8GLT1

Backbone model of de novo-designed chlorophyll-binding nanocage o32-15
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
234
Chain Sequence
EFKFLATEAKMLITAAERLAGTDPRLQEMVALIKKELEQAERTFