8DFRA

Refined crystal structures of chicken liver dihydrofolate reductase. 3 angstroms apo-enzyme and 1.7 angstroms nadph holo-enzyme complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
186
Chain Sequence
VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSIPEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAVYKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFEVYQKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Crystal Structures of Chicken Liver Dihydrofolate Reductase. 3 Angstroms Apo-Enzyme and 1.7 Angstroms Nadph Holo-Enzyme Complex
rcsb
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase(chnh(d)-nad+ or nadp+(a))
source organism Gallus gallus
total genus 54
structure length 186
sequence length 186
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1989-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 8dfrA00
3JWCA 3NZCX 4PDJA 1HFRA 1M79A 3F8ZA 4GH8A 1DF7A 1KLKA 1DYJA 4XT6A 4DP3A 1LUDA 1QZFA 3OCHA 6DFRA 4DDRA 3TD8A 3TQAA 1DHIA 4KY8A 4PSSA 4H98A 3SRUX 1E26A 1U72A 2FZJA 3EIGA 3K2HA 4M7UA 4LAHX 3NU0A 4IXED 3R33A 2INQA 4OR7A 4PTHA 4EIGA 4ELEA 3L3RA 3JSUA 3TQBA 2W3VA 3FQFA 3FQ0A 3F8YA 3KY8A 1PD8A 4ECKA 1RX6A 2W3AA 1DLSA 1RA3A 3DG8A 4M6KA 4PSYA 3F0UX 3NXOA 1DISA 3UM8A 4XECX 1AO8A 4EIZA 3QGTA 5HSRA 3QLXA 4NX7A 1CZ3A 2HQPA 3IROA 4ELHA 1IA1A 4Q6AA 2W9SA 4RGCA 1U71A 7DFRA 4M6LA 3M09A 8DFRA 5DXVA 4G3MA 3NZBX 3FREX 1M78A 1HFQA 1DRFA 3S9UA 1RH3A 2B3ZA 4M7VA 4XT5A 4HOEA 5HT4A 4LAGX 1DG5A 3UM5A 1HFPA 3JVXA 3K45A 4PSTA 5HVBA 1LY3A 3QLRA 4XRBA 5FDAA 3RO9A 3QLZA 3ROAA 3SA2A 1D1GA 1RD7A 3KJRA 1AOEA 4OSGA 3JWFA 3KGYA 1RX8A 3QG2A 3QLYA 4KEBA 4X5JA 3EEMA 4X5HA 3GI2A 4QHVA 1AI9A 3TQ9A 4Q0EA 4I1NA 2CD2A 4X5GA 3SH2A 4G95A 4P3QA 3I8AX 4P68A 1DR6A 3SRQX 1KMSA 3FRFX 3FQOA 1DAJA 4KNEA 1DDRA 4KFJA 4HOFA 4Q0DA 1BOZA 4PTJA 2W3MA 1DR5A 4KYAA 4LEKX 3NXXA 4KJKA 4KD7A 3DL5A 3EX8A 4QJZD 3IA4A 1DYRA 1DRAA 1PDBA 2D5NA 3S3VA 1DREA 1DG8A 5JA3A 2JYBA 5HI6A 1IA4A 5HUIA 3FQCA 5ECXA 3FY9X 4KJLA 1VDRA 1YHOA 1RX2A 3NXYA 3SGYA 3I3RA 1RA8A 1RX1A 1KMVA 2BL9A 2LF1A 3UM6A 1DHJA 2BLAA 2AZNA 2G6VA 3DGAA 4NX6A 2CIGA 1DRBA 2OBCA 5JG0X 1PD9A 3EEKA 1DDSA 3QLSA 4Q67A 3GHVA 3KFYA 3S7AA 1DIUA 2DHFA 3F0SX 3QYLA 2HM9A 3IA5A 1DG7A 5CC9A 3CL9A 4ELGA 1RB2A 3QYOA 3FQVA 3IRMA 2C2TA 1DR1A 4X5IA 3D84X 4QJCA 4QLEA 2W9TA 2H2QA 2QK8A 1LY4A 3SRRX 3DAUA 4LAEX 5U27A 4DPDA 4P3RA 4XT4A 4EJ1A 2L28A 4HA9A 3D80A 1RC4A 1VJ3A 4XE6X 1CD2A 4KM2A 3JWMA 4KL9A 3JTWA 3SQYX 4G8ZX 1DRHA 3NXVA 4DFRA 4ELFA 5HF2X 4DPHA 3FS6A 3GHCA 3JW3A 1RX4A 3FRAX 2C2SA 1J3JA 4FHBA 3TQ8A 3FL9A 4QI9A 3F0XX 5HQYA 2DRCA 3F0VX 4H96A 3NRRA 3FQZA 5HQZA 3OAFA 3F0BX 3SRSX 1S3YA 3DFRA 1RF7A 1RX7A 1U70A 