8FABB

Crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
214
Chain Sequence
AVKLVQAGGGVVQPGRSLRLSCIASGFTFSNYGMHWVRQAPGKGLEWVAVIWYNGSRTYYGDSVKGRFTISRDNSKRTLYMQMNSLRTEDTAVYYCARDPDILTAFSFDYWGQGVLVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of murine anti-p-azophenylarsonate Fab 36-71. 1. X-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA HIL FAB (LIGHT CHAIN)
total genus 47
structure length 214
sequence length 222
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 8fabB01
3RU8L 3BW9A 3IDYC 3MLSL 3RIFK 1DVFB 4P2OA 3GSNB 1XF4A 3UZEA 2ZUUA 5IMKB 3CDFA 2IFGA 1L7IL 4I48B 4FMKA 1I1AD 3TO4A 1FNFA 1S7VA 1SHMA 2E8YA 1JNHB 1EHAA 2NNAA 3QRGL 2YZ1A 3RIFF 1CN4A 1OAXH 3O6FD 4AL8L 3KYKH 4JQXA 1WZKA 4PV8A 4QT5A 4GG6F 5E94B 1CL7I 5EZJA 3KPRD 3F12B 4OGAD 4NIKB 5IB1B 1MLCA 1NBZA 1BREA 4OF3A 2A0LC 2CLZA 4MXQD 4ZUVB 5EIIB 3ESUF 3AC0A 4G8FB 4X83A 3V7MA 5JHLL 2WIIA 3KDMB 4CU8A 4XH2A 3MCG1 1F4WL 1VPOL 2DB8A 1IQDA 2A6IB 4N0RA 3MO1A 4MA8H 4M61B 4DK3A 1YECL 2ZG3A 2PYEB 1A6UL 3MUGA 1X5XA 5IWLC 1CDYA 5EZLA 5HYQB 2DLGA 1F97A 1NCDL 1G7LB 2Z31B 4PJHB 5HHXL 4JM2C 3MROA 4YDJA 2V2TB 5D1ZB 5IM7B 4C4KO 4JKKA 5GRJH 4YNYB 3MREA 4HUVB 4WW1A 1OAKH 1XF5A 3KXFE 2DLHA 1JYVA 4XP6L 1KPVB 4FXGA 4OLXH 1IM9D 2HKHL 4CVXB 1NMAH 5HY9A 2JJVA 4PTUB 4HWNA 3MNZA 4GRWH 4N8PA 4ELKB 5GRXG 4JKPL 3OKOB 3IDXH 1U8PB 3RVTD 1CGYA 4OZGB 1YMMD 5E0QA 4GBXA 3EKCA 1CICC 1T2JA 2VITA 2X70B 1DANT 1OD7A 4HS6A 1XCTA 2EZ0D 1MRDH 3ZYJA 2RIKA 5CJQL 4Z7WE 2OJZH 1I7ZB 5IK3A 1AP2B 1G7MA 3I6LE 3WE6B 3RWFA 2NZIA 1T2QH 1TJIH 5T1MB 3FFDA 5F7YC 5I8KL 5DURB 1ZV5A 1LK3H 2FECI 5T3ZH 1WICA 3S34L 4HC1L 1CE6B 3DRTA 2GIYA 3EDEA 4GO6B 2P5EE 3IRZA 4HGWA 3NCFB 1OP3K 5I9QC 3ZHKA 3KJ4B 5CCKH 1NEZG 2Z31D 2IH1A 5FA3A 3B2VH 4TVSa 3D9AL 4OV5B 4XHJD 3DURB 4QF1A 2PNDA 3OGCB 1O7VA 2VDQH 3KNBB 4Y1AE 4ZUWB 3G5XA 1BWWA 2Z8WC 4HKJB 1KN4L 1WIOA 4LL9A 1J0KA 3QCUH 1AKJD 5HXMA 1U8OA 5FUCC 5HDQL 5I73C 2QQQA 2MCPH 4N0YL 1BZ7B 1UXSA 4EIGB 1N0XL 2A38A 3ARFB 1C5DA 3QEQD 4LCWB 2X4PA 5IG7A 4JKWA 3O81A 4KRLB 3I50H 2EIDA 3L9RA 5T1KA 4Z0XB 2QHRH 3NCEB 5FO7A 3BRGC 1NBQA 1FE8L 5D7IB 5FB8B 2X9XA 3C5ZD 1MQ8A 1I9IL 2VLJE 4U1MB 1TZIB 1DQMH 4GMTL 4CKVX 1CE1H 2A1WL 4DN3L 2VXTH 4X4YA 1UZ8B 3KR3H 5D2LF 4UOW1 5T1KB 5ILTL 1JTPA 4TOYL 4IS6A 4Z78B 3CMGA 4IOFC 4D3CL 4LCWA 1QRNE 5IG7B 3V5DA 4YWGH 3JV0A 1EH9A 1VFMA 2OI9C 4Y4FB 4HIJB 5EU3A 1TVBB 2ZG2A 1XCQA 3MV7A 2HLAB 2NTFB 1IL1A 2VDMH 1FAIH 2Y7QB 1JUFA 1OARH 3FQUB 4FZ8H 4NZRL 1NGPL 5ICXA 1J18A 1U93B 3MLRH 3TNNA 5SWSB 1RUPL 3WFBL 3ARBC 5JHDB 2D7TL 2P24B 3JSSA 4I0PB 1U93A 3V6FB 4MD5B 5I18L 2EXWC 3DURA 1CXLA 4P0DA 4NHUA 5F3BB 3JWDH 3ISWA 5C0BA 5I8CB 4HG4J 4LEOB 1DQJB 1BFVL 1LQSR 4LLUA 1Z3GH 4CMHC 3V5DB 4JZJB 3WFBH 3BT2H 5CBAA 3O41A 1RZFL 4FQLH 5FGRA 4KROB 4FZ8L 1H5BA 2ENYA 2DMKA 1YYLL 1NFDF 5I1LB 5FGBA 2X10A 4NWUL 1P7KA 2WNGA 4OGZA 5E4EC 2OXHA 4GAGH 4U1MA 2Y36H 1F4AA 2NTSP 1AY1L 4E41E 5FYJD 1I3GH 4LPUA 5ILTH 1UZ6E 1SM3H 4U1HA 3KR3L 4O2EA 2HFGL 4GRWF 4S1SL 1L9NA 2AEWA 2QQNH 3K2UH 5IVZB 1J87A 1T4KA 3TBYA 2ADFH 4FRWA 1MAMH 5C0GA 1BIIB 4HJGA 2V9RA 4LFHG 1UH3A 1FSKB 5F8QC 1Z2KA 3FO1A 4PJXF 4ZFGL 2BC4A 3U46A 1FORL 2NY1D 1WZ1H 4LRIC 5HD8C 1VENA 3P73B 3QXTA 2Q8BH 2R9HD 4NQDB 2XWJA 1HHIA 1KJ2B 2R15A 2R8SL 2XG5A 1CYGA 3PF2A 3RVXD 3MREB 1VEMA 1BLNB 3LSOA 5EWIL 2Y4SA 4L4TB 5KAQF 1KIPA 2E9BA 2MCPL 4Y2OA 3I9GH 1ZTXL 4MLIA 4IRJA 1HDMA 4WU5B 3RKDD 3VW3H 1CE6A 5IB3B 3NIGE 2RCSH 4P2YA 5BXFA 5EFIA 1PG7L 2AJSH 4CN4A 4WEBH 1QSFD 3H8NA 1F00I 2ZSWB 4FS0A 4S11A 3SDXE 4JFPA 4RDQG 3STZB 4TPRH 1CZ8L 1MLCB 5EIQA 3MNWA 3F12A 2H8PA 1SEQH 3BN9C 5FM5O 5FUOH 1TJIL 1MCBA 4JPIA 1T2QL 3RP1A 15C8H 2MHAA 5EC2B 5IVOA 1FPTL 5AUMB 1OQXA 1TITA 5HI4C 3GIZL 4DKEL 3OKOA 1D5MA 3MV8E 3D39B 5ISZE 3NIGF 3MRHA 4HG4K 4D8PB 4JG0L 1M7XA 2B8OT 2C4FU 5TDNA 1V7NL 1BEYL 5BS0E 4X7FC 2PXYC 4WW2F 5GZNC 3LAFA 3U6RA 1YUHB 1JMZA 4Z7NF 1NUFA 1EVUA 4JY6A 5F1IA 5IW3A 3IDXL 1IGIL 2EDNA 3BE1H 3IFPB 4PJ8D 5I2IA 5I76B 4Y5XA 3O2VH 4ZODA 3MROB 5C6PB 1AO7A 4XCEA 2VZ1A 4MNGE 2X9WA 4OLXL 1I1AB 4Q0XL 3OKMA 5D7LE 3GSWB 5IBLC 3BZFA 5JDSB 1OAKL 3EYSH 5D6DA 3MJ7A 1VGKA 3O9WD 3PE9A 4OKDA 3FONB 2VDPL 1CT8B 1R24A 3FB6A 3JV4B 3FB8B 1HOCA 1T83C 1ZK9A 2BXYA 5DRZB 1I7RA 3HCVA 1II4E 4DQOH 4Z6AT 2BXZA 2ED7A 3WIHA 3MLUH 3ULSA 4WTZG 4ZUVA 4LNRA 3SDCB 4C56B 5EBLA 1FH5L 2ADJA 2EDJA 3OBAA 3VGBA 4MDIA 4M4RA 3EZJB 3S37L 4PJ7A 5LGJA 3SE8H 1DLFH 4LSVL 3NH7L 2DMBA 2Y5TB 4NM8L 5B39G 3DSNA 1GGUA 3TVMA 1I85A 3SDCD 4HS8H 4Z7VE 5DEGB 4YR6B 5ENWB 4JCLA 1H15B 3NGBB 2I9LA 5ESAB 4EUPB 1S5HA 4MCZA 4KKCC 4HGMA 2A77H 2DQTH 1DBKL 1MRCL 3MX0A 2LVCA 1OGTB 3QCTL 3FQNB 3QNZA 2J7LA 3BPLC 4C56A 3MJGX 4OLZH 4U1SB 3DARA 5L2KB 5B39B 4LCYB 3RY5A 2WWMC 4KJYA 4D9LH 3QWRA 1T7VA 3BO8B 1EUUA 3T1FB 3BN3B 3OG6B 4FFWC 2HT3D 3CK0H 3S3SA 1R0AH 3DETD 5JDSA 3VRJA 3QHZL 1DBKH 1BX2B 1MRCH 5HGGS 5ADPL 1UACL 3PQYB 4M1GL 5BOZG 4PR5B 1T20B 1UJTA 2YZ8A 2A2QT 4TVPH 3B43A 4WUUB 1KJ3H 1NAML 3TN0B 1BQLH 4UV4L 4UQ3A 4MJ5B 3VFMB 4EDXA 4JY6B 5BV7C 1CLOL 4H1LA 3QEQE 1DLFL 5DFVC 4N1CA 2R23B 3FN0L 5KANI 1RU9L 1RZ8B 4KZEH 2KH2B 2B1AH 