  1ZFQ A;  5FLQ A;  9CA2 A;  4IWZ A;  1RAY A;  4QJM A;  3RZ1 B;  5LMD A;  3P44 A;  1CIL A;  1I9M A;  5J8Z A;  2OSM A;  2FNN A;  1G53 A;  3RYJ B;  1G4J A;  1BN4 A;  3TVN X;  1YDB A;  4E3D A;  4JSZ A;  5SZ6 A;  4E3H A;  3RGE A;  3M1W A;  4CQ0 A;  4HEZ A;  2NN7 A;  5FNJ A;  1F2W A;  4ZWX A;  5E2R A;  1RJ5 A;  3P4V A;  3D0N A;  3IAI A;  4KUV A;  5FNI A;  3DVC A;  5DSO A;  1EOU A;  3DC3 A;  1YO2 A;  4QK1 A;  4Q6D A;  4QEF A;  3HKU A;  4K1Q A;  4QJW A;  4KP8 A;  3KOI A;  3DAZ A;  3KLD B;  3RZ0 B;  5JGT B;  4YXO A;  1YO1 A;  1CNH A;  1ZGF A;  1CVF A;  5L3O A;  4ZX1 A;  4Q6E A;  5E2M A;  2AW1 A;  2FOY A;  1FQL A;  1AZM A;  4YGK A;  3T5U A;  5AMD A;  3SAP A;  4FL7 A;  4YWP A;  1CRA A;  4E9O X;  1OKL A;  2AX2 A;  2WD3 A;  2H4N A;  2HL4 A;  1CVB A;  3QYK A;  3ZNC A;  5EHW A;  5DSM A;  3M5S A;  2NNG A;  1V9E A;  1CNY A;  3RZ5 A;  1CA3 A;  1KOP A;  1YDD A;  3DCC A;  1LG6 A;  4Q06 A;  2QP6 A;  4Q9Y A;  3D9Z A;  3DV7 A;  2FOQ A;  1TG3 A;  3UYN A;  4YYT A;  1CRM A;  4QSB A;  3M1K A;  1DCB A;  3JXH C;  3KIG A;  4CNW A;  3CA2 A;  3KOK A;  4PXX A;  1Z9Y A;  5SZ2 A;  3PO6 A;  5FNM A;  2FOU A;  1CAY A;  4N16 A;  4Z1J A;  5EZT X;  5BNL A;  4TWM A;  1JV0 A;  4Q7P A;  4Z0Q A;  2FNK A;  3OYS A;  2NWO A;  1CAZ A;  5FLP A;  4M2V A;  1CNX A;  4RH2 A;  1G54 A;  3SBH A;  2WEH A;  1LGD A;  3PYK A;  4RIV A;  4XIW A;  5JQT A;  1IF4 A;  3UYQ A;  1G48 A;  4RIU A;  1CIN A;  1FSR A;  3MWO A;  3MHC A;  2HOC A;  3M04 A;  3ML2 A;  1I91 A;  3JXF A;  1CAO A;  2CAB A;  4E3F A;  4XIX A;  2X7S A;  3W6I A;  4QSJ A;  3NI5 A;  3B4F A;  3F4X A;  1Z93 A;  3DCS A;  3TMJ A;  5JG5 B;  1I9Q A;  4WUP A;  3F7U A;  3DVB A;  4Q08 A;  3V5G A;  3FW3 A;  4ITO A;  1CVE A;  4XFW A;  2VVA X;  1CVC A;  4Q0L A;  5SZ1 A;  4MO8 A;  4ETQ C;  1G0E A;  4Q8X A;  4RUX A;  5DOG A;  3V3H B;  1J9W A;  3OIK A;  5EOI A;  1HEB A;  5EHV A;  3KNE A;  4L5W A;  2NWZ A;  3DCW A;  1HVA A;  1UGA A;  5JEP B;  5JEG B;  3K2F A;  1Z97 A;  3M5T A;  3S77 B;  4QJO A;  5DVX A;  4KUW A;  3TVO X;  1TBT X;  4FPT A;  1BNV A;  1IF5 A;  1BIC A;  2CBE A;  2IT4 A;  3V3F A;  4CA2 A;  1CAI A;  3CYU A;  4YHA A;  4Q8Y A;  4K0S A;  3S78 B;  3MMF A;  5CJF A;  1ZNC A;  3JXG A;  5FLS A;  