3RG9A 3NTZA 3F0QX 3DRCA 4M6JA 3LG4A 4I13A 5E8QA 1IA3A 4H95A 2OIPA 3FYWX 1RA9A 3EELA 3FL8A 3KJSA 4KLXA 3N0HA 4M2XA 5EAJA 3NZAX 1RE7A 4QLFA 1J3KA 2ANOA 1RX3A 4KAKA 1JOLA 1DHFA 1MVSA 1SEJA 2W9HA 1OHJA 3F91A 4EILA 3SRWX 3FRBX 4FGGA 1RB3A 1MVTA 3HJ3A 1DR7A 1IA2A 3ZPGA 4HA7A 1JUVA 3QL0A 1DR3A 3QLWA 1ZDRA 4CD2A 1DR2A 3JWKA 4KY4A 3K74A 3INVA 1RX5A 1BZFA 4H97A 2KGKA 3SR5X 3NZ9X 5CCCA 1JOMA 3QFXA 4KM0A 3SAIA 3GYFA 3NXRA 4P66A 3HBBA 3NZDA 4TU5X 2HXVA 3CD2A 3NXTA 3E0BA 4IXGX 2XW7A 5HF0X 2P4GA 3CLBA 3DL6A 3NZ6X 3JW5A 3CSEA 2BLCA 3FYVX 2BLBA 1DR4A 3IX9A 3GHWA 4QLGA 3FRDX 4X5FA 3QL3A 2W9GA 1DYIA 2D0KA 4KJJA 1TDRA 3M08A 1J3IA 5HT5A 3IRNA 4XT8A 2FZIA 4KBNA 2O7PA 1M7AA 3K47A 4HOGA 5HPBA 2GD9A 5ECCA 2W3WA 1S3UA 3VCOA 3DATA 2W3BA 3EEJA 1RG7A 3SA1A 1RA1A 2ITHA 4ELBA 2ZZAA 1DYHA 3FY8X 4IXFX 3ZPCA 2FZHA 1RX9A 1S3WA 5HSUA 1OHKA 1RA2A 3Q1HA 5DFRA 4XT7A 2ANQA 1S3VA 5HVEA 4FGHA 1DLRA 5U26A
chains in the Genus database with same CATH superfamily
3JWCA 3NZCX 4PDJA 1HFRA 1M79A 3F8ZA 4GH8A 1DF7A 1KLKA 1DYJA 4XT6A 4DP3A 1LUDA 1QZFA 3OCHA 6DFRA 4DDRA 3TD8A 3TQAA 1DHIA 4KY8A 4PSSA 4H98A 3SRUX 1E26A 1U72A 2FZJA 3EIGA 3K2HA 4M7UA 4LAHX 3NU0A 4IXED 3R33A 2INQA 4OR7A 4PTHA 4EIGA 4ELEA 3L3RA 3JSUA 3TQBA 2W3VA 3FQFA 3FQ0A 3F8YA 3KY8A 1PD8A 4ECKA 1RX6A 2W3AA 1DLSA 1RA3A 3DG8A 4M6KA 4PSYA 3F0UX 3NXOA 1DISA 3UM8A 4XECX 1AO8A 4EIZA 3QGTA 5HSRA 3QLXA 4NX7A 1CZ3A 2HQPA 3IROA 4ELHA 1IA1A 4Q6AA 2W9SA 4RGCA 1U71A 7DFRA 4M6LA 3M09A 8DFRA 5DXVA 4G3MA 3NZBX 3FREX 1M78A 1HFQA 1DRFA 3S9UA 1RH3A 2B3ZA 4M7VA 4XT5A 4HOEA 5HT4A 4LAGX 1DG5A 3UM5A 1HFPA 3JVXA 3K45A 4PSTA 5HVBA 1LY3A 3QLRA 4XRBA 5FDAA 3RO9A 3QLZA 3ROAA 3SA2A 1D1GA 1RD7A 3KJRA 1AOEA 4OSGA 3JWFA 3KGYA 1RX8A 3QG2A 3QLYA 4KEBA 4X5JA 3EEMA 4X5HA 3GI2A 4QHVA 1AI9A 3TQ9A 4Q0EA 4I1NA 2CD2A 4X5GA 3SH2A 4G95A 4P3QA 3I8AX 4P68A 1DR6A 3SRQX 1KMSA 3FRFX 3FQOA 1DAJA 4KNEA 1DDRA 4KFJA 4HOFA 4Q0DA 1BOZA 4PTJA 2W3MA 1DR5A 4KYAA 4LEKX 3NXXA 4KJKA 4KD7A 3DL5A 3EX8A 4QJZD 3IA4A 1DYRA 1DRAA 1PDBA 2D5NA 3S3VA 1DREA 1DG8A 5JA3A 2JYBA 5HI6A 1IA4A 5HUIA 3FQCA 5ECXA 3FY9X 4KJLA 1VDRA 1YHOA 1RX2A 3NXYA 3SGYA 3I3RA 1RA8A 1RX1A 1KMVA 2BL9A 2LF1A 3UM6A 1DHJA 2BLAA 2AZNA 2G6VA 3DGAA 4NX6A 2CIGA 1DRBA 2OBCA 5JG0X 1PD9A 3EEKA 1DDSA 3QLSA 4Q67A 3GHVA 3KFYA 3S7AA 1DIUA 2DHFA 3F0SX 3QYLA 2HM9A 3IA5A 1DG7A 5CC9A 3CL9A 4ELGA 1RB2A 3QYOA 3FQVA 3IRMA 2C2TA 1DR1A 4X5IA 3D84X 4QJCA 4QLEA 2W9TA 2H2QA 2QK8A 1LY4A 3SRRX 3DAUA 4LAEX 5U27A 4DPDA 4P3RA 4XT4A 4EJ1A 2L28A 4HA9A 3D80A 1RC4A 1VJ3A 4XE6X 1CD2A 4KM2A 3JWMA 4KL9A 3JTWA 3SQYX 4G8ZX 1DRHA 3NXVA 4DFRA 4ELFA 5HF2X 4DPHA 3FS6A 3GHCA 3JW3A 1RX4A 3FRAX 2C2SA 1J3JA 4FHBA 3TQ8A 3FL9A 4QI9A 3F0XX 5HQYA 2DRCA 3F0VX 