2NW2B 2AP2A 4P4RB 1L7TL 1T5WA 3QR2A 5L8LB 1CQKA 3R0MA 3VFGH 3QNYB 5DJDA 2J8UA 4HV8A 3W5MA 1WEJH 2Y5TA 3LV3B 2IPTL 5D96C 1CTNA 4UI2A 1A2YB 5LGJB 1HH6B 5C0IB 5DC9B 1SY6H 3HAEB 5HJ3A 1HKFA 5L7XH 1BFTA 2J12B 4QRRD 4FZEH 1BF8A 1G7QA 1C1EH 2AK4D 4NN7C 1FN4A 3EYSL 4U6TA 5FGCB 5C0ND 5J89A 2BSRA 4GRLB 3LEXA 1MCWW 3U2SB 4P99A 4N0CC 4Z76B 3D0LB 3I02B 1DVFD 2VR4A 5ISZD 4PJ5E 3UJIH 3JV4A 1WISA 5I73B 4N8CL 3RVVC 5CHNA 3VXPA 2OZ4H 4FQCH 3G6JE 5IB3A 3ARFC 3DTXB 4G8IA 5F7NC 1RMFH 1V7NH 4JG0H 3VFTA 4JLRA 2FH8A 1NUDA 4OZHA 5CZXC 3BZ4A 5D1QB 4DW2L 4RA3A 1QRNB 1URLA 4LPXA 4HAFA 4M3KB 5CMAA 1FCCA 5TQ2L 2WQRA 3K7UA 1EV2E 4NKMB 2DQHH 2YRLA 3MFFA 2DQDH 15C8L 5E8EA 1BBJB 4ORZC 2P42B 3P4OB 5FUOL 1ONQB 2ORBL 1VADA 2GFBB 3TCXA 4L3EE 3G6AA 1D5IL 2D7OA 4GW5B 1SBBA 1CFVL 1G7IB 2FJGB 3ULUL 1JV5A 1YQ2A 5AUMA 3IYLW 3UBXB 2GCYB 2IAMC 1K85A 3RX8A 1QQDA 1D6EB 3V0WH 3FFCD 2BSSA 2BNQA 1PG7H 4MCYA 3O4LD 3RGVC 4FG6C 3RX5A 1DCLA 4P48A 5HBBA 3IU4L 3KPOB 2BRRH 1KYOK 4F58H 1P6AB 4JJHA 3CU1A 2G5RA 4LF3B 5BS0B 3PWVB 2QADC 2Z92B 3IAQA 4HAGA 3DVIA 4UDUA 4XNMB 2DQUL 2ZUQB 5I1LA 1NBVH 4Y16C 4OCXH 1MJUH 5A3ID 3CFDB 3L3HB 5IQ7H 3HI5L 1YMHB 2JJSC 2HFEB 5TE4L 4CMHB 5KSAA 2VL5A 2PXYD 5I75C 5HI3D 2W0KA 5C0BB 2DRUA 3SE3C 3RIAK 1RZKH 4FQHB 2Q3AA 4UTAH 4Y16A 3O11A 4DN4H 1M6OA 4NSKB 3U0TB 3ZTNL 5GS0D 2FYYB 3MLVH 4HH8A 5JHDA 1SMOA 1G6RA 4J1UB 1WK0A 4NDMA 4NRXB 2HLAA 2NTFA 5F6IB 1DL7H 5HGBB 1KTRL 3ZKMC 4EN3C 3KLHD 1IZKA 2FB4L 3LEVH 5D7LD 4FFVD 1MPAL 4R4BA 4DCQA 4HX1A 4LHQB 1T4KB 4NWUH 5TFSH 1DUYB 4NC1E 4L4TE 1HHGB 3RPKA 1NUGA 3V6OE 3WO4B 2VDNL 1YYLH 3VMPA 1Z0MA 5CUSH 2RHEA 3MUZ1 5LCVH 2FX8L 3DHJA 1U8LB 4M00A 5EC1B 4EJ1C 1HQ4B 3HE6A 4GUPB 3MOBL 1QPXA 4K3DL 5D7IA 3OAZK 5FB8A 4GAJL 2AQ2A 4H1LH 1F3JA 4N9GA 4GKNA 3MOBH 3WUWA 2FBOJ 1MH5B 1ZS8B 4QNPE 2XOTA 1J0HA 1CQYA 3C5JA 5LCVL 4M7ZB 1T3FA 4FN0A 5GGSA 1C5DB 1I4FA 2VKWA 1KIUA 4LLUB 4BH8B 2XI9A 2PYEE 4KQ4H 5BRZE 2NXZB 2YA0A 3ARFA 2K7PA 1U8JA 1WFOA 4QTHB 3O6KL 1Z5LA 3IKKA 4MD5A 3EIFA 1I75A 4YWGL 5HVHB 1MPAH 3O3BA 2EC8A 2UYLB 1R3JA 2VTFA 1RJCA 5E1AB 1OTSD 1QSFE 1RUQL 5DC4B 5HHQA 1DL7L 4FFWD 4RNRA 5TGBB 2G5BA 2VLRD 3WN5C 3V5KB 5IBTL 1DQML 3FOLB 1BOYA 3B9DA 1D9KB 4RFNC 3PV6A 2EICA 4I3RL 5H37H 3MYJA 2FEEL 5EOCH 4IS6B 4DN4L 5EH1A 3ORJA 3WL9B 2V2XA 1AKJB 1TQCB 4J2XA 1JTTA 2ICWJ 5KSBB 1DZBA 5DJ6A 2QHRL 5T1MA 1OSZA 4JO2L 3SBWA 4GKSB 1NGWB 1OAUH 5D2LA 1MI5D 5A2KH 1CDJA 2PYFB 2CJUL 4EXKA 1I7UA 4JFEA 3BDBA 3LKPA 4LSQH 3SGDH 1QFWH 2DMCA 5DJXA 2CGRH 4ZO7A 4CVZA 3HUJF 2FIKB 1FZKA 3R8QA 1EEUA 2QSCH 5FO7B 1P6FA 3SGKC 4G6KH 3WIHH 3IGAA 4KUZL 1DDHA 1KN4H 4GBXB 4F58L 3EO9L 3HI6L 1ZVSA 3C5ZB 3IU4H 4LPVA 4NNXB 5E2UH 2R0ZH 4RBPH 3CUPB 3D9AH 1UXSB 3GKWH 3GKZA 4KK9C 3QFJA 4Q6IB 3T65B 4JHZA 3FFCA 2BP3A 3K0WA 3S36X 3RDTD 4X80H 1OSPL 1GZPA 2BVPB 5C09E 4LLDA 3VWKD 1KACB 4HUVA 4FG6D 1N59B 4LU5L 5I1DA 3LEYL 4K7PY 5HYJD 1LK3L 5HYSG 5KSBE 1BD2E 1N5AB 3LQAH 1A4KB 4EI6A 4PJHA 2VLRB 3WFEH 3P0GB 4D0DA 4LASL 4D9QD 2DQDL 4PJEE 1YMME 2H9GA 3SCMB 1I9RL 2OJZL 3LY6A 5GJTL 3IFLL 5TQ2H 2XZCL 2AJZB 2UWEF 1S9WA 1AD9B 3VDBA 1T5XB 3NFSL 5T3ZD 3BPCB 4PRAA 2R1XB 1UGNA 1ND0A 1NAMA 3GJFH 4WGWB 4DW2H 4DZBB 5K59E 2GY5A 1Y18B 1Q9OB 1HSBB 3E6HB 3MJ8B 1M1SA 5DTFA 1RMFL 3C5SA 4MD4B 2JTDA 3VH8A 5EIIA 4HMEA 3PHQB 4ETQA 2VO5A 5E8PB 3GFUA 4ELMF 5L2KD 4X6BB 3BPLB 4ZQKB 2CKNA 4G80B 4KROD 5JO5B 4R2GD 2JCCA 3F8UB 3IDJB 2HMID 5GHWL 1NMAL 4U1NA 1LO4H 1WTLA 5FKAA 5FO9A 4G8GA 2P1YA 5IEHB 4GW4A 5DRWA 4Z18A 1GC1L 1JGVH 1MUJA 3BI9X 5GRJL 3QDME 4OAWB 5E2TH 3OSKA 2GSGA 4UQ2A 3PQYD 3VFOB 3FQWB 1XIWD 5D6DC 2AJ3A 2OBGA 4PRHB 1TDQA 5DT1L 1OT2A 3SE4A 1CGVA 4PBXA 4P2OB 1JGDB 4PJAA 3QIUB 4NQXB 3LKOA 3ULVD 2C3HA 4XVUD 3QUKB 1U8KB 1VFBB 4FQQB 2XYCA 1ZT1A 5HI3C 4NRZB 1FVCA 3F6LA 2EDOA 4YDJB 3AU1A 3Q6GH 3ZHLA 1XIWB 5HYJB 2V2TA 2BVYA 4O51B 3GGWA 4JR9H 5LAXB 4KZEL 3UTSD 1E27B 2ATPA 4S1QL 1R3HB 1WAAE 4PGCB 3MZTA 3KPQA 1V7ML 1U91A 3D85A 3OKNA 1IEBA 1WCQA 1OTUD 1N64H 4HUXA 3AVEA 1RJYB 5EBWB 4IMKA 2R9HC 3MRQB 5ADPH 1K3ZA 1OGAA 4IOFD 2IAND 1K8IB 1CLZL 5DRXB 3OB8A 4Z7WF 1G6RL 3PGDA 2DM4A 4UT7L 3W0WD 2P4AB 4BK4A 3EJZD 5DK2B 1UM6H 3QDGA 4DGYL 3KPRA 5F7MC 5DEZA 1QLRB 3TPKA 4CW1A 5JR1L 4NNYA 8FABB 1SBSH 1T04A 4R7DB 2JK5A 4PJFE 3VFPB 2PR4H 4XGZB 3U1SL 5DFWH 4G6JL 3QUMH 4GMSL 5EU4A 4PP1D 3KYNB 3TBSA 2P5WA 1CGXA 1EVTC 5EUOE 3KLSA 5D72H 4MJIB 3IS1X 1KCVL 3NACH 5F89B 3KJ4C 5CS7A 3A0OA 3SDDB 3D85D 4PJGF 4DKDC 3FQTB 1JGUL 1HKLH 3D48R 1RK0A 4Y5YA 4E5XB 4PUBH 5CP3H 3SE8L 1KIRB 2CR6A 4NRYA 5HHPB 3Q48A 1BQHG 1AJ7L 3SJVB 1ZEAL 3S37H 4OCSH 3TBWA 2J8OA 4H25B 4KRPB 2XTJB 4P2RE 4GQ9H 4LLQA 4S10A 5C08A 3I3BA 2A83A 1T1XB 3DV6A 4G7YL 1KB9J 2JB5L 3BP6A 1JNLL 3SKJH 5FKPB 3RWEA 5MHSE 2NY0B 2DQCH 1S7XB 1Q9KA 1RPQA 3GBNH 1YZZA 3TNMB 1MIEL 3VFSA 4F3FA 1TPXB 3B9EA 2VDPH 2BOBB 3UPAA 4QXGH 4Y2DB 1TCRB 4M8VA 3AB0B 4BFBD 4PJGE 2A73A 5C9JA 3HMWL 1C5BH 4KRNA 2A83B 4RWYH 5A1AA 1KJ2H 4HDIA 5EOQL 3HRPA 3TBWB 4ZAKA 2UZXB 2SEBA 4WFGD 2P47B 3MSPA 4PLOB 2EDYA 4M62H 2JCCF 3F7VA 4QHNB 1RFDH 5F70A 3OB0K 2FX7H 4ZFFB 4FQXD 5E99H 1NC4A 4K2UL 4XPBL 3TA3B 5C6TL 3V4UL 5E5UB 1IGTB 2CRMA 