8FY1C

E3:protac:target ternary complex structure (vcb/753b/bcl-2)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
88
Chain Sequence
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGTNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development and crystal structures of a potent second-generation dual degrader of BCL-2 and BCL-xL.
pubmed doi rcsb
molecule tags Transcription
source organism Homo sapiens
molecule keywords von Hippel-Lindau disease tumor suppressor
total genus 25
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2023-01-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...