8CD1n

70s-phikz014
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
KESMKNRELKRQLTVAKYAKKRAELKAIIANPNSSAEERWNAQVALQKQPRDASASRLRNRCRLTGRPHGFYRKFGLSRNKLREAAMRGDVPGLVKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 70S-PHIKZ014 PHIKZ phage protein occupied ribosome
rcsb
molecule tags Ribosome
source organism Pseudomonas aeruginosa pao1
molecule keywords 50S ribosomal protein L32
total genus 18
structure length 98
sequence length 98
ec nomenclature ec ?:
pdb deposition date 2023-01-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...