5LVEA 1RZJC 3C5ZC 1TFHA 1S7SA 4P4KC 2WINA 3NN8A 5KSAC 3E6FB 2EDRA 4OIBA 1A9EB 2JJSA 3L3GA 3G6DL 1A3RH 1CDCA 3KYNA 1FNLA 1JF1A 3ARTA 4U1KA 2DWDA 5CSGA 3TN0D 1LK2A 1NL0H 2VZOA 3UPRB 3MQIA 5D9SB 4JM2F 1HZHH 3K8LA 4LEXL 4I18C 2X4NA 4IRSD 4LLVA 2Z91A 1CD0A 5ALCL 1UYWH 3NFPB 1FVEB 1R5VA 2I27N 3CVIL 4XNXL 4R7NA 4K9EC 2O5YH 3RVWD 4NO5A 4WEBL 2AJSL 3QHTC 1PJ9A 3R0NA 1S9YA 1EA9C 2ZCKH 1DFBL 3G5ZB 1NGYB 4BKLB 5B8CB 1RJYA 1N3NB 5E6ZA 3UYRH 4ALAH 3IXAA 2AERT 2E9IA 2ZOLB 3TO2A 4X7TA 4RZCB 1A1OA 4UILL 3OKNB 4K94L 3U4AA 1ZTXH 3LRSB 3QULB 2H2SC 3JZ7A 4W4OA 4XTRD 4X6CB 2YUZA 2J88L 3CDCA 4HJJL 1JFQH 3UTSA 2UUDK 5EBGA 4ODSH 1NKOA 1A6WL 5EWIH 1JWSA 3UTTA 3HUJA 1ED3A 1XR8A 4E5XA 1HIMH 3B3IB 1ZT1B 3MOQA 4O2CB 3GSQB 5DRNA 4JFDA 1U8KA 3QUKA 1ADQH 4OF7A 3PHSA 1G9MH 5F7KC 3UEZA 4Y5VA 4Z7QE 4N8VA 1NCAH 1FORH 4LAQH 2P5WB 4W6WB 2AKRA 3Q3GA 1IM3B 2GUOA 3G04A 3BD4A 2F19L 4PJFF 3HZYA 1A9BA 4JHWH 4Z9KB 3VFPA 4ODUA 3VWKC 4XWOD 5DRWB 1L0XA 3MV11 2AGJH 3WIIL 3RWHB 4S1SH 2IH3A 4Y19D 3DMMB 4JRXB 5SWSD 2IMMA 3O3AB 3CLFH 5EULV 2HKFL 2ARJQ 1MCIA 4ZYKA 5D7JB 3PHQA 3CVHA 5CSZB 3IJYA 3V4PH 4MD4A 3H9YA 2Y06L 1FJ1A 1SJHA 3ARGA 5EBWA 3K8MA 4XNYL 1C08B 1U36A 3QRFM 5E5MB 1RUML 4KKLC 4LARL 5I8EB 1K4CA 3E2HC 3ULVH 3ZTJG 1FNEB 1RULL 1LWRA 3GHEH 3NPSB 2BERA 5IW6B 3B8YA 4LK4A 2ZUSA 4KKCD 3X14A 5I18H 4X4MA 3MV9E 4Y1AD 1XIWA 5I15H 3ARFD 3BGMB 1LEIA 1W72L 4ZTPL 4NRZA 3VXSA 4MD0A 4LCIL 4ORGA 2HVJB 1VFBA 2VAAA 4CMMB 3ET9F 4I18A 2FJHB 2FWOA 3T3ME 3QIUA 2CDFA 2F54D 1YPZF 2DKSA 2XN9E 2VXVH 5DQ9B 5C0BD 1DQQB 3RWGB 4I9WE 2NPLX 2NY6B 5J6GA 2E7LC 3MRRB 4IMLB 5DQJB 4ZXBA 5J13B 25C8L 4D3CH 1J8HA 4TOYH 4P4KA 4K3EL 2DLFH 4HF5L 5CEZH 2UV3A 1OW0C 1U8QA 4DN3H 2QQKH 1A7OL 3ARED 2FX9L 2FATL 2GJZA 3IDJA 4ZPTA 4ZMAT 4EBQH 4JM2A 1IAKB 5AYQA 4LP5A 3NA4A 2HJLA 4ETYA 2EIZA 1MFNA 3DX7A 1MF2L 2FJFB 5E8DL 4HLZG 1ZVYA 4TVPE 2G75B 3ZE1E 2LAGB 5IHUH 3LMJH 2GITB 1PY4A 4KKAD 3T8XA 3VD9A 1OSZB 1EHNA 3QWOB 3I50L 3UC0L 2R2BB 5E6ID 3BOVA 4G6AD 2F53E 5MEPA 4XHQA 1ZA6A 4I2XB 2HTLC 3GJFK 4NM4H 2WMPA 1N0XH 4IEFB 1QA9B 1Q1JL 1KT2A 1LD9A 1OT1A 3NTCH 2W59A 1RZ7L 5DHVA 1J1XH 5MERB 2ESVE 4PJCA 4OM0L 4Q9BA 3EAKA 3TBTA 3U82B 4IIQC 1IEAB 2K1MA 2YK1L 1KTKE 2NCMA 2V6HA 1B9ZA 3GMNB 4PRHD 1MFBH 4P46C 1J7VR 4PBWD 1PSKL 2WV3A 4N5ED 2BSED 3DYMA 1FFOB 4S0TD 3NZHL 4KKBD 2PTTA 2OJEA 3DOSA 5MENB 4HUMB 2DQEL 2PETA 5D71L 5T3ZL 1JE6A 1U58A 2Z31C 4NJ9H 4ODWB 1MCDA 1ZS8A 4P23A 4R6UA 4GKZB 3GO1H 5D2NB 3RIAF 5CJQH 3S98A 3BZEB 4MXQC 1VSCA 3EJZC 3GRWL 3OPZL 4M5ZH 4AIXA 5L88L 1U8LA 4XPFH 3V79C 5C7XH 3AXLA 4KV5F 5FCUL 1J10A 5JW4R 3C08L 1UH2A 3WS3B 3MPCA 5EO0B 3G6JF 3FB7B 2EYSA 1YMMA 3L5WA 1AKJA 5F72S 5DS8B 2HRPH 3OV6A 1T1WB 4J8RB 1BD2A 3E3QE 4LKXB 3VXSB 4KPHL 4R26L 5IFHL 3I75B 3BX7C 5DMGC 1NMBL 4A2MA 4YHZH 3RVTC 5AG8A 5CINH 1FYTD 4HBQA 3BKJL 4F37F 3AGVA 5HPMA 1CFQB 1QEWA 1TXKA 1R3JB 2UYLA 4QGYA 5E5MA 4L3EB 5IVXF 2WUBL 1A7RH 3JV6B 4QXTA 4U2ZA 2PW2A 5HHXH 1A02N 4UZGA 3O11B 3ULUC 5I1EL 2DQJL 3DXAA 3E8UH 4KQ3L 4OD2A 1QFUL 2B2XH 5TDOB 3X3FH 2QR0B 4URTB 5E6YA 4H8WH 4ZFOA 3GK8L 1HINH 1F4WH 2EIEA 3NABH 3M8OL 4JFEE 4FNLH 3BKCL 3DMMA 4JRXA 4YHOL 4U7SA 3DVGB 4KRPD 4WTXA 5GSVB 5JHLH 2IH3B 3HC4L 4N1EA 1M4KA 4UDUB 5D2LE 5ANMB 2D7NA 5IGXL 4OD3H 3HZKB 3MODH 3BGAA 2E3VA 3DBXA 5F6HJ 5J06A 1K9TA 3VXME 2BJML 1EEQA 1JL8A 1U3YA 1D5BB 2Y6SD 4KKLD 3TJEL 4UTBH 1BM3L 3WNNA 2NY0C 3MACL 4QHLA 1A6ZA 4I77H 1N6UA 4AL8H 2NY2C 4WW2C 4XAKD 1UT9A 2BNQB 2BSSB 3I6GB 4JREC 3B8SA 1MCHA 4PJDF 5DR5H 1LO2H 1NCCH 2D03L 3O6FB 4O2CA 3QYCA 2J5LB 3TYFA 4NQCA 5SX5K 1I9JH 1ACYH 2EC9U 1FGNL 1JPFB 3FQRB 1FNHA 4HS3A 3MGOA 1NGZB 3MLSH 4OLWH 4XPAH 3VXOA 1ONQA 1EXUA 3DUUA 2WK2A 4NZUH 3CSGA 3NPSC 5LQBH 4P9HC 1YEKL 4C4KT 1W2KT 2GTZA 4A2LA 1FO0A 2ZUQC 3EO0B 4OF5A 1A1NB 3O3DA 4JAMA 1JNNH 1WCBA 3G5ZA 1H5BC 1RUAL 4JO3L 2WBWB 3ZT7A 5HGDB 1AI1H 1Z9LA 3BP5B 4JGUA 3VXQB 5F96L 3PHOA 4HIHA 5KSAB 3OAYK 1F3RB 1ZT7B 4NO5B 1J05B 1J8HE 5I1CH 5KOVC 1ETZB 5FUZH 4WUUE 4V1DD 5SWZA 3HS0B 4O02H 2GJ6B 2GJ6A 4PGBA 4PGBB 5E2WH 5B3NA 3STBA 3D39D 2DOCA 1FVEA 2NY1C 3LN5B 3V2AR 1HXMA 4MNQD 4U0RB 2X4NB 3DX8A 4BELD 4LF3A 2ZPKH 3MXVH 4XP4H 4EEEA 4S1DD 3VGHA 4GRLA 5CWSB 2H2SD 4PBVC 2FD6L 4NO2B 1VACB 1A1NA 2IPUG 3WCYA 3P9LB 1H8SA 3E1F1 3QJHA 4Z95L 2A9MH 2XZZA 1MIMH 4FFVC 4GSDH 4MDJB 1JP5A 4NUGH 5JNYA 5GRUL 3DVFA 3GNMH 1QLEH 3K4ZA 5T33H 1XGRA 3F5WB 4N5EC 3QG7L 3SBWC 2YD6A 2CUHA 3WFDL 3HFML 5DD5L 1FL6A 1YNLL 2OL3H 3O6LL 3O2DL 2XA8L 4C58B 4XPTL 1EMTL 1ZLUK 2A6KB 3LOWA 4QNPF 5DF0A 5DD0L 2GT9A 3RA7H 5JHDE 1VADB 1IAIH 1X7QB 1INDH 3C8HA 3O6FA 43C9B 5GS0C 1BBJA 1E4XH 1NGXB 1JIBA 1E4KA 1LO3L 4K7PL 2BMKA 3C9NB 4OF0A 3WN5A 1JI2A 4H1LB 1E6JL 4GG6A 4F57H 1UCBH 5CMAB 1D5BA 5CKGA 1N6QL 1G84A 3ETBF 3ZTJH 4PJ5B 3LRHA 1N8ZB 3NIDF 4OZ4A 4MHHG 2P5WD 4XC3H 1T0MA 4JLRB 2CIIA 3JVGA 1CFBA 4I0PC 4NJAH 5MI0C 4CU7A 2M2DA 4U6YA 2IFFH 5JUEL 2DTML 4JANA 4JHAL 4RDQF 3VA2C 4ZFOB 4B7LA 2VDLL 4H0GA 1T7WA 3VFWA 1YY9D 2XTJD 3OZ9H 3FKUS 1JWUA 3IJSB 3MCKA 2IJ0C 1TIUA 1OTTC 2DD8L 3ESVF 2BNQE 5K9QI 3U36A 3HUJE 1CDBA 5IBLD 4YBQC 3N85L 3FQNA 1OGTA 1LDPH 3WHXA 1BQSA 4RFNB 