4H96A 3NRRA 3FQZA 5HQZA 3OAFA 3F0BX 3SRSX 1S3YA 3DFRA 1RF7A 1RX7A 1U70A 3RG9A 3NTZA 3F0QX 3DRCA 4M6JA 3LG4A 4I13A 5E8QA 1IA3A 4H95A 2OIPA 3FYWX 1RA9A 3EELA 3FL8A 3KJSA 4KLXA 3N0HA 4M2XA 5EAJA 3NZAX 1RE7A 4QLFA 1J3KA 2ANOA 1RX3A 4KAKA 1JOLA 1DHFA 1MVSA 1SEJA 2W9HA 1OHJA 3F91A 4EILA 3SRWX 3FRBX 4FGGA 1RB3A 1MVTA 3HJ3A 1DR7A 1IA2A 3ZPGA 4HA7A 1JUVA 3QL0A 1DR3A 3QLWA 1ZDRA 4CD2A 1DR2A 3JWKA 4KY4A 3K74A 3INVA 1RX5A 1BZFA 4H97A 2KGKA 3SR5X 3NZ9X 5CCCA 1JOMA 3QFXA 4KM0A 3SAIA 3GYFA 3NXRA 4P66A 3HBBA 3NZDA 4TU5X 2HXVA 3CD2A 3NXTA 3E0BA 4IXGX 2XW7A 5HF0X 2P4GA 3CLBA 3DL6A 3NZ6X 3JW5A 3CSEA 2BLCA 3FYVX 2BLBA 1DR4A 3IX9A 3GHWA 4QLGA 3FRDX 4X5FA 3QL3A 2W9GA 1DYIA 2D0KA 4KJJA 1TDRA 3M08A 1J3IA 5HT5A 3IRNA 4XT8A 2FZIA 4KBNA 2O7PA 1M7AA 3K47A 4HOGA 5HPBA 2GD9A 5ECCA 2W3WA 1S3UA 3VCOA 3DATA 2W3BA 3EEJA 1RG7A 3SA1A 1RA1A 2ITHA 4ELBA 2ZZAA 1DYHA 3FY8X 4IXFX 3ZPCA 2FZHA 1RX9A 1S3WA 5HSUA 1OHKA 1RA2A 3Q1HA 5DFRA 4XT7A 2ANQA 1S3VA 5HVEA 4FGHA 1DLRA 5U26A
chains in the Genus database with same CATH topology
3JWCA 3NZCX 4PDJA 1HFRA 1M79A 3F8ZA 4GH8A 1DF7A 1KLKA 1DYJA 4XT6A 4DP3A 1LUDA 1QZFA 3OCHA 6DFRA 4DDRA 3TD8A 3TQAA 1DHIA 4KY8A 4PSSA 4H98A 3SRUX 1E26A 1U72A 2FZJA 3EIGA 3K2HA 4M7UA 4LAHX 3NU0A 4IXED 3R33A 2INQA 4OR7A 4PTHA 4EIGA 4ELEA 3L3RA 3JSUA 3TQBA 2W3VA 3FQFA 3FQ0A 3F8YA 3KY8A 1PD8A 4ECKA 1RX6A 2W3AA 1DLSA 1RA3A 3DG8A 4M6KA 4PSYA 3F0UX 3NXOA 1DISA 3UM8A 4XECX 1AO8A 4EIZA 3QGTA 5HSRA 3QLXA 4NX7A 1CZ3A 2HQPA 3IROA 4ELHA 1IA1A 4Q6AA 2W9SA 4RGCA 1U71A 7DFRA 4M6LA 3M09A 8DFRA 5DXVA 4G3MA 3NZBX 3FREX 1M78A 1HFQA 1DRFA 3S9UA 1RH3A 2B3ZA 4M7VA 4XT5A 4HOEA 5HT4A 4LAGX 1DG5A 3UM5A 1HFPA 3JVXA 3K45A 4PSTA 5HVBA 1LY3A 3QLRA 4XRBA 5FDAA 3RO9A 3QLZA 3ROAA 3SA2A 1D1GA 1RD7A 3KJRA 1AOEA 4OSGA 3JWFA 3KGYA 1RX8A 3QG2A 3QLYA 4KEBA 4X5JA 3EEMA 4X5HA 3GI2A 4QHVA 1AI9A 3TQ9A 4Q0EA 4I1NA 2CD2A 4X5GA 3SH2A 4G95A 4P3QA 3I8AX 4P68A 1DR6A 3SRQX 1KMSA 3FRFX 3FQOA 1DAJA 4KNEA 1DDRA 4KFJA 4HOFA 4Q0DA 1BOZA 4PTJA 2W3MA 1DR5A 4KYAA 4LEKX 3NXXA 4KJKA 4KD7A 3DL5A 3EX8A 4QJZD 3IA4A 1DYRA 1DRAA 1PDBA 2D5NA 3S3VA 1DREA 1DG8A 5JA3A 2JYBA 5HI6A 1IA4A 5HUIA 3FQCA 5ECXA 3FY9X 4KJLA 1VDRA 1YHOA 1RX2A 3NXYA 3SGYA 3I3RA 1RA8A 1RX1A 1KMVA 2BL9A 2LF1A 3UM6A 1DHJA 2BLAA 2AZNA 2G6VA 3DGAA 4NX6A 2CIGA 1DRBA 2OBCA 5JG0X 1PD9A 3EEKA 1DDSA 3QLSA 4Q67A 3GHVA 3KFYA 3S7AA 1DIUA 2DHFA 3F0SX 3QYLA 2HM9A 3IA5A 1DG7A 5CC9A 3CL9A 4ELGA 1RB2A 3QYOA 3FQVA 3IRMA 2C2TA 1DR1A 4X5IA 3D84X 4QJCA 4QLEA 2W9TA 2H2QA 2QK8A 1LY4A 3SRRX 3DAUA 4LAEX 5U27A 4DPDA 4P3RA 4XT4A 4EJ1A 2L28A 4HA9A 3D80A 1RC4A 1VJ3A 4XE6X 1CD2A 4KM2A 3JWMA 4KL9A 3JTWA 3SQYX 4G8ZX 1DRHA 3NXVA 4DFRA 4ELFA 5HF2X 4DPHA 3FS6A 3GHCA 3JW3A 1RX4A 