8F9MA

Hiv env germline targeting bg505_md64_n332-gt5 sosip in complex with v3-glycan polyclonal fab isolated from immunized wild type mice, and nhp monoclonal fab rm20a3
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
470
structure length
433
Chain Sequence
NLWVTVYYGVPVWKDAETTLFCASDHNVWATHACVPTDPNPQEIHLENVTEEFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLQCTNYAPKLRSMMRGEIKNCSFNMTTELRDKKQKVYSLFYRLDVVQINKEYRLINCNTSAITQACPKVSFEPIPIHYCAPAGFAILKCKDKKFNGTGPCPSVSTVQCTHGIKPVVSTQLLLNGSLAEEEVIIRSENITNNAKNILVQLNTPVQINCTRPSNNTVKSIRIGPGQAFYYFGDVLGHVRMAHCNISKATWNETLGKVVKQLRKHFGNNTIIRFAQSSGGDLEVTTHSFNCGGEFFYCNTSGLFNSTWISDSLILPCWIKQIINMWQRIGQAMYAPPIQGVIRCVSNITGLILTRDSTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title mRNA-LNP HIV-1 trimer boosters elicit precursors to broad neutralizing antibodies
doi rcsb
molecule tags Viral protein/immune system
source organism Synthetic construct
molecule keywords BG505_MD64_N332-GT5 gp120
total genus 94
structure length 433
sequence length 470
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2022-11-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...