4QRRB 3VFNA 4LSPL 1HH6A 3WXVH 3QIBA 1PAMA 5KVFL 4B0MM 1INEL 1XF3B 1WC7A 2AXFA 5EU4B 2AW2A 3TH3T 3QNYA 1MCQA 4RRPG 3C2AH 3C09C 5GRYA 5GZND 3MCLH 4LHUB 3QPQC 3UMTA 1YPZB 1MFDH 4JFXB 2X4OB 1ZHKA 5J12C 1QFWI 5F9AC 4X0KA 3ZYZA 2ERJB 3FB7A 5EO0A 1MI5A 1UWEH 3BH9A 1FP5A 4KDWA 4LSSH 4P46D 4UQ3B 5EBLB 1I3UA 4WI9A 3QISA 2R2HA 5GGTA 3EHBC 1MJ8L 4TNWF 4LKCB 1U92B 2NY6D 1A3LL 3IFOA 3NOIA 4GBXC 4GAYA 4YC2C 3PP3K 4QRUA 4CVUA 1BJ8A 5CZVL 4UAOB 3BGFB 5IEKA 4M93B 3MJ7B 5DLMH 1U91B 3BEVB 4BZ2L 4OJFL 2C1PB 5HHVL 4AEIL 1CGSL 1J1PL 4N0UE 1E27A 3BUTA 4YHPA 2XPGB 4L3CB 1AO7B 5B39A 3AU1B 1DEEA 1T22B 1SJVA 5MEQB 4ZS6D 1YNKL 3P30L 1PLGH 2IG2H 1QFPA 2EDWA 2DI9A 1IGFH 4NQXA 5DD3L 1UKTA 1QFWM 4JHBA 4F33B 2XKNB 5EN2B 4XBEL 1IEAA 4Y1AB 4ZD3H 1DLHA 4S2SA 1FIGL 1TNNA 2I9LB 4QLRA 1BIHA 3CLEH 1D5MB 5DEGA 4UQ2B 2GSGB 4YHLH 1JHLH 1NUNB 4P9ML 1QNZH 5GGUB 3QIWD 5D7KD 1U8HA 1QA9A 3L3OA 4FXKB 2WQ8A 2ICWB 4HPOL 4ELMA 1LE5A 4M1DH 1DSFL 1IFHL 1UB6B 1WIUA 1QYGL 1B3JA 1T6WA 5CJXA 2ZWLT 3LN4A 2OTWB 4ZQKA 5JIKA 3FAXA 4RMVA 4CNIB 1Q9WA 4TUOB 3TCLA 1NCUA 1E4KC 3MRDA 5FCSH 4P2RA 2K9UA 5EU7C 2O61B 2ZSWA 4Y4HB 3X3GL 3BVNA 3FB8A 3DJ9A 1Y18A 2G9HA 3TYGL 4TUKL 2R4RH 5C07D 3P40A 2J8UF 3P11L 1ZWIA 2IQ9L 4M7LH 1H3PL 2CD0A 1T89C 5JPMA 3TT1L 3BDXA 4F7TB 3O2WH 1KEMH 4D0DB 2EECA 1E4WH 3CFIC 5HGHB 4QRSB 3LIZH 2XICA 1R3KA 1T66C 3VD4A 3GSRB 4Y5XB 2WBJD 3V4VH 1S3KH 5I1DB 4NWTH 5DQ9A 3U7YL 5DSCB 1EGJL 4L9LB 3RWDB 2QQLH 3MUY1 5DGQA 3DXAD 1ZLWH 5A16B 4MD0B 5MEQA 1X5LA 3QDGE 3TM6A 1H8OA 3QFJB 4Q6IA 4XP5H 3T65A 3V52H 3WDJA 3O45A 5BCAA 5L2JA 3P9MB 2HH0H 1RUKH 2W60A 2YA1A 1SJEA 3X14B 4HXAL 5SWSE 4AT6A 3FRPG 4QOKE 1QSFB 2Y07H 3BEVA 1OGAE 3T0EC 4E41B 3EFDL 3MBXH 2VJXA 2B7DT 5FUCE 1AC6A 2P43B 1C08A 3LHPL 4L4VE 5GISL 2J6EL 4U1HB 5DDHA 2Z8SA 5A40E 2O93L 1F2XK 4GAYB 5MEND 3H9SD 2IQAB 4BFGA 2QHLA 1AR1D 4AENB 1JVKA 2Z93A 3EDJA 3OAYH 4X6CF 1HQRB 3CVHB 3WV0A 1GCFA 2YPVL 1WAAA 3CX2A 1CU4H 1Q9WB 4HXBL 4TUOA 4CNIA 5BXFB 3MR9A 4LP4A 2AEPL 4BZYA 4JO1L 1AFVH 5BZDA 1KYOJ 2ATKB 4C57C 1UB6A 5IT2H 3ZKQD 5DJ0B 4TUJA 1P4BL 5I6XB 3HC3L 4F15C 3W2DL 3L3OB 2NY5H 3WO4C 5E03A 1KENH 5I8CA 2H1PH 2YA2A 4TSAH 1P84J 4S2SB 5C08E 3H6JA 1FZOA 3P4LA 4F33A 5F7HA 2P24A 4LCWD 5FHBL 3WHXB 4DKFH 4XX1E 5DRNB 3CD4A 1CVSC 1EAJA 1IL1B 4QTHA 2F58L 2JCCE 3B6SB 5E6IB 1Q0YH 5IJVB 3UTTB 2XPGA 1NGQH 4IRSC 3VFWB 2D31B 3MRBB 4IRZH 3PL6A 3HAEH 2ZSVA 1BIIA 4HJGB 3GBMH 1AXTH 4UT9H 3VWJC 1EK3A 5IF0B 5EUOA 3TBYB 5FM5M 3QULA 3LRSA 3S8WA 2XQYK 3BXNB 2UZIL 4KI5C 1A1OB 4QRUB 3IVKA 4MNHB 4BZ1H 4UNUA 1MAJA 1GIGH 1RQ5A 4BKLA 1K6QH 1NGYA 2J4WL 2D4FA 2KQMA 3H9SB 1TZIA 5EC1A 2HN7B 3NBNA 4UIMA 4M48H 4UDTA 1N6VA 1FZMA 3UZQA 2BVTA 4W6XB 5TE6L 4FTVA 3GSNH 2BMKB 2FBJH 3S3JA 1QG3A 2RBLA 4Z77A 1DUYA 5AD0A 1WVZA 1A22B 2MFNA 3QCVL 4JFXA 4CU6A 1JRHL 4KMLB 4CN6A 1S9VA 3Q0HA 3B2UD 2GT9B 2NY3D 2D0HA 3VA6A 4LEOA 5TPWL 2Q86B 3BGFC 2FECL 5I30H 3QG6B 1BZ7A 5LGKA 1A8JH 3A6CL 2Q6WA 3G08A 4NQDD 1XGRB 3RNQA 5J13C 3LN9A 5JW3L 2FSEB 4OB5H 3G5XB 5LXGH 4TTGA 3UROR 1JUFB 3FQUA 4L5FL 4LFHD 3FRUA 3NCJH 4NO2A 1Q0XH 1JPGA 3WEXB 4E42B 4P23C 1BQUA 1XGYH 2VL5B 4GBXD 3DX8B 4PJAE 3QZWA 4OIAA 5TE7L 3UYPA 2IPKA 3IF1A 3ME0A 4JB9H 4PY7A 4KK6C 2B0SL 1RZGA 3NMEA 4HIIB 3I2CH 5B8CC 3R1GH 5GGQH 2DQGH 3MJ9L 2NR6D 4P46A 3I6KB 1FZJA 3NVQA 5F7EL 3WKMH 1JPSH 2E7MA 1PEZA 5K9OB 4JAMB 3O3DB 3U9PH 5D1XC 2D0FA 2Y1VA 2GTZB 5E5RB 4D0BB 4OFKA 3IRPX 4JM4L 1KJVA 2F74A 4JPKL 5CGYC 1ZANL 4YXLL 1H3UA 1OWRM 4X5XA 5T3XL 43C9A 2HVKA 4LVOB 2DWEA 4QXUL 4NO0D 1B0RB 1NGZA 1VCAA 2XRAL 3BHBA 3SJVA 3HE7C 2A6KA 1XGUB 3S88H 3BIKB 4HUKB 3FT3A 4OGAC 4ONGH 4YK4B 3QH3B 4ELKA 1UENA 1YN7B 3BD3A 4OLEA 4WHDA 1OM3L 5IFAH 3F5WA 4WJ5A 4CVXA 4YHMH 3ZL4L 1Q72H 4JQIL 4F7EB 1CXIA 1KN2L 1N7ML 2DI8A 3ZYOA 5EU6D 5IB2B 1FFNB 1IQWH 3SKNA 2L0DA 2EXYD 5I1AB 3KNBA 2JF1A 4YE4H 2B1HL 3HB3C 2R0LH 2V2WB 4CBPA 4M8QB 3B2UC 4XP1H 3UJJL 1RV6X 3JTTA 3EJYC 1QRNA 3TP4A 4JFZH 1YEHH 2IANB 4OZHB 4RWHA 1V3KA 4P5TA 1FV1A 4LRIA 2Z8VC 4JFQB 3TWCL 3HLAA 3QQ4A 5EOCJ 3THML 4Z7NE 1YEGL 3WLWC 1HYSC 1KFAH 1EGJA 3SO3C 4UV7H 3QIUC 1PDKA 5DHYA 1AP2A 1G7MB 3SGEH 3WE6A 3FQXA 3QDHA 3IFNH 1EFXB 2BHYA 1KCSL 1NBZB 1XCTB 1CGTA 5D7JC 1GGYA 1KPUB 2APFA 3PQYE 1ZLSH 2YPKB 5EZJB 5HPMB 2VN4A 1F8TH 3QUXC 5C0IA 4DZ8A 3T2NH 3VXOB 1KG0A 1CF8L 1XGQB 3L95B 2ATPB 4HWBL 2P49B 4I3SL 1KJMB 1BVZA 3D25A 4B5EA 3U0WL 3TO4B 4YGAB 4BQ9A 4PTUA 1EDQA 3MNVA 4K55A 2ADGB 5HGAA 4FXGB 3CFCH 3BW9B 1YDPB 4PS4H 2XXCB 4QTIL 4CDHA 3HI1B 3TH2T 1BFOB 3PNWB 4MJ5A 3VFMA 4WU7A 2NY4C 3L5JA 3OJDA 3ULVF 1ZLSL 4HD9A 5IM7A 4I3GA 3GI9H 1H9VA 4YO0B 4G6AC 2EDKA 3GUTB 4HUUA 4MB4A 2BVQA 2AXGA 1JJUA 3IFNL 3FO9B 1B4RA 3PGFH 1BX2A 2NY3C 4P59H 3DVGA 4G6FD 4C56D 5CEXB 5SWQB 4JO4L 4X98B 1KCRH 3CFJA 4WO4C 1RIHH 4S1RH 3LRGA 3THMH 1S5IL 5JO5A 2Z35A 4G7VH 4HJ0D 4EIZC 4LMQI 1CBVH 3RY6A 4M6OL 2AJYL 5C0AB 2QR0A 2ZCLH 4Z7UA 3TWCH 4OZFG 5F9OH 1CIDA 1G0XA 2PTTB 3QDJB 5FYLE 1CXEA 1T0NA 4HKXB 3C6SB 1R5WA 3IJHA 3ULUF 2VZVA 3MRNA 1G9NH 4JN1L 3BPCA 4PRAB 3WLBA 4L3EA 1QLFB 3MLZH 5MP6L 4PJ8C 5I0ZA 2R0LL 2B1HH 1OAYH 3C8KB 3HMXA 3L7FA 3RZCC 1AD0A 4XMKH 2WUCH 1K8DA 