3FRAX 2C2SA 1J3JA 4FHBA 3TQ8A 3FL9A 4QI9A 3F0XX 5HQYA 2DRCA 3F0VX 4H96A 3NRRA 3FQZA 5HQZA 3OAFA 3F0BX 3SRSX 1S3YA 3DFRA 1RF7A 1RX7A 1U70A 3RG9A 3NTZA 3F0QX 3DRCA 4M6JA 3LG4A 4I13A 5E8QA 1IA3A 4H95A 2OIPA 3FYWX 1RA9A 3EELA 3FL8A 3KJSA 4KLXA 3N0HA 4M2XA 5EAJA 3NZAX 1RE7A 4QLFA 1J3KA 2ANOA 1RX3A 4KAKA 1JOLA 1DHFA 1MVSA 1SEJA 2W9HA 1OHJA 3F91A 4EILA 3SRWX 3FRBX 4FGGA 1RB3A 1MVTA 3HJ3A 1DR7A 1IA2A 3ZPGA 4HA7A 1JUVA 3QL0A 1DR3A 3QLWA 1ZDRA 4CD2A 1DR2A 3JWKA 4KY4A 3K74A 3INVA 1RX5A 1BZFA 4H97A 2KGKA 3SR5X 3NZ9X 5CCCA 1JOMA 3QFXA 4KM0A 3SAIA 3GYFA 3NXRA 4P66A 3HBBA 3NZDA 4TU5X 2HXVA 3CD2A 3NXTA 3E0BA 4IXGX 2XW7A 5HF0X 2P4GA 3CLBA 3DL6A 3NZ6X 3JW5A 3CSEA 2BLCA 3FYVX 2BLBA 1DR4A 3IX9A 3GHWA 4QLGA 3FRDX 4X5FA 3QL3A 2W9GA 1DYIA 2D0KA 4KJJA 1TDRA 3M08A 1J3IA 5HT5A 3IRNA 4XT8A 2FZIA 4KBNA 2O7PA 1M7AA 3K47A 4HOGA 5HPBA 2GD9A 5ECCA 2W3WA 1S3UA 3VCOA 3DATA 2W3BA 3EEJA 1RG7A 3SA1A 1RA1A 2ITHA 4ELBA 2ZZAA 1DYHA 3FY8X 4IXFX 3ZPCA 2FZHA 1RX9A 1S3WA 5HSUA 1OHKA 1RA2A 3Q1HA 5DFRA 4XT7A 2ANQA 1S3VA 5HVEA 4FGHA 1DLRA 5U26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JWC A;  3NZC X;  4PDJ A;  1HFR A;  1M79 A;  3F8Z A;  4GH8 A;  1DF7 A;  1KLK A;  1DYJ A;  4XT6 A;  4DP3 A;  1LUD A;  1QZF A;  3OCH A;  6DFR A;  4DDR A;  3TD8 A;  3TQA A;  1DHI A;  4KY8 A;  4PSS A;  4H98 A;  3SRU X;  1E26 A;  1U72 A;  2FZJ A;  3EIG A;  3K2H A;  4M7U A;  4LAH X;  3NU0 A;  4IXE D;  3R33 A;  2INQ A;  4OR7 A;  4PTH A;  4EIG A;  4ELE A;  3L3R A;  3JSU A;  3TQB A;  2W3V A;  3FQF A;  3FQ0 A;  3F8Y A;  3KY8 A;  1PD8 A;  4ECK A;  1RX6 A;  2W3A A;  1DLS A;  1RA3 A;  3DG8 A;  4M6K A;  4PSY A;  3F0U X;  3NXO A;  1DIS A;  3UM8 A;  4XEC X;  1AO8 A;  4EIZ A;  3QGT A;  5HSR A;  3QLX A;  4NX7 A;  1CZ3 A;  2HQP A;  3IRO A;  4ELH A;  1IA1 A;  4Q6A A;  2W9S A;  4RGC A;  1U71 A;  7DFR A;  4M6L A;  3M09 A;  8DFR A;  5DXV A;  4G3M A;  3NZB X;  3FRE X;  1M78 A;  1HFQ A;  1DRF A;  3S9U A;  1RH3 A;  2B3Z A;  4M7V A;  4XT5 A;  4HOE A;  5HT4 A;  4LAG X;  1DG5 A;  3UM5 A;  1HFP A;  3JVX A;  3K45 A;  4PST A;  5HVB A;  1LY3 A;  3QLR A;  4XRB A;  5FDA A;  3RO9 A;  3QLZ A;  3ROA A;  3SA2 A;  1D1G A;  1RD7 A;  3KJR A;  1AOE A;  4OSG A;  3JWF A;  3KGY A;  1RX8 A;  3QG2 A;  3QLY A;  4KEB A;  4X5J A;  3EEM A;  4X5H A;  3GI2 A;  4QHV A;  1AI9 A;  3TQ9 A;  4Q0E A;  4I1N A;  2CD2 A;  4X5G A;  3SH2 A;  4G95 A;  4P3Q A;  3I8A X;  4P68 A;  1DR6 A;  3SRQ X;  1KMS A;  3FRF X;  3FQO A;  1DAJ A;  4KNE A;  1DDR A;  4KFJ A;  4HOF A;  4Q0D A;  1BOZ A;  4PTJ A;  2W3M A;  1DR5 A;  4KYA A;  4LEK X;  3NXX A;  4KJK A;  4KD7 A;  3DL5 A;  3EX8 A;  4QJZ D;  3IA4 A;  1DYR A;  1DRA A;  1PDB A;  2D5N A;  3S3V A;  1DRE A;  1DG8 A;  5JA3 A;  2JYB A;  5HI6 A;  1IA4 A;  5HUI A;  3FQC A;  5ECX A;  3FY9 X;  4KJL A;  1VDR A;  1YHO A;  1RX2 A;  3NXY A;  3SGY A;  3I3R A;  1RA8 A;  1RX1 A;  1KMV A;  2BL9 A;  2LF1 A;  3UM6 A;  1DHJ A;  2BLA A;  2AZN A;  2G6V A;  3DGA A;  4NX6 A;  2CIG A;  1DRB A;  2OBC A;  5JG0 X;  1PD9 A;  3EEK A;  1DDS A;  3QLS A;  4Q67 A;  3GHV A;  3KFY A;  3S7A A;  1DIU A;  2DHF A;  3F0S X;  3QYL A;  2HM9 A;  3IA5 A;  1DG7 A;  5CC9 A;  3CL9 A;  4ELG A;  1RB2 A;  3QYO A;  3FQV A;  3IRM A;  2C2T A;  1DR1 A;  4X5I A;  3D84 X;  4QJC A;  4QLE A;  2W9T A;  2H2Q A;  2QK8 A;  1LY4 A;  3SRR X;  3DAU A;  4LAE X;  5U27 A;  4DPD A;  4P3R A;  4XT4 A;  4EJ1 A;  2L28 A;  4HA9 A;  3D80 A;  1RC4 A;  1VJ3 A;  4XE6 X;  1CD2 A;  4KM2 A;  3JWM A;  4KL9 A;  3JTW A;  3SQY X;  4G8Z X;  1DRH A;  3NXV A;  4DFR A;  4ELF A;  5HF2 X;  4DPH A;  3FS6 A;  3GHC A;  3JW3 A;  1RX4 A;  3FRA X;  2C2S A;  1J3J A;  4FHB A;  3TQ8 A;  3FL9 A;  4QI9 A;  3F0X X;  5HQY A;  2DRC A;  3F0V X;  4H96 A;  3NRR A;  3FQZ A;  5HQZ A;  3OAF A;  3F0B X;  3SRS X;  1S3Y A;  3DFR A;  1RF7 A;  1RX7 A;  1U70 A;  3RG9 A;  3NTZ A;  3F0Q X;  3DRC A;  4M6J A;  3LG4 A;  4I13 A;  5E8Q A;  1IA3 A;  4H95 A;  2OIP A;  3FYW X;  1RA9 A;  3EEL A;  3FL8 A;  3KJS A;  4KLX A;  3N0H A;  4M2X A;  5EAJ A;  3NZA X;  1RE7 A;  4QLF A;  1J3K A;  2ANO A;  1RX3 A;  4KAK A;  1JOL A;  1DHF A;  1MVS A;  1SEJ A;  2W9H A;  1OHJ A;  3F91 A;  4EIL A;  3SRW X;  3FRB X;  4FGG A;  1RB3 A;  1MVT A;  3HJ3 A;  1DR7 A;  1IA2 A;  3ZPG A;  4HA7 A;  1JUV A;  3QL0 A;  1DR3 A;  3QLW A;  1ZDR A;  4CD2 A;  1DR2 A;  3JWK A;  4KY4 A;  3K74 A;  3INV A;  1RX5 A;  1BZF A;  4H97 A;  2KGK A;  3SR5 X;  3NZ9 X;  5CCC A;  1JOM A;  3QFX A;  4KM0 A;  3SAI A;  3GYF A;  3NXR A;  4P66 A;  3HBB A;  3NZD A;  4TU5 X;  2HXV A;  3CD2 A;  3NXT A;  3E0B A;  4IXG X;  2XW7 A;  5HF0 X;  2P4G A;  3CLB A;  3DL6 A;  3NZ6 X;  3JW5 A;  3CSE A;  2BLC A;  3FYV X;  2BLB A;  1DR4 A;  3IX9 A;  3GHW A;  4QLG A;  3FRD X;  4X5F A;  3QL3 A;  2W9G A;  1DYI A;  2D0K A;  4KJJ A;  1TDR A;  3M08 A;  1J3I A;  5HT5 A;  3IRN A;  4XT8 A;  2FZI A;  4KBN A;  2O7P A;  1M7A A;  3K47 A;  4HOG A;  5HPB A;  2GD9 A;  5ECC A;  2W3W A;  1S3U A;  3VCO A;  3DAT A;  2W3B A;  3EEJ A;  1RG7 A;  3SA1 A;  1RA1 A;  2ITH A;  4ELB A;  2ZZA A;  1DYH A;  3FY8 X;  4IXF X;  3ZPC A;  2FZH A;  1RX9 A;  1S3W A;  5HSU A;  1OHK A;  1RA2 A;  3Q1H A;  5DFR A;  4XT7 A;  2ANQ A;  1S3V A;  5HVE A;  4FGH A;  1DLR A;  5U26 A; 
#chains in the Genus database with same CATH topology
