8CROL

Cryo-em structure of pyrococcus furiosus transcription elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
94
structure length
94
Chain Sequence
MKIEVIKKEENLLEFYLEGEDHTFANLLVETLRENPHVKFTAYTIEHPITMARKPRFRVVTDGEITPEEALEEAAKKIFERAKEVLEAWEKAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of archaeal RNA polymerase transcription elongation and Spt4/5 recruitment
rcsb
molecule tags Transcription
source organism Pyrococcus furiosus dsm 3638
molecule keywords DNA-directed RNA polymerase subunit Rpo1N
total genus 24
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2023-03-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...