5ESAA 4YFEA 4PJ8A 2NNAB 3F58L 1N5AA 4EI6B 3GSXA 3TZVB 4ZTOH 2NY0D 1G1CA 1QHOA 5DA4A 1WFNA 3DV4B 1QBML 1LDSA 4ONGL 1H3WM 1KC5L 1JWMA 3ARQA 1VGEL 3SDYL 5I71C 5DS8A 2XRAH 5MEPB 2BDNL 2EYSB 5T3XH 5CILL 3D3VB 1QBLL 4JPKH 1HILB 4X5WB 3EOTH 4JM4H 2YBRA 5T1LA 1YEFH 4NN5B 5DRZA 1S7TB 1TCMA 1FC1A 4POZC 1KIQB 1WBYA 3QAZC 4NQEB 1FLRH 5F7EH 2X40A 1INQA 4HHAA 4OCYL 3D2UB 1CT8A 4M1CD 1C5CH 4AEEA 5GZOD 1FZKB 4O4YH 4ODTL 4ODWA 3TA3D 3X13B 3LKPB 1KOAA 3CDGA 3R1GL 5DD1H 4BQBA 2M8XA 5E70A 5CP7B 2OJEB 4LPYA 2MWCA 4X4ZA 3W9EA 4GG8A 3VFRB 4OCRH 1TTFA 2DAVA 5IHBA 2LE9A 1H3TA 4LCUA 3K4DA 5J9PB 5F1IB 4KZDL 3ILPB 4LLYA 1AGCB 3EYVA 3OKLA 3VGAB 1QKZH 2CDFB 2RR3A 4JKLA 4FQIL 1EO8H 3NCJL 3FOMB 3G9VA 3QQ3A 3O6MH 4CMMA 3DYOA 4ZUUB 4FP8L 1PBYA 1WWCA 5DEFB 3MRHB 1F5WA 3TBTB 3EDDA 4WI2A 1RVFH 4ODXB 1A6TB 2OR9H 5EA0L 4G8GD 7FABH 3QSKB 4MWFA 2P48B 1AGEB 4HEPG 1IM9B 5I6XC 3UTTE 4F7MB 5GGRB 4Y19B 5FK9A 4RX4A 3ZKXB 1PEWA 3NIFE 1KGCD 1RZKC 3MLXL 3TPUB 2EYTA 3JWOH 5E2VL 2IWGA 5C0EB 3QCVH 3EFFA 5E2JA 3QIBC 2FBJL 4G9DB 3I3EA 1FL5A 5D2NE 5KSUA 3QA3B 4OCWL 5BS0D 1Y6NR 5CSZA 1KGCE 1UADC 4P5TC 5E9DA 4EXPX 4RISL 3ES6B 5E1HB 4E0RB 1YJDL 4JM2B 2P8MB 3DGCR 3WKNA 5D7IF 2X4SA 2C7UB 4Y5YC 2Q7YA 5IVXA 4OQTL 1UM5H 5JOPE 1J9CT 1ZA3B 2I07A 2OR8A 2NY2B 4JY4B 4KK6D 4WW2B 2NXYC 1QBAA 2NY7L 3TGXA 2YEZB 3K46A 2EEBA 4XPHL 4J3WA 2AKRB 1QHPA 1GGIL 3P77B 1HH9A 4N8VB 4Y5VB 3HNSH 1C12B 3AY4A 4WUKH 3NAAH 2PW1A 2AJVH 2FWOB 3FT2A 3B9VA 3IDMA 4KHXL 5T1DH 4JFDB 3O4LB 5FHBH 4F9LA 4ZFZB 3RUGA 1ED3B 4AQOA 3MRCA 3INUH 2DLIA 1VA9A 3MRJA 3FTGB 4L8SB 4U1GB 1N4XH 3Q2CA 2A6DB 3L1OL 4TSAL 5J57B 5E9DD 3MZGB 4PB0H 2J5LC 5C0RL 4N8VG 2J1KA 3EOAA 3FT2B 4M6NL 1I3VA 4MAYB 2DJ4A 3GMQB 2FYYA 2WBJB 1LEGB 5SX5H 5B8CA 4YDKH 4JN2A 3CH1B 4X6EA 3GJFB 1HHKA 3PGCB 5D7LA 4QHKJ 3E2HB 1MFAL 2PXYB 3IJYB 4ZS6C 1CU4L 5ANME 4KHXH 5LBSL 5F97E 2L4OA 1OCWL 5CGMA 1XGPA 4P57B 3STLA 4DVRH 2A9NL 2P8MA 3PDOA 5DUBB 2J6EH 5CBAB 1GGBL 4XNMA 1CLYL 1H0DA 2NXZD 2V17L 5DWUH 1GAFH 5BS0A 5GGSY 3W82A 3PDDA 2VNCA 3KGRA 4X99B 5JW4N 3PV7A 2GK0A 1UM5L 3WIFB 1KLUB 4OQTH 4Y4HD 4RFOL 5I1IL 5M95B 1LK2B 1G7PA 2NY6C 4MA1B 4HW6A 4XP9H 4PRBA 4U7MA 3T3PE 4MCYB 1B0WA 3CNKA 4HIXL 4WHCA 4RISH 1EAPB 5ALBH 3MA9L 1D6EA 4LIQE 5I17B 1IC7L 2HJKB 1AGEA 2XTLA 4UINL 4L8SA 2CH8A 5JOPD 1G7IA 1FFQA 1D7FA 1D9KD 1Z6JT 4NWTL 4Y4FA 3U7YH 2CKBA 2GFBA 1IC5H 4G43B 1QSZA 4HUWA 3U4BH 3LZFL 3QEUA 5C6WH 3LKRA 4ZUSA 4OZFH 3TO2B 3P77A 3OHXB 5F1KC 4YK4C 4D9RE 4YPGA 1H3PH 5J1AA 5FEBA 2DBLL 5IMMB 2AXHA 2DYPB 3VFRA 1RK1B 5KS9B 5HHME 4TUKH 1WFTA 3VFSB 1JHTA 5CP7A 4JY4A 2AS5M 1LEKA 2EH8H 1LO0H 3CDGB 1U2CA 2F5BL 2XZQL 4R7NB 2B5IB 4G5ZH 5HDOA 3DVNA 3H42H 4ODHH 1NQBA 5EU5A 1ZKAA 4MA3A 5MENE 1QYGH 1JHKL 4LVHB 4WEUD 4IOIA 3B5HA 5DD1L 5KG9A 1ZGLB 5MEOA 4YAQB 3H7LA 3VI4F 3D3VA 5C0EA 4P9MH 1T7YA 3AREC 5EO1B 4OLVL 5H94A 4QOKD 2WINB 3NN8B 4KDTA 3CLEL 3S5LB 3VWKB 2VDRL 4HKJA 4O5LL 1I3RB 2AJXL 5FK9B 4Y19A 4Y0GA 5KTEL 1C7SA 3DV4A 1KBGH 2O5ZH 2J8UB 2VOTA 4BFEA 4B7IA 3V6ZA 2YUXA 4WV1C 2R69L 1TZGH 8FABA 1AQKH 1NFDB 5IP4A 1B4JL 5EORH 3CU7A 4K9EL 1CGSH 1J1PH 5IMOA 5ISZA 1A6VL 5CJ5A 4PGDA 3MV8A 1AGCA 1QBMH 3EYVB 3ILPA 3OKLB 3CCHA 1KEGH 3WNPA 5IFJA 1CK0L 1C8PA 3KPSE 3Q1SL 4HKXA 1F90H 4WEMB 4E9LA 1QUNA 4M93C 3T0EA 3ROLB 4XMKL 3HMXL 4PR5A 3QI9A 1NMCC 1H8NA 3Q5OA 2MKWA 4WFFD 2Z35B 4OF6A 3PWPA 4P5MB 3ARUA 4X98A 3H0TA 3D0VB 3T1FA 2EDBA 3IDUA 3D2UA 3T4YA 1UWEL 4NQVA 2R0KH 1EFXD 3FO9A 4J3VA 1R3HA 5H35B 3WSQH 2AJYH 5DMKA 5IW1B 4O51A 4ZO9A 2ZKHL 4P2QE 1K5NA 3MCLL 1IZJA 4S1RL 2EEDA 1P2CA 3PP4H 5ITFB 1B2WH 4P2OD 3BQUB 3SDDA 1B6UA 5J1SC 4NP4H 5ESVB 1J0YA 2UWEA 3BIBX 4G3YH 5FYLD 2OTUB 4N5UA 4YNYA 2YD3A 5FM4A 1JYXA 3GI8L 3S9DB 4EUPA 3ZDXF 4OSUH 1DBBH 3P0YH 1OAQH 5EOTA 1QVOA 1NC4D 3C8DA 4L9DA 5HHNA 2DL9A 5D70L 1BAFL 5IEHA 2D7QA 4EQ2A 2Q8AH 4EVNB 3MJ6A 3EUUA 4HFUL 3PWPD 1X4XA 2I9TB 5DK2A 3SN6N 1F4YH 5FECB 2ADJB 2VDLH 2LV4A 2FL5B 5DD6A 4KI5D 4JHAH 3SDCA 1YEIL 1X5HA 5F7DA 4I3SH 5CJXC 5JUEH 3VH8B 3KXFD 3AROA 5SV4A 5TH2A 5SX4I 2CUIA 5F21B 1CL7L 3R8BB 2V5YA 5AWNH 4WTWA 4XVTL 5IB1A 2G60H 1W8OA 1DBBL 3P0YL 4FFZH 1XGTB 4FQJH 1S9WB 2X09A 4ZOCA 3C87A 4BH7A 2C3VB 4KHTL 3OXRA 1I7TA 3D18A 1M7IA 4UV7L 1E4XL 4YBHA 2C4XA 1U3HC 1Z0NA 2ZKHH 4P5TD 5C3TA 3RWCA 1F4XL 5L6YL 1OW0A 1BFOA 3PNWA 5IMKA 2XA8H 4YXHL 2ZG1A 3O2DH 2R0KL 1YNLH 5I75B 5IB2A 2ADGA 5HGAB 1MAKA 4FQPA 1FQ9C 4PJFB 3CX5K 2P5EA 3SGDI 3TZVD 4OGXH 3N1QC 2E7LA 1P2CB 1YEHL 3GNML 4NUGL 3D39A 3KYAA 3VFOA 4MLSA 3UJJH 1KNOA 1MUJB 1MY5A 2I5YH 3TVMD 4CJ0A 4GW4B 2BOCB 4RAVB 12E8L 4G8GB 5FO9B 1A1MA 1KN2H 5DVNA 3T4YB 2KPNA 3MXVL 1OPGL 2ZPKL 1Q72L 3Q1SH 4GRMB 2YPKA 4NO3B 1S7UA 2VYRE 3PWPB 3DUHA 4P5MA 4OFVA 3B9KB 1LNUA 1GZQA 5D1XB 3DI3B 2H32B 2F5AL 1P4LA 3CFKB 5A43C 4ETQB 3DX9A 3MC0A 2E9JA 3I6KA 3C5SB 4PLKC 4YQXL 1I8IA 5GGVL 4GKSA 1A47A 4QWWC 5F96H 3REWA 5DD6B 3ZO0A 5EFIB 4Q6YA 2G2RA 5C0JA 2X7LB 4KU1A 5FECA 4BM7A 3ARGC 5KTEH 3W5NA 1JNNL 4HIIA 5IMOB 5ISZB 1F42A 4PY7B 4MJID 1MEXL 4LRNH 3U7AA 2KKQA 2VLJA 2AABH 5DUPL 2ZCHH 4PRNB 3QZWB 4OLVH 4IRJB 2CPCA 4XPGL 4KJPC 5GRVK 4PRPE 2YD5A 4XNUH 2ZUTA 5EOTB 