 3JWC A;  3NZC X;  4PDJ A;  1HFR A;  1M79 A;  3F8Z A;  4GH8 A;  1DF7 A;  1KLK A;  1DYJ A;  4XT6 A;  4DP3 A;  1LUD A;  1QZF A;  3OCH A;  6DFR A;  4DDR A;  3TD8 A;  3TQA A;  1DHI A;  4KY8 A;  4PSS A;  4H98 A;  3SRU X;  1E26 A;  1U72 A;  2FZJ A;  3EIG A;  3K2H A;  4M7U A;  4LAH X;  3NU0 A;  4IXE D;  3R33 A;  2INQ A;  4OR7 A;  4PTH A;  4EIG A;  4ELE A;  3L3R A;  3JSU A;  3TQB A;  2W3V A;  3FQF A;  3FQ0 A;  3F8Y A;  3KY8 A;  1PD8 A;  4ECK A;  1RX6 A;  2W3A A;  1DLS A;  1RA3 A;  3DG8 A;  4M6K A;  4PSY A;  3F0U X;  3NXO A;  1DIS A;  3UM8 A;  4XEC X;  1AO8 A;  4EIZ A;  3QGT A;  5HSR A;  3QLX A;  4NX7 A;  1CZ3 A;  2HQP A;  3IRO A;  4ELH A;  1IA1 A;  4Q6A A;  2W9S A;  4RGC A;  1U71 A;  7DFR A;  4M6L A;  3M09 A;  8DFR A;  5DXV A;  4G3M A;  3NZB X;  3FRE X;  1M78 A;  1HFQ A;  1DRF A;  3S9U A;  1RH3 A;  2B3Z A;  4M7V A;  4XT5 A;  4HOE A;  5HT4 A;  4LAG X;  1DG5 A;  3UM5 A;  1HFP A;  3JVX A;  3K45 A;  4PST A;  5HVB A;  1LY3 A;  3QLR A;  4XRB A;  5FDA A;  3RO9 A;  3QLZ A;  3ROA A;  3SA2 A;  1D1G A;  1RD7 A;  3KJR A;  1AOE A;  4OSG A;  3JWF A;  3KGY A;  1RX8 A;  3QG2 A;  3QLY A;  4KEB A;  4X5J A;  3EEM A;  4X5H A;  3GI2 A;  4QHV A;  1AI9 A;  3TQ9 A;  4Q0E A;  4I1N A;  2CD2 A;  4X5G A;  3SH2 A;  4G95 A;  4P3Q A;  3I8A X;  4P68 A;  1DR6 A;  3SRQ X;  1KMS A;  3FRF X;  3FQO A;  1DAJ A;  4KNE A;  1DDR A;  4KFJ A;  4HOF A;  4Q0D A;  1BOZ A;  4PTJ A;  2W3M A;  1DR5 A;  4KYA A;  4LEK X;  3NXX A;  4KJK A;  4KD7 A;  3DL5 A;  3EX8 A;  4QJZ D;  3IA4 A;  1DYR A;  1DRA A;  1PDB A;  2D5N A;  3S3V A;  1DRE A;  1DG8 A;  5JA3 A;  2JYB A;  5HI6 A;  1IA4 A;  5HUI A;  3FQC A;  5ECX A;  3FY9 X;  4KJL A;  1VDR A;  1YHO A;  1RX2 A;  3NXY A;  3SGY A;  3I3R A;  1RA8 A;  1RX1 A;  1KMV A;  2BL9 A;  2LF1 A;  3UM6 A;  1DHJ A;  2BLA A;  2AZN A;  2G6V A;  3DGA A;  4NX6 A;  2CIG A;  1DRB A;  2OBC A;  5JG0 X;  1PD9 A;  3EEK A;  1DDS A;  3QLS A;  4Q67 A;  3GHV A;  3KFY A;  3S7A A;  1DIU A;  2DHF A;  3F0S X;  3QYL A;  2HM9 A;  3IA5 A;  1DG7 A;  5CC9 A;  3CL9 A;  4ELG A;  1RB2 A;  3QYO A;  3FQV A;  3IRM A;  2C2T A;  1DR1 A;  4X5I A;  3D84 X;  4QJC A;  4QLE A;  2W9T A;  2H2Q A;  2QK8 A;  1LY4 A;  3SRR X;  3DAU A;  4LAE X;  5U27 A;  4DPD A;  4P3R A;  4XT4 A;  4EJ1 A;  2L28 A;  4HA9 A;  3D80 A;  1RC4 A;  1VJ3 A;  4XE6 X;  1CD2 A;  4KM2 A;  3JWM A;  4KL9 A;  3JTW A;  3SQY X;  4G8Z X;  1DRH A;  3NXV A;  4DFR A;  4ELF A;  5HF2 X;  4DPH A;  3FS6 A;  3GHC A;  3JW3 A;  1RX4 A;  3FRA X;  2C2S A;  1J3J A;  4FHB A;  3TQ8 A;  3FL9 A;  4QI9 A;  3F0X X;  5HQY A;  2DRC A;  3F0V X;  4H96 A;  3NRR A;  3FQZ A;  5HQZ A;  3OAF A;  3F0B X;  3SRS X;  1S3Y A;  3DFR A;  1RF7 A;  1RX7 A;  1U70 A;  3RG9 A;  3NTZ A;  3F0Q X;  3DRC A;  4M6J A;  3LG4 A;  4I13 A;  5E8Q A;  1IA3 A;  4H95 A;  2OIP A;  3FYW X;  1RA9 A;  3EEL A;  3FL8 A;  3KJS A;  4KLX A;  