2WEJ A;  4IDR X;  3MNA A;  6CA2 A;  2Q1Q A;  4HBA A;  3IGP A;  3MYQ A;  4RUY A;  4ZWZ A;  1G4O A;  3P5L A;  2HKK A;  2FW4 A;  1ZSC A;  1I8Z A;  5SZ3 A;  4Y0J A;  2NNS A;  4ITP A;  5FL5 A;  1UGG A;  1UGD A;  1RZB A;  3HKQ A;  3V3G B;  3DD8 A;  4MTY A;  3FE4 A;  4LU3 A;  3OIM A;  4BF1 A;  1I9O A;  3M2Y A;  4QY3 A;  3MHI A;  4Q7V A;  1BN3 A;  4Q81 A;  1DMY A;  1YDA A;  1G46 A;  3MNI A;  1G45 A;  2EZ7 A;  5DSR A;  3MHM A;  1I9N A;  3M1Q A;  1LZV A;  1RAZ A;  1BNQ A;  5CA2 A;  2NWP A;  4E49 A;  4YXI A;  3U7C A;  1ZFK A;  2EU2 A;  2WD2 A;  3IBI A;  4Q07 A;  4YGL A;  3DVD A;  4QJP A;  1CNB A;  3PJJ A;  4E4A A;  4XE1 A;  3ML5 A;  1CIM A;  2W2J A;  4K0T A;  4CNV A;  4Q78 A;  1RZE A;  1FR4 A;  2POW A;  3N4B A;  3W6H A;  4WUQ A;  3RYZ A;  2NNO A;  5SZ4 A;  4YGF A;  4Q09 A;  2POU A;  4FRC A;  1YDC A;  3MNU A;  4E5Q A;  4DZ7 A;  1CCU A;  1IF8 A;  2NN1 A;  5BRV A;  5A25 A;  5EKH A;  5DRS A;  3NJ9 A;  1UGC A;  1CNJ A;  3T82 A;  1BNM A;  1FQR A;  3HFP A;  3BL0 A;  5AML A;  1TG9 A;  3M67 A;  2NXR A;  1A42 A;  1IF9 A;  2QO8 A;  4YVY A;  4YGJ A;  3SBI A;  1Y7W A;  3OIL A;  3M2N A;  1CNI A;  1CAK A;  4QJX A;  4WL4 A;  1ZSA A;  2FMG A;  2HNC A;  1I90 A;  1G52 A;  3S74 B;  1TH9 A;  3M5E A;  4KV0 A;  2FOV A;  4Z1K A;  3MHL A;  2ABE A;  3T5Z A;  7CA2 A;  4QSA A;  4FIK A;  1HUG A;  2GEH A;  3LXE A;  4RUZ A;  4M2W A;  3M96 A;  2O4Z A;  4WW8 A;  1KEQ A;  2HD6 A;  3ZP9 A;  1CAN A;  5L6K A;  4Q49 A;  3R17 B;  5EH5 A;  4Q8Z A;  3MHO A;  1OQ5 A;  1YO0 A;  2FOS A;  3KKX A;  3NB5 A;  2F14 A;  4HEW A;  3RG4 A;  3U45 X;  3MNK A;  4ILX A;  4MDG A;  5DSN A;  3DBU A;  3M3X A;  3V7X A;  1CVD A;  4N0X B;  5DSQ A;  4CAC A;  2QOA A;  4QTL A;  4UOV A;  3M1J A;  3SAX A;  3S9T A;  3N3J A;  3BL1 A; 
#chains in the Genus database with same CATH homology
 1TEQ X;  1BNW A;  1H9N A;  3GZ0 A;  1KWQ A;  3IEO A;  1HCB A;  8CA2 A;  1ZGE A;  1JD0 A;  5DSP A;  4HF3 A;  5EHE A;  3F8E A;  1I9L A;  3VBD A;  3HKN A;  3S76 A;  4HU1 A;  1H9Q A;  4QIY A;  3S73 B;  4BF6 A;  3HKT A;  1BNN A;  3L14 A;  1BN1 A;  1RZC A;  1HUH A;  4L5U A;  1HCA A;  3N0N A;  4FVN A;  3D93 A;  4KNI A;  3C7P A;  1G1D A;  4ZAO A;  4RN4 A;  4E3G A;  5AMG A;  3CZV A;  4HT0 A;  1THK A;  5DSJ A;  4MLT A;  1ZH9 A;  4RFD A;  5E5U A;  4JSS A;  3MNH A;  1T9N A;  5E2K A;  1JCZ A;  2POV A;  4MDL A;  4PZH A;  1XPZ A;  4Q99 A;  1BCD A;  3T84 A;  4ZX0 A;  1AM6 A;  4QK2 A;  4YX4 A;  2X7U A;  3M2X A;  4Q7S A;  1TTM A;  2OSF A;  4KNM A;  2NWY A;  2CBD A;  3OY0 A;  1DMX A;  4Q7W A;  4R5A A;  1CNG A;  4LP6 A;  3M98 A;  4G7A A;  4KNJ A;  3S8X A;  1G3Z A;  3U47 A;  3FFP X;  5FDI A;  4Q87 A;  4COQ A;  1CA2 A;  1RZA A;  4HEY A;  4R5B A;  3S71 B;  1G6V A;  1MUA A;  3OKU A;  1UGF A;  3OYQ A;  4KNN A;  3D8W A;  3IBN A;  5IPZ A;  1H4N A;  3S72 B;  2VVB X;  3DA2 A;  5FL4 A;  5FL6 A;  5SZ0 A;  3RZ8 A;  3V3J A;  4KAP A;  2ZNC A;  4Z1E A;  2EU3 A;  4R59 A;  1XQ0 A;  4G0C A;  2WEG A;  3P55 A;  3Q31 A;  3D92 A;  4Z1N A;  3M14 A;  3V2J A;  1XEG A;  4HT2 A;  3MZC A;  3OKV A;  4GL1 X;  3RYV B;  5BYI A;  4YXU A;  1CAJ A;  1LUG A;  3N2P A;  1V9I C;  4WW6 A;  4YGN A;  5JES B;  1ZSB A;  5JG3 B;  1RJ6 A;  3RLD A;  1HEC A;  1FSN A;  3U3A X;  1FQM A;  3RYY A;  1DCA A;  5A6H A;  4PYY A;  5G01 A;  4Q90 A;  1CNW A;  4KP5 A;  4QIZ A;  1HEA A;  1BNU A;  5E5R A;  5FLR A;  3M40 A;  3RG3 A;  3B1B A;  4X5S A;  4Q83 A;  3KS3 A;  4K13 A;  1XEV A;  2NMX A;  1CCT A;  3EFI A;  3MNJ A;  3T85 A;  1HED A;  5JEH B;  3IBU A;  5CAC A;  3V3I B;  4CNX A;  1RZD A;  2CBC A;  3P58 A;  4PQ7 A;  5G0B A;  3T83 A;  1CNK A;  1LG5 A;  3R16 A;  2CBA A;  3IBL A;  3HS4 A;  2FMZ A;  1KWR A;  1CCS A;  5BRW A;  4LHI A;  5DSI A;  2CBB A;  5EKJ A;  2GD8 A;  1UGB A;  1KOQ A;  4FVO A;  3EFT A;  5DSK A;  4ZWI A;  4QJ0 A;  4FU5 A;  1CZM A;  3BET A;  4WR7 A;  5FNL A;  3K34 A;  5G03 A;  1FQN A;  5EH8 A;  5FDC A;  4RFC A;  3CAJ A;  2NNV A;  3DD0 A;  3F7B A;  1BV3 A;  2NXS A;  4L5V A;  4TWL A;  5E28 A;  5FLO A;  5EKM A;  5EIJ A;  1IF6 A;  5JGS B;  1CAM A;  2WEO A;  4JS6 A;  5EH7 A;  1MOO A;  4KUY A;  2H15 A;  2Q38 A;  4CNR A;  5DOH A;  5E2N A;  3P3J A;  5E2S A;  4DZ9 A;  1TE3 X;  3P5A A;  5HPJ A;  5G0C A;  12CA A;  1G0F A;  4XZ5 A;  3HLJ A;  1OKM A;  1CAH A;  1BNT A;  5JDV B;  3K7K A;  2X7T A;  5C8I A;  3S75 B;  5CLU A;  5JQ0 A;  3S97 A;  3KWA A;  5DSL A;  1CVA A;  1TB0 X;  5FLT A;  1CNC A;  3KON A;  4BCW A;  4PYX A;  1IF7 A;  1BZM A;  