5LGHH 1MCFA 2CIKA 5GGQL 5D2NC 2NY2D 1U3ZA 5C71A 3SJVD 3I84A 4FQ1H 4CUCA 1JHKH 4WCYH 2OTUA 3VWKA 5K9KA 3S5LA 4UNTA 1H3GA 1XGYL 3ECBB 3DIFB 4Q2ZA 1P7QB 4HKBB 3QH3A 3QXUA 4OZGE 4Y8AA 3SQBA 3UTPE 3AREB 4XAWH 4U0QB 3CUPA 4FXLA 1ZGLA 4Y5VC 5E00A 1FDLH 1F6AB 5DMKB 5IW1A 2OMNA 2YXFA 1Q38A 3TJEH 3JVGC 5L9DL 4V1DA 5SWZD 2C3WA 3MXWL 5K59F 1FNSH 3D0VA 4HWZB 3GB7B 3VGDA 1OAZH 3W9DB 1F3JB 5DJXB 2HTLD 4RMQA 3LS5H 4MAYD 3NABL 1P5UA 2CMRH 3WLWD 5HYIA 1IC5L 1FZJB 2X1QA 5KS9A 4FTVD 2W38A 3O6FC 1P84K 4U1IA 2GYSA 5GS1B 3OHXA 3MV9B 5GSRB 3CCHB 4YUEL 5IFJB 4UT6H 3OQ3B 4IDJL 4KVCL 4TNVF 1V05A 2DQJH 2N4IA 3QEUB 1UXWB 1U8MA 4LIQL 1U8NB 4XCFH 2AJUL 2CKBL 5AZ2H 3GIVA 2PO6D 4Z7WA 1EHLH 3MRFB 3PV6B 3PL6B 2CKBB 3RDTC 4MMZC 3GM8A 3V5KA 4IRJD 2ZNWA 4BZ1L 4RFOH 5HGBA 3O8XB 5D7SL 5JOFA 5DWUL 5IFHH 5E1AA 4R26H 3TLRA 3EYFA 3T0WA 3FO0H 1DQTA 4RMTA 2A9NH 4YEEA 1M6OB 2OP4H 5BVJB 2HRPL 2B4CH 4DVRL 1X3DA 3RTQB 3PJSB 4OZIA 1OCWH 3QG6A 1ZLVK 1P7QD 5MEOB 1L4IA 4HIJA 5C3LD 3KYOA 4X99A 4R4FL 5FIEA 1ES0A 1NLDL 1A0QL 1RZJH 4BJLA 2BNRA 4OZHE 3CFDA 3L3HA 3E3QC 4PJAF 5JXAH 2FEDC 4OFDA 2VLME 4X4YB 4QRPA 4PJBB 4PJ7F 4Z7QF 2NY5L 2P45B 1KTLA 2EDQA 1AGFB 3SCMC 3PWVA 4J6RL 1IKNA 3RVVD 2QSTA 1NC2D 3L1OH 1B0GA 4YH6A 5FXCH 1EHXA 4QRPE 3VFVA 4F2MA 1A14L 1P4BH 3SGEI 3KPOA 2Q87A 5BVPL 5GPRA 3K80A 3VXSD 3MMEB 4MNHA 3IVKB 4P3CL 4PG9B 3BXNA 3ELAT 5CJOL 1OWWA 3L9RB 2BCKB 4R4FH 3JWNC 4ACPA 2X4PB 4WUKL 4LOUC 1MFBL 2ZSVB 4XCYA 1RAMA 4H0IA 1EERB 1GGIH 3QEHB 1EBPA 5EPMA 4I5BB 3O45B 4P5KB 5EZOH 2X4QA 4XPHH 3ARPA 4OT1L 4Y4KA 3ZSSA 1SEBB 3TV3H 4HMCA 4AH2A 1A6PA 3P4OA 3SOBL 5D7SH 2YWYA 5HSFA 2AI0H 1P1ZB 3NZ8B 3HB3D 2OR7A 3S96A 4BQCA 5ITBL 2PO6A 3JTSB 4L9LA 4U3XA 2MSPA 4HXAH 3MGTB 3KJ6H 4L8BB 4QF1B 4Y16B 3A6BL 2VZSA 5DFVD 1CR9H 3V52L 4AMKH 3DO3A 3QEQA 1BZ9B 3RTQD 1PFCA 4TRPL 3VDAA 1DANU 4KVCH 4R97B 4OCWH 4YBLB 2YOCA 2Q7YB 5IVXB 3G5YB 3QFDB 5BZDB 4V2CB 1OLLA 3HNTL 2E5EA 4C54A 5KS9E 4XTRC 4PJHF 3T4AA 5BV7B 1L6XA 5E9DB 4KKNA 4YEFA 1E4WL 1YEDA 3EYUL 2V9TA 3VXRE 3PGCA 4KK5D 5C0CB 1KSRA 1T66D 3ZT6A 5DDHB 4JM2D 3DROB 3TH4T 4X7DC 4P3DA 5I1KH 2EYTB 2RFXB 3GMQA 2X70A 2VIRB 4FP8H 4HPYL 3EO1A 1OL0A 3EHBD 4X9HA 2GCYA 4EI5B 5A2LH 3ZE0E 4OZGA 2H26B 2R2CA 4KZDH 3UDWC 3MBEB 5K33A 3D69A 3LPWA 2JIXD 1AGDB 1I1CA 1CFSA 1UJ3B 1YNTB 5C07E 4WCYL 5LWYL 4M1DL 5E8EB 5DJCA 5GRVL 3ZDYE 1BJ1J 3GHEL 2PW1B 4WWID 4XHJC 3OR7B 1RULH 5FM8A 5KSAD 1AIFA 4NZTL 2VLKD 5DMIL 3FO2B 4AEHL 4QGTA 3GSRA 3G9AB 4Y16D 5FHAL 2GTWA 4L3CA 3BZ4B 4JFFA 2P8PB 4KUCD 4QRSA 1OTSC 4XBEH 4ZD3L 2Z31A 4J23A 3VD3A 3ARSA 5EZLB 4G8IB 5JPMB 1A21A 3CFEB 3VD7A 1QBLH 1GYAA 3ZE0F 5GGVH 1JK8A 4U2YA 3CLFL 1RURL 5AYUL 3KS0H 1JTOA 4RAHA 3I02A 2FZ3A 4K8RL 5HHVH 2NY3B 3BZDA 1RJLB 4OJFH 5T5NF 1BHGA 3PWNB 1WGOA 4JG1H 3KVQA 3EFFB 4WWKA 3F58H 4UB0L 4JHWL 4U1JB 1FBIL 2E8ZA 2HG5B 1RIVH 3LN4B 5IKCA 12E8H 4XXCA 3KPLB 5INCB 1MCJA 1LP9E 4PV8B 3VD5A 4N68A 5F1OB 4LAQL 2IAMB 3MLZL 3OR6A 2YHGA 3BWAB 1BBDL 5ENWA 1XF2B 5KVEH 2P7TA 4LPWA 4PJCF 1S7VB 5I8OH 4LSSL 5BQ7A 4I48A 4HFWB 5HTSA 1A6WH 1MFEL 2XKNA 3QQ3B 5L6YH 3FOMA 1F4XH 5HYEA 2DM2A 3L7EB 1JFQL 2ZUWA 2J88H 4HJJH 4JDVA 3LKNA 2XKUA 1FVDA 4XI5D 1MCNA 1I8LA 3QBTB 4LCUB 1ACZA 4K94H 3OMZA 1DEEB 3SCMD 5IQ9A 3QXVA 5KVFH 4HC1A 4WDIA 3OB0H 1DVFC 4LLWA 4LQFH 1FG2B 4FQJL 2AK1H 3GI9L 3AS1A 4QCIB 4XVTH 4UUJA 4R9HA 3PXJA 2VQUA 3CFJB 5C70A 4XRCA 4XRCB 2XWBB 4OI7A 3T09A 1EZVX 4L8CA 2LABA 4XNXH 3CFCL 3VE0B 4OBRA 4X9FA 4LCYA 2JJWA 4AJ0A 3ARBA 1VFUA 2HJFB 1OQOA 4RGND 2R2HB 4D0CA 1RIUH 3V7AG 5KVDH 3U30C 3AMLA 4X5WA 2GAZB 2ZOKB 3QDMB 4HWBH 3IAPA 1GGTA 3RUGF 3CGTA 4X0KB 1YA5A 3FHQA 2EZ0C 5D70H 1KCUH 4Z5RB 4D8PA 3HG1E 43CAA 3HNVL 5C2UB 4Z7OE 3ROOA 1I1FA 1CD9B 4OSUL 4X8JA 2DIBA 3DPBA 6FABH 4OI8A 2Q76B 4F57L 4GFTB 5E99L 4G3YL 4U05A 1U2HA 3ARYA 1XF3A 4JRWA 3DSFL 4NP4L 2CLRA 5HHMB 4QRRA 1AD0B 2KL6A 3BD5A 1B2WL 4JPIB 4NQSB 3PP4L 2VC2H 2I60H 1EEZA 2VWEE 3OXSB 2E7CA 2WLZA 1YEEL 3OF6A 4U1JA 2W9DL 5JW4Q 4XPTH 5ID0B 3PWNA 1NCTA 4U6VL 5DD5H 1I8MB 3WJLC 2WANA 3BJLA 5T33L 1HOCB 1F58L 1HSAB 2A9ML 2EDLA 1MIEH 4K71B 1IARB 1KLGA 1AXSA 5SWZB 5CLWA 2FD6H 3H9SE 1YC8A 2DQCL 4GKOA 5D5ME 4WU5A 3D87B 4RAUB 4WNQA 4G7YH 4G8EB 3W0WB 1IC1A 1OGAD 3MLTA 4OCSL 2YKLL 5DJZA 5I76A 3BN9D 2V2WA 5EORL 1KF9B 3KLAA 4OD1L 1AQKL 4DAGL 4GG6B 1YDPA 1JCKA 1CG9A 2R69H 2YSSB 1IGYB 1PYWB 5ACLA 1JGUH 3QIWB 3VCLB 1NFDE 3PABA 4HIEA 2DTSA 2FHCA 2MMXA 1YN7A 1FYHB 2HYMA 1PZ5B 1RUAH 4JPWH 5C0CE 1ZXQA 3D25B 4NT6B 4NT6A 3TESA 3VXUE 3Q6FB 5DA0B 3BHBB 2AJXH 3WKML 4NQCB 2DWEB 4NZUL 4EI5C 4YX2L 4F15B 3GM0A 4KJWD 2H8PB 2VKXA 1SBSL 3BDYL 2DQGL 1CG9B 2YSSA 3DROA 5JR1H 3T2PA 4LVNB 3P9LA 4DGYH 2EKSB 1CD1A 1S7RB 4WHTA 4M7JH 4MS8D 1UM6L 1ACYL 5C0AD 5C07B 5TE7H 3DBXB 4W70A 3EJJX 4UT7H 1NCCL 3H42L 1OTUC 1G6RH 4WNQB 2IGFL 4JFFE 1CI5A 3VGFA 4U33A 3O4OB 2DDQL 1LO0L 3SE3A 1KPRB 4JFOA 2VWEC 4DUXA 3HS0A 1HSAA 1NKRA 3MODL 1JGEB 5JIHA 4EZMA 4Y2DD 4YDLC 4LMQE 2ADIA 4K8RC 4MXVE 2APBA 3HC4H 4R3SA 3H9ZA 4XVUC 3DXAB 1WCBB 1AE6L 1DN0B 3BKCH 1BLNA 2PW2B 1FO0B 3LSOB 2CXGA 4JR9L 3RAJH 5D1XD 2PO6B 3JTSA 35C8L 3Q6GL 4K3JH 2IF7A 3BKYL 3SKNB 1FFNA 