3N0H A;  4M2X A;  5EAJ A;  3NZA X;  1RE7 A;  4QLF A;  1J3K A;  2ANO A;  1RX3 A;  4KAK A;  1JOL A;  1DHF A;  1MVS A;  1SEJ A;  2W9H A;  1OHJ A;  3F91 A;  4EIL A;  3SRW X;  3FRB X;  4FGG A;  1RB3 A;  1MVT A;  3HJ3 A;  1DR7 A;  1IA2 A;  3ZPG A;  4HA7 A;  1JUV A;  3QL0 A;  1DR3 A;  3QLW A;  1ZDR A;  4CD2 A;  1DR2 A;  3JWK A;  4KY4 A;  3K74 A;  3INV A;  1RX5 A;  1BZF A;  4H97 A;  2KGK A;  3SR5 X;  3NZ9 X;  5CCC A;  1JOM A;  3QFX A;  4KM0 A;  3SAI A;  3GYF A;  3NXR A;  4P66 A;  3HBB A;  3NZD A;  4TU5 X;  2HXV A;  3CD2 A;  3NXT A;  3E0B A;  4IXG X;  2XW7 A;  5HF0 X;  2P4G A;  3CLB A;  3DL6 A;  3NZ6 X;  3JW5 A;  3CSE A;  2BLC A;  3FYV X;  2BLB A;  1DR4 A;  3IX9 A;  3GHW A;  4QLG A;  3FRD X;  4X5F A;  3QL3 A;  2W9G A;  1DYI A;  2D0K A;  4KJJ A;  1TDR A;  3M08 A;  1J3I A;  5HT5 A;  3IRN A;  4XT8 A;  2FZI A;  4KBN A;  2O7P A;  1M7A A;  3K47 A;  4HOG A;  5HPB A;  2GD9 A;  5ECC A;  2W3W A;  1S3U A;  3VCO A;  3DAT A;  2W3B A;  3EEJ A;  1RG7 A;  3SA1 A;  1RA1 A;  2ITH A;  4ELB A;  2ZZA A;  1DYH A;  3FY8 X;  4IXF X;  3ZPC A;  2FZH A;  1RX9 A;  1S3W A;  5HSU A;  1OHK A;  1RA2 A;  3Q1H A;  5DFR A;  4XT7 A;  2ANQ A;  1S3V A;  5HVE A;  4FGH A;  1DLR A;  5U26 A; 
#chains in the Genus database with same CATH homology
 3JWC A;  3NZC X;  4PDJ A;  1HFR A;  1M79 A;  3F8Z A;  4GH8 A;  1DF7 A;  1KLK A;  1DYJ A;  4XT6 A;  4DP3 A;  1LUD A;  1QZF A;  3OCH A;  6DFR A;  4DDR A;  3TD8 A;  3TQA A;  1DHI A;  4KY8 A;  4PSS A;  4H98 A;  3SRU X;  1E26 A;  1U72 A;  2FZJ A;  3EIG A;  3K2H A;  4M7U A;  4LAH X;  3NU0 A;  4IXE D;  3R33 A;  2INQ A;  4OR7 A;  4PTH A;  4EIG A;  4ELE A;  3L3R A;  3JSU A;  3TQB A;  2W3V A;  3FQF A;  3FQ0 A;  3F8Y A;  3KY8 A;  1PD8 A;  4ECK A;  1RX6 A;  2W3A A;  1DLS A;  1RA3 A;  3DG8 A;  4M6K A;  4PSY A;  3F0U X;  3NXO A;  1DIS A;  3UM8 A;  4XEC X;  1AO8 A;  4EIZ A;  3QGT A;  5HSR A;  3QLX A;  4NX7 A;  1CZ3 A;  2HQP A;  3IRO A;  4ELH A;  1IA1 A;  4Q6A A;  2W9S A;  4RGC A;  1U71 A;  7DFR A;  4M6L A;  3M09 A;  8DFR A;  5DXV A;  4G3M A;  3NZB X;  3FRE X;  1M78 A;  1HFQ A;  1DRF A;  3S9U A;  1RH3 A;  2B3Z A;  4M7V A;  4XT5 A;  4HOE A;  5HT4 A;  4LAG X;  1DG5 A;  3UM5 A;  1HFP A;  3JVX A;  3K45 A;  4PST A;  5HVB A;  1LY3 A;  3QLR A;  4XRB A;  5FDA A;  3RO9 A;  3QLZ A;  3ROA A;  3SA2 A;  1D1G A;  1RD7 A;  3KJR A;  1AOE A;  4OSG A;  3JWF A;  3KGY A;  1RX8 A;  3QG2 A;  3QLY A;  4KEB A;  4X5J A;  3EEM A;  4X5H A;  3GI2 A;  4QHV A;  1AI9 A;  3TQ9 A;  4Q0E A;  4I1N A;  2CD2 A;  4X5G A;  3SH2 A;  4G95 A;  4P3Q A;  3I8A X;  4P68 A;  1DR6 A;  3SRQ X;  1KMS A;  3FRF X;  3FQO A;  1DAJ A;  4KNE A;  1DDR A;  4KFJ A;  4HOF A;  4Q0D A;  1BOZ A;  4PTJ A;  2W3M A;  