5SZ7 A;  3RJ7 A;  4ZWY A;  5FNH A;  2Q1B A;  3RZ7 A;  3DC9 A;  1ZE8 A;  3MDZ A;  4QK3 A;  4C3T A;  5FNK A;  2HFW A;  1FR7 A;  3P3H A;  4JSW A;  2FNM A;  1FSQ A;  1AVN A;  1I9P A;  1TEU X;  3V2M A;  4JSA A;  1FLJ A;  4K0Z A;  4MDM A;  3RYX B;  5BRU A;  3M2Z A;  5SZ5 A;  2ILI A;  1CVH A;  4M2R A;  2NXT A;  4MLX A;  1CAL A;  4QSI A;  5FNG A;  1UGE A;  1URT A;  1OKN A;  2CA2 A;  4M2U A;  1ZFQ A;  5FLQ A;  9CA2 A;  4IWZ A;  1RAY A;  4QJM A;  3RZ1 B;  5LMD A;  3P44 A;  1CIL A;  1I9M A;  5J8Z A;  2OSM A;  2FNN A;  1G53 A;  3RYJ B;  1G4J A;  1BN4 A;  3TVN X;  1YDB A;  4E3D A;  4JSZ A;  5SZ6 A;  4E3H A;  3RGE A;  3M1W A;  4CQ0 A;  4HEZ A;  2NN7 A;  5FNJ A;  1F2W A;  4ZWX A;  5E2R A;  1RJ5 A;  3P4V A;  3D0N A;  3IAI A;  4KUV A;  5FNI A;  3DVC A;  5DSO A;  1EOU A;  3DC3 A;  1YO2 A;  4QK1 A;  4Q6D A;  4QEF A;  3HKU A;  4K1Q A;  4QJW A;  4KP8 A;  3KOI A;  3DAZ A;  3KLD B;  3RZ0 B;  5JGT B;  4YXO A;  1YO1 A;  1CNH A;  1ZGF A;  1CVF A;  5L3O A;  4ZX1 A;  4Q6E A;  5E2M A;  2AW1 A;  2FOY A;  1FQL A;  1AZM A;  4YGK A;  3T5U A;  5AMD A;  3SAP A;  4FL7 A;  4YWP A;  1CRA A;  4E9O X;  1OKL A;  2AX2 A;  2WD3 A;  2H4N A;  2HL4 A;  1CVB A;  3QYK A;  3ZNC A;  5EHW A;  5DSM A;  3M5S A;  2NNG A;  1V9E A;  1CNY A;  3RZ5 A;  1CA3 A;  1KOP A;  1YDD A;  3DCC A;  1LG6 A;  4Q06 A;  2QP6 A;  4Q9Y A;  3D9Z A;  3DV7 A;  2FOQ A;  1TG3 A;  3UYN A;  4YYT A;  1CRM A;  4QSB A;  3M1K A;  1DCB A;  3JXH C;  3KIG A;  4CNW A;  3CA2 A;  3KOK A;  4PXX A;  1Z9Y A;  5SZ2 A;  3PO6 A;  5FNM A;  2FOU A;  1CAY A;  4N16 A;  4Z1J A;  5EZT X;  5BNL A;  4TWM A;  1JV0 A;  4Q7P A;  4Z0Q A;  2FNK A;  3OYS A;  2NWO A;  1CAZ A;  5FLP A;  4M2V A;  1CNX A;  4RH2 A;  1G54 A;  3SBH A;  2WEH A;  1LGD A;  3PYK A;  4RIV A;  4XIW A;  5JQT A;  1IF4 A;  3UYQ A;  1G48 A;  4RIU A;  1CIN A;  1FSR A;  3MWO A;  3MHC A;  2HOC A;  3M04 A;  3ML2 A;  1I91 A;  3JXF A;  1CAO A;  2CAB A;  4E3F A;  4XIX A;  2X7S A;  3W6I A;  4QSJ A;  3NI5 A;  3B4F A;  3F4X A;  1Z93 A;  3DCS A;  3TMJ A;  5JG5 B;  1I9Q A;  4WUP A;  3F7U A;  3DVB A;  4Q08 A;  3V5G A;  3FW3 A;  4ITO A;  1CVE A;  4XFW A;  2VVA X;  1CVC A;  4Q0L A;  5SZ1 A;  4MO8 A;  4ETQ C;  1G0E A;  4Q8X A;  4RUX A;  