3NZ8A 2I26N 4U31A 5ICXB 4KRPC 2Y9RT 5IWLA 3QB7C 5D8JL 4PGEB 5BJTB 4JFYA 4F9PC 1CXKA 3MGOB 4UINH 3BIKA 3RGVA 5FYJH 3VRLF 3PG2A 4GLRI 1MCRA 2JIXA 3IT8D 4XI5C 4BA8A 1GVIA 3MA9H 4UOJA 4HIXH 1S7QA 1G0DA 2BK8A 1K6QL 2J4WH 1JGVL 2BCKA 5J6HB 1OP9A 3I6GA 3BKJH 1UZ8A 5I1IH 4ISVA 3SDCC 3U83A 3AB0C 4S1DC 1LO4L 4YXKL 3OKEB 1FZMB 2PF6A 4M9OA 3G6JB 5K9OA 4RQQB 3AXLB 1R3LB 1DBAL 1GGBH 1B0GB 3J7HA 3RZCB 3UXFA 3HZKA 1LP9A 4IRZL 4JQXC 4X7EC 1EEYB 1NGQL 1E28B 3W0WE 1FYTE 1P5VA 4KVNH 2FRGP 3RWJA 4QY8A 5LBSH 5I66B 4Z0XA 1F3DJ 1FC2D 5FCUH 4DGVL 1JPST 3TIDA 3AUVA 4U1LA 3SHSA 4ZSOA 4J3XA 4XPFL 3MV01 3OPZH 4M5ZL 5L88H 2L7UA 2EDTA 3GRWH 1J0JA 4OD2B 3EDFA 2UY7A 2EDEA 5IQ9B 1AHWC 2LAAA 1B88A 1MJ7H 3FCTA 3LQAL 5I19L 1HK6A 1KB5A 1Q9LA 4M7KH 4NN5C 5C0CD 5GS3A 5IB4B 3QHFL 2DQEH 3TNNB 3NZHH 2Q6WB 2DLTA 3OGCA 1OHQA 3RUGE 2WBKA 4Q9RL 4Z7VF 1OSPH 5DZNA 1I9EA 5DHVB 4ZUTA 3ULVE 3B9KC 1KT2B 3N1MC 2YPVH 1JYWA 1U3HD 3WFCL 4LKXA 3HNSL 5H2BB 3GIVB 5CD3B 4XC1H 4TUJB 5INCA 1UXWA 2NR6C 1O0VA 3EO9H 5GISH 1BFSA 9CGTA 2R2BA 4ZNCD 5EBMA 3WD5L 4F9PA 5INDA 3O8XD 1BJ1H 2QSCL 1Q1JH 1U8IA 2PN5A 4BFIB 5BMFL 2NYYC 2EYRA 3QUYB 5T1KD 4LSRH 1RUKL 1FAKT 2HJLB 2CJUH 4NNPL 1NJ9A 1E4JA 2NQCA 4YDIH 2VQ1A 5FYKU 5ICYB 4MQTB 4HCRH 1N2RB 2ITDB 2XWTA 4F37K 5J56B 3T3MF 5F71A 1F6FB 4P4KD 4ZS7L 5MI0B 2KUTA 1TMCB 2CR3A 1MF2H 1S3KL 5DZLA 4HH9B 1U8PA 5D5MF 4XMPH 5EOCL 4MYWB 3AREA 3ARWA 3WFHA 4KTEH 3LIZL 4H0HB 3ARGD 5E7BA 4FFYH 5IBTH 5ETUB 1J0ZA 1U8OB 4OCNC 1EZVY 4HUNB 4ZUWA 3RWDA 1IBGH 4XNQA 1RUQH 2XTJC 4H20H 1CICB 4GS7B 3FT4B 1NC2A 1ORQA 1UZ6F 3TYGH 5D6CA 2IAMD 2VDOL 3O6ML 2VXVL 3RNKA 2X1OA 4M9PA 5HPOA 4EI5A 4JGMA 4PRNA 2NY5C 5KVGH 4R96B 2ATKA 4M61A 3TVMC 4OCRL 1W72H 1TQBC 4G9FA 2OYPA 3BUYB 3HE7D 5DYOA 3C09B 3FFDB 1R6VA 3AM8C 2O61A 4YDIL 4G8FA 4V1DE 4JFDD 1L0QA 4LSRL 3TCLB 4LARH 1MHCA 1C5CL 1GZQB 2IMNA 4NO0B 4OCYH 2F8OA 2OTWA 4JRYA 5ACZA 2GJZB 4KMTH 5C0AE 1S9XB 3ZDZF 5EZIH 4L8SC 2ED8A 3WD5H 4FQ2L 4OFYA 3A67H 3ZMRA 4C83B 2IG2L 3CXDH 3P30H 4C59B 4P4KB 1YNKH 3EZ8A 4XC1L 5GGUA 2W60B 1BZ9A 5C8JB 5EB9A 3BYYA 2OXGA 1RJZB 4WO4B 2ZP0T 4L8BA 5T3XD 1VGEH 1KC5H 3GHBL 3S5LG 2KDGA 1OY3B 4Q9RH 2AGJL 5BZWA 3WIIH 3WNMA 4CRPA 1HYSD 1KXVC 3UBXI 4WW1B 1CDHA 5DLML 3QHFH 5I1JL 1S78D 1CGUA 2E6PA 4ENED 5MHSD 5I19H 3VXTA 4R0LC 4QWWD 4UTAL 4J7RA 5IW6A 3OXRB 4WI8A 4P2RD 1FNEA 3UTZB 2X4UA 3MRPA 4TULH 4ZSOE 5DK0A 5IQ7L 4MA1C 5K9JL 3IXAB 5E8OA 5F9OL 1MJUL 1RHHA 4ODSL 2NZ9D 1S9YB 4G7VL 4HJ0C 4P2RB 3UX9B 1MCEA 1NCWH 3QJFB 1UC6A 1DQDH 4JO4H 5ERWA 4KJWC 2CRYA 5F7DB 3K2MC 4PJBA 4ZNEA 2OI9B 3OKDA 4F9LC 3UYRL 2I9TA 3QEGH 3S35X 5JW5B 2X4OA 1DFBH 2QEJA 3RWHA 4ELMB 2CDGA 1MWAL 2R4SL 2MNUA 4U3HA 3HZYB 4PS4L 3KXFB 1NANH 3LQZA 1WC7B 2AXFB 3Q3GB 3OZ9L 3KS0J 1CFVH 3TF7C 1U95B 5FYJL 3DNKA 5IOPA 1S8DA 4X6DF 1DVFA 2ARWA 2Y5EA 2UWEB 1QP1A 2ORBH 4RA0C 1DQLH 1ZLVH 2YD8A 3VGGA 3BYTA 1T22A 2YS4A 2B5IC 3IJSA 1JWUB 2A74B 3PIQA 1MLBA 5H35A 3TBVA 4PJDA 1F13A 3M07A 5C0FB 1HNGA 2MCG1 4GJTB 4MX7B 4PIRF 4EN3B 5GSRA 4N0FA 1N3NA 4M62L 1P9MC 2XQBL 5DUMH 1UA6H 4N8CH 1P53A 1RZIA 2Z8RA 1IAIL 3ZKXC 4JDZA 1LVEA 3X12B 2OL3L 3O6LH 3W9DA 3J8F7 4EN3A 1IGJB 4HWZA 1ZHBA 4XWOC 1UJ3C 1IT9L 1QLEL 3NFPA 4V1DB 3T04D 3U7WL 3OKYA 3BP7A 4Q9QH 4YC2B 4PRHE 1G7JA 3MRGA 4PB9H 5C9KA 3O4LE 1KIRA 5HHPA 3ARVA 4M5YL 4QHMA 2MQ0A 2EIBA 4Q2ZB 4XP4L 3V6OC 4JQIH 3V9FA 4YHML 3T2QA 3E6FA 3GRWA 4JPWL 4TNWK 4TTDD 1I3RA 1L7TH 4APQB 4CADB 2VXQH 1S8DB 3VG9B 3FMGH 4HSQA 1ZEAH 3AS3A 1AC0A 3FN0H 3RWIB 5FUZL 3VG0H 2CIKB 2V7HA 1BECA 5B38B 3D2UD 3PWPE 5T5NG 1NDGB 5FFLA 1MCSA 3F7VB 2X41A 3OJMB 4IOIB 1ZANH 2JK5B 2YKLH 3B4NA 2DQFA 4AEFA 3DRQB 2VLJB 3KPMB 4UMGA 1IGJA 1UACH 2X7LA 1XH3B 5A2FA 5FDWB 2IBZY 4EN3D 4PB9L 3CK0L 5FV2A 2ARJA 2GJJA 1KB5L 4PJEB 2ENSA 5HGDA 3LH2H 1N8ZA 4OLWL 3U7WH 5ESQB 3MRQA 4M43H 1IT9H 2HMIC 5KAQG 1TQBB 4YPGB 2YMXH 1LNUB 4ZUSB 3U48A 3GMRA 1UEYA 5IR1B 1EXUB 4J4PA 3AS2A 2C4FT 1CLCA 4NGHL 5L8KB 3K1DA 4FMFA 1Q0XL 1WV7T 2HP4A 4RGNB 2XQBH 5DUML 1JZ2A 4QRRE 4UTBL 3D3VE 4WY7L 4GW1B 4HK3J 2HJKA 3ARDB 4HBCH 5IMLB 1CDUA 3F62A 3MV9D 4DTGH 3NH7H 5JNYB 5F7LB 1A6ZB 3HNVH 3HG1A 2ITCA 4O2FB 1ZVHA 3TBSB 3ALXA 2X9YA 4IJ3B 3FQWA 4WO4A 5CEYB 3T0ED 1MCCA 3KAAA 5CWSA 3QUZB 1ZSDB 3N0PB 2X4TB 4OAWA 5IV2A 2GK2A 1IAOA 4XCNA 5DMYA 2B2XL 4U0RC 2UWEE 1EX0A 4O58L 2N56A 2CDEB 3E8UL 4FTVE 5FKAB 2R0WH 3LN5A 4BH7B 4DEPC 2K7QA 5DVLA 5JW5A 3QDGB 3GMLA 2BFVH 4P2QA 2YPLA 2L7JA 4PRDB 4PD4K 4LHUG 2CRIA 3PHOB 4HIHB 4JZJC 1GIGL 3OJ2C 5KBNC 5TH2B 3V95A 5CINL 1GC1C 1UVQA 4YHZL 4Q0XH 1NMBH 3QEGL 5GHWH 2KZWA 3EO0A 3BUYA 4OM1H 4KPHH 1AXTL 1IEBB 1T0PB 1GOFA 4YLQT 4NHCH 3T0EE 4EVNA 1R5IB 1W0VB 2H9GB 3SCMA 2EEAA 1EIBA 2IEPA 3UCRA 3KPSA 1JPFA 1UEMA 1X5ZA 2HT2C 4X6FB 4MVBC 5C7XL 1CICA 1H3VA 3NFSH 3TYFB 1V3LA 1MHPH 1JGLH 3I85A 5GGVY 1I9RH 2NXZC 4PJAB 3D3VD 2Q1EA 5ESVA 2H6PB 3GO1L 5FYKL 3ARBD 1SEQL 4D9RD 4LHUD 1K5NB 4OZHF 5T3ZE 5HVGB 3VGEA 3QUZD 4NCDA 5ANMA 4MXWL 3GMMB 3BMWA 5CGTA 1MWAA 3O2DA 2YD2A 4K8RH 4OFYD 1RURH 5ACZB 4Y7MA 5JA9A 4MB3A 1HEZB 2WSKA 1S9KC 1F2QA 4HWEL 2XIDA 3BKMH 4TN9A 2HTKD 4JFEB 2RCSL 5MENA 5TDOA 1TTGA 5EUOF 4KUZH 