1DR5 A;  4KYA A;  4LEK X;  3NXX A;  4KJK A;  4KD7 A;  3DL5 A;  3EX8 A;  4QJZ D;  3IA4 A;  1DYR A;  1DRA A;  1PDB A;  2D5N A;  3S3V A;  1DRE A;  1DG8 A;  5JA3 A;  2JYB A;  5HI6 A;  1IA4 A;  5HUI A;  3FQC A;  5ECX A;  3FY9 X;  4KJL A;  1VDR A;  1YHO A;  1RX2 A;  3NXY A;  3SGY A;  3I3R A;  1RA8 A;  1RX1 A;  1KMV A;  2BL9 A;  2LF1 A;  3UM6 A;  1DHJ A;  2BLA A;  2AZN A;  2G6V A;  3DGA A;  4NX6 A;  2CIG A;  1DRB A;  2OBC A;  5JG0 X;  1PD9 A;  3EEK A;  1DDS A;  3QLS A;  4Q67 A;  3GHV A;  3KFY A;  3S7A A;  1DIU A;  2DHF A;  3F0S X;  3QYL A;  2HM9 A;  3IA5 A;  1DG7 A;  5CC9 A;  3CL9 A;  4ELG A;  1RB2 A;  3QYO A;  3FQV A;  3IRM A;  2C2T A;  1DR1 A;  4X5I A;  3D84 X;  4QJC A;  4QLE A;  2W9T A;  2H2Q A;  2QK8 A;  1LY4 A;  3SRR X;  3DAU A;  4LAE X;  5U27 A;  4DPD A;  4P3R A;  4XT4 A;  4EJ1 A;  2L28 A;  4HA9 A;  3D80 A;  1RC4 A;  1VJ3 A;  4XE6 X;  1CD2 A;  4KM2 A;  3JWM A;  4KL9 A;  3JTW A;  3SQY X;  4G8Z X;  1DRH A;  3NXV A;  4DFR A;  4ELF A;  5HF2 X;  4DPH A;  3FS6 A;  3GHC A;  3JW3 A;  1RX4 A;  3FRA X;  2C2S A;  1J3J A;  4FHB A;  3TQ8 A;  3FL9 A;  4QI9 A;  3F0X X;  5HQY A;  2DRC A;  3F0V X;  4H96 A;  3NRR A;  3FQZ A;  5HQZ A;  3OAF A;  3F0B X;  3SRS X;  1S3Y A;  3DFR A;  1RF7 A;  1RX7 A;  1U70 A;  3RG9 A;  3NTZ A;  3F0Q X;  3DRC A;  4M6J A;  3LG4 A;  4I13 A;  5E8Q A;  1IA3 A;  4H95 A;  2OIP A;  3FYW X;  1RA9 A;  3EEL A;  3FL8 A;  3KJS A;  4KLX A;  3N0H A;  4M2X A;  5EAJ A;  3NZA X;  1RE7 A;  4QLF A;  1J3K A;  2ANO A;  1RX3 A;  4KAK A;  1JOL A;  1DHF A;  1MVS A;  1SEJ A;  2W9H A;  1OHJ A;  3F91 A;  4EIL A;  3SRW X;  3FRB X;  4FGG A;  1RB3 A;  1MVT A;  3HJ3 A;  1DR7 A;  1IA2 A;  3ZPG A;  4HA7 A;  1JUV A;  3QL0 A;  1DR3 A;  3QLW A;  1ZDR A;  4CD2 A;  1DR2 A;  3JWK A;  4KY4 A;  3K74 A;  3INV A;  1RX5 A;  1BZF A;  4H97 A;  2KGK A;  3SR5 X;  3NZ9 X;  5CCC A;  1JOM A;  3QFX A;  4KM0 A;  3SAI A;  3GYF A;  3NXR A;  4P66 A;  3HBB A;  3NZD A;  4TU5 X;  2HXV A;  3CD2 A;  3NXT A;  3E0B A;  4IXG X;  2XW7 A;  5HF0 X;  2P4G A;  3CLB A;  3DL6 A;  3NZ6 X;  3JW5 A;  3CSE A;  2BLC A;  3FYV X;  2BLB A;  1DR4 A;  3IX9 A;  3GHW A;  4QLG A;  3FRD X;  4X5F A;  3QL3 A;  2W9G A;  1DYI A;  2D0K A;  4KJJ A;  1TDR A;  3M08 A;  1J3I A;  5HT5 A;  3IRN A;  4XT8 A;  2FZI A;  4KBN A;  2O7P A;  1M7A A;  3K47 A;  4HOG A;  5HPB A;  2GD9 A;  5ECC A;  2W3W A;  1S3U A;  3VCO A;  3DAT A;  2W3B A;  3EEJ A;  1RG7 A;  3SA1 A;  1RA1 A;  2ITH A;  4ELB A;  2ZZA A;  1DYH A;  3FY8 X;  4IXF X;  3ZPC A;  2FZH A;  1RX9 A;  1S3W A;  5HSU A;  1OHK A;  1RA2 A;  3Q1H A;  5DFR A;  4XT7 A;  2ANQ A;  1S3V A;  5HVE A;  4FGH A;  1DLR A;  5U26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...