5DOG A;  3V3H B;  1J9W A;  3OIK A;  5EOI A;  1HEB A;  5EHV A;  3KNE A;  4L5W A;  2NWZ A;  3DCW A;  1HVA A;  1UGA A;  5JEP B;  5JEG B;  3K2F A;  1Z97 A;  3M5T A;  3S77 B;  4QJO A;  5DVX A;  4KUW A;  3TVO X;  1TBT X;  4FPT A;  1BNV A;  1IF5 A;  1BIC A;  2CBE A;  2IT4 A;  3V3F A;  4CA2 A;  1CAI A;  3CYU A;  4YHA A;  4Q8Y A;  4K0S A;  3S78 B;  3MMF A;  5CJF A;  1ZNC A;  3JXG A;  5FLS A;  2WEJ A;  4IDR X;  3MNA A;  6CA2 A;  2Q1Q A;  4HBA A;  3IGP A;  3MYQ A;  4RUY A;  4ZWZ A;  1G4O A;  3P5L A;  2HKK A;  2FW4 A;  1ZSC A;  1I8Z A;  5SZ3 A;  4Y0J A;  2NNS A;  4ITP A;  5FL5 A;  1UGG A;  1UGD A;  1RZB A;  3HKQ A;  3V3G B;  3DD8 A;  4MTY A;  3FE4 A;  4LU3 A;  3OIM A;  4BF1 A;  1I9O A;  3M2Y A;  4QY3 A;  3MHI A;  4Q7V A;  1BN3 A;  4Q81 A;  1DMY A;  1YDA A;  1G46 A;  3MNI A;  1G45 A;  2EZ7 A;  5DSR A;  3MHM A;  1I9N A;  3M1Q A;  1LZV A;  1RAZ A;  1BNQ A;  5CA2 A;  2NWP A;  4E49 A;  4YXI A;  3U7C A;  1ZFK A;  2EU2 A;  2WD2 A;  3IBI A;  4Q07 A;  4YGL A;  3DVD A;  4QJP A;  1CNB A;  3PJJ A;  4E4A A;  4XE1 A;  3ML5 A;  1CIM A;  2W2J A;  4K0T A;  4CNV A;  4Q78 A;  1RZE A;  1FR4 A;  2POW A;  3N4B A;  3W6H A;  4WUQ A;  3RYZ A;  2NNO A;  5SZ4 A;  4YGF A;  4Q09 A;  2POU A;  4FRC A;  1YDC A;  3MNU A;  4E5Q A;  4DZ7 A;  1CCU A;  1IF8 A;  2NN1 A;  5BRV A;  5A25 A;  5EKH A;  5DRS A;  3NJ9 A;  1UGC A;  1CNJ A;  3T82 A;  1BNM A;  1FQR A;  3HFP A;  3BL0 A;  5AML A;  1TG9 A;  3M67 A;  2NXR A;  1A42 A;  1IF9 A;  2QO8 A;  4YVY A;  4YGJ A;  3SBI A;  1Y7W A;  3OIL A;  3M2N A;  1CNI A;  1CAK A;  4QJX A;  4WL4 A;  1ZSA A;  2FMG A;  2HNC A;  1I90 A;  1G52 A;  3S74 B;  1TH9 A;  3M5E A;  4KV0 A;  2FOV A;  4Z1K A;  3MHL A;  2ABE A;  3T5Z A;  7CA2 A;  4QSA A;  4FIK A;  1HUG A;  2GEH A;  3LXE A;  4RUZ A;  4M2W A;  3M96 A;  2O4Z A;  4WW8 A;  1KEQ A;  2HD6 A;  3ZP9 A;  1CAN A;  5L6K A;  4Q49 A;  3R17 B;  5EH5 A;  4Q8Z A;  3MHO A;  1OQ5 A;  1YO0 A;  2FOS A;  3KKX A;  3NB5 A;  2F14 A;  4HEW A;  3RG4 A;  3U45 X;  3MNK A;  4ILX A;  4MDG A;  5DSN A;  3DBU A;  3M3X A;  3V7X A;  1CVD A;  4N0X B;  5DSQ A;  4CAC A;  2QOA A;  4QTL A;  4UOV A;  3M1J A;  3SAX A;  3S9T A;  3N3J A;  3BL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...