2P8LA 4YDVA 1NGWA 3HTLX 3EFDH 4NFDA 5DYOB 1MJJB 1I85C 1ZMYA 3HE7A 5F44A 1CFTA 2ZUXA 3BH8A 4QOKA 1ORSB 5JORA 3WL9A 4U6XB 1TTUA 5GGTH 2R8SH 4Y8DC 4XP5L 3UTQB 5DJYB 2VLRA 3W11C 4D2NA 4MWFB 4JO2H 1CVRA 5HYFA 2DQIL 3I75A 2DKMA 3LMJL 5TGBA 4RNRB 2KZ1B 2QQLL 4JVWA 1N59A 1X4YA 2W65B 3V4VL 4NQED 4Z0BL 2LVEA 4ZOAA 1AQDA 5AAMA 3WS3A 2GI7A 4YGVA 3TO4C 4RMRA 2FATH 4RFEA 3BPOB 3O2WL 5FYLH 3GDBA 3W9EB 4H20L 4KI5F 5ID1B 5CEZL 1IBGL 2DLFL 4HF5H 4M7LL 1I4FB 5E9DE 1XFPA 3PL6D 3P11H 25C8H 2RGSA 2R4RL 5DFTA 3EYUH 2E9WA 4LGRB 5D2NA 5C0NC 4WIQA 4LPCA 4XZUA 3X3GH 4QY8B 2R1YB 4M4PA 5ICYA 4CVZB 1MFCL 3HNTH 4OBSA 4XMPL 2IBGA 5HDBF 4KQ4L 1S7TA 3HE6B 2EYRB 5CJBA 5ID1A 3ARZA 4ZTPH 5C2BH 4KTYA 3L5XH 1Z3GL 3F7QA 3PWLA 4QHUB 4B53A 2JJTA 2C26A 1DSFH 1IFHH 3BRFA 5D5MB 3OG4B 1WBXB 4NNPH 5HDBE 3T0VA 3A6BH 2V2XB 5GGTL 5J6HA 4OKVB 3VXNB 1JHLL 4QXWA 1RUPH 2EKJA 3QT2A 1OARL 3HRZA 3RGVB 5CUSL 3TV3L 2G5BB 2Y06H 5EU6E 2VDNH 5DD3H 4OT1H 4PJ9C 2AAVA 1NFKA 1T21B 5EZOL 1WZMA 3K1KC 4UBDD 1QACA 5TFSL 1PLGL 2GHWB 3P2TA 4I2XA 3BKML 4JKMA 3WFCH 3TZVC 4NSKA 1Z5LB 5HI5D 3QWOA 1ZHLA 5J8OA 4UOW0 1ITBB 3ARGB 2W07A 3WJJC 2OL3A 4U3CA 3SKMA 1QPPA 2ADIB 2ICCA 5BVPH 4RSVA 1IAIM 3DX7B 4PJIB 1A7NH 1KB9K 4ZSOB 4M7KL 2UY6A 3C5JB 3UTTD 2F19H 5J1TC 3EOYG 1SY6A 3WDHA 4J6RH 3O3AA 3D5OF 4KTDH 5FYKH 4JFOB 3V8CA 1SMAA 4N9GB 4Y88A 3KPSD 5HVWA 3P0VL 5CZXD 3HN3A 1JGLL 1EEYA 2Z92A 1MHPL 2ICWI 3KPPB 4G42A 1HIML 1A0QH 1I8KB 3HI5H 4JE4B 5CEYA 5FDYA 1IM3A 3G04B 4NBYB 3RVUC 5TDPB 1CD1B 4WHTB 3GSUB 3DO7B 3ILQD 1MFDL 1K2DB 4OCXL 1QR1A 4KVNL 3QPQD 1KLFA 2AV7A 3S3PA 2E6QA 4MSWA 5HDQH 2HVJA 5IROC 4YBLC 1R3IL 3B3IA 3QCUL 1TLKA 3LDBC 1JV5B 4OM1L 2VLKB 5HHOA 2BRRL 4HQQH 3RUGB 2DJSA 4PGEA 5BJTA 2ZCKL 2HWZL 1J0IA 3QIWC 4F80A 1Q94A 4M02A 1OD9A 3QDMD 2O5YL 3RFZC 2BY3A 4I13B 1HH9B 3U0TA 3CVIH 1EO5A 2FGWH 2BFVL 3HPLB 3L3IA 5FGBC 4WO4D 1D5IH 1G1YA 2R0WL 2UZYB 3GSVB 3BPNB 2PTUA 4NQEE 4O58H 4LQ1A 5TJWK 5F88B 4HCRA 3IDGB 4A6YB 2DTMH 1JGEA 3SDDC 2FR4B 1I1RA 3BKYH 4U6HA 3V0VA 5FDWA 2W0PA 5IJKA 4K3JL 1NL0L 1WWWX 1YQVH 4LHJB 1A3RL 3RAJL 1DP0A 2X4SB 1AE6H 2VLJD 4XC3L 4L3ED 3T0XA 4P5TB 5TF1L 2DQFB 4HBCL 3QNXA 1NANI 1IAOB 4GH7B 1I8MA 2Q20A 3CX5J 5F7FA 5TF0A 4G9DA 4K7PH 4BUGA 2J6EA 5JMOC 1T1YB 5GXBB 3MFGB 4PP2B 1INDL 4JQVA 5A2JH 4NGHH 3UJIL 1TPXC 5JTWA 2IGFH 4F7EA 1DE4A 4F8TA 1IGTA 1CIUA 3ZKMD 4QHMB 3Q6FA 2DJUA 4QXGL 3TIEB 5CJ8A 3HZVB 4ODXA 4FZEL 5GRUH 3BDYH 1MIML 3B9KD 4XNUL 43CAB 1KB5H 3QIWA 3VCLA 3GBNL 4YX2H 3N1PC 1HXYA 3FJTA 4FQXA 2DLEA 5I9QB 5I16B 1IGYA 3PXHA 1LMKA 4Y4HC 4YFDB 2AK4A 1WEJL 3HPJA 3AAZB 2GAZA 5F8RC 1XR9A 3ARDC 5IHZA 1YECH 2BNUB 3MLTB 5I71B 2DN7A 1T20A 3VFTB 4WFFE 1X5YA 4KDTC 4K7FA 1PD6A 1S7WA 3MGAA 4YQXH 2EC9T 4NQTA 2VABA 4DAGH 1U3JA 2XWBA 1RZGB 4YHYB 1T1XA 5CHNB 3RHWK 3VXPB 1R5VB 1KJ3L 1NAMH 2VXQL 1W72A 3RJQB 4H25A 3NACL 4LLWB 3SGJC 4Z7UE 5D72L 4ZAKD 3SEPA 3TBVB 3LEXB 2BSRB 4QO1A 1SYVB 4G6JH 4GMSH 4KFZC 3U1SH 1IRAY 1JF1B 2PR4L 5D93B 1G9EA 3WBDA 4RMSA 3LKNB 1DUZA 1EEZB 3OXSA 5DO2D 2FSEA 4NQSA 1F58H 2GJ6D 4H1LG 4KK9D 1CS6A 1BVKB 2VR5A 1FGNH 2CLRB 1NC4B 2XXMB 4JVPA 5L0QC 3LQZB 1H15A 4NQCE 2QV2A 4AM0B 4QHNA 4OLZL 1I1FB 2CDGB 2I60L 2BHZA 4P4RA 3DUSB 3OR6B 1OP5K 3NCYP 2VC2L 2WZPD 1QLRA 4OFPA 4CW1B 1RZ8A 3CZFA 5AD0B 1BM3H 3QUYC 3DSFH 3L3KA 3U30B 5J11C 2ZOKA 3D1MC 3O0RH 4KV5E 5DJAA 1QSEA 4NM8H 3ZDXE 4D0CB 5TF1H 2MTPA 1RJLA 4HMDA 5AWNL 1RZIB 1OGAB 3QDJA 4S1QH 4YHOH 3REVB 3PQYA 1KCUL 1Q9KB 1QBBA 4LCCB 1YQVL 1R24B 3VXRB 6CGTA 3VRJB 4HUXB 5FKPA 1U6AL 3MBEC 3RWEB 3DLQR 3TEUA 5SWQA 5CEXA 1QFUH 4I8DA 3BZFB 4UUJB 3B9AA 1RIUL 3RJDA 4KQ3H 2JKXA 4PGCA 4DQOL 2AXGB 1CFNB 3AFLA 2D31A 3MRBA 4XCEB 3VXTB 4DK6A 3BSZH 2FGWL 2VQTA 1A4JA 5L2KA 1RK0B 5HHOD 5E2TL 4WU7B 2B20A 1FVDB 4RMUA 1UFUA 1VFAA 1UCTA 2HWZH 3U6RB 2AK1L 4LVHC 3VJ6A 4F7PB 1JGDA 5KSVA 4L1DA 1PKQB 1SYSA 2NLJA 3LQMA 1MVUB 3OKKA 5LG1A 3MLPA 4HQQL 1IC4H 1S5HB 4GRWE 4KH2A 3JUYA 4AK1A 4EKXA 1R3IH 4Q7DA 3TVMB 3OWEA 4KXZI 1DQDL 2EXYC 1T04B 1GL4B 3V6BR 4DZ8B 3NIDE 2XN9B 1W8NA 3WSQL 3ZHDA 2BRQA 5HD8D 2GY7B 2JCCB 5ICZB 1DTUA 1FCGA 4NO0A 4TULL 5DMJB 1W0WB 3PGDB 1K4DB 4PG2A 4DKEH 2QKIB 3ARDD 3QJFA 1EFXA 5GJTH 3P0VH 4MNQE 1D5XB 1FPTH 1PW3A 2VZ3A 3ILQC 5DHYB 1YEDB 3DETC 3WFEL 4PGZA 4WI7A 4JCMA 4KTDL 3FB6B 4JFFD 1J12A 3WHE1 4Y89A 1D3CA 1HHHA 1A7NL 4EQ3A 5D71H 4NZJA 2X4UB 4AZ8A 1KEGL 3OKMB 3ZDZE 4JVUA 4QRQA 2IANA 3PDGA 1B4JH 2D2OA 1NSNL 2R39A 1TZGL 5HYJA 1FL3A 3QEQB 4M8QA 4TSCL 2R0ZL 1GOGA 2CSPA 1QFHA 3CXDL 2YK1H 2O5ZL 4FQQA 4GRLC 1KBGL 3OR7A 2BSTB 5GIRB 1YUHA 3LKOB 4X9IA 4NQDA 3WIHL 2DKUA 5JIIA 1XAUA 2F54A 3NTCL 5CD5C 4KMTL 4O5LH 3N50A 4Y4KB 2ESVB 5FHAH 4NM4L 3MBEA 5B3JF 2Z0BA 3RZCD 2XY2A 2ZNXA 3QO0B 3KPTA 1OTTD 1B0RA 2VSCA 1UWXK 4TTDC 2JB6B 3GMOB 2NZ9C 4HWBA 2VIRA 5BW7A 5B22A 4PG9A 1ZWIB 3L5XL 3T2OA 4P3DB 3X17A 5C2BL 2XTJE 4WHYG 3MRIB 1WZ1L 2YD9A 2G9HB 2N7BA 4ZFGH 5KVGL 5LJYH 4NKOA 1MCKA 3QUYA 4LDLB 3NCYS 4MZ2A 2XZQH 5KZCB 4J3TA 4BFIA 1MFCH 1G7HB 2OS7A 4QRTA 5HYSA 2VDOH 1P7KB 3WMSA 1A3QA 3EYOA 1Q9OA 4EI5D 4RGNC 2QQKL 5I1KL 4DFHA 4UU9B 2HFGH 4DJMA 5E24E 5DJ8A 1H5BB 5I1GH 3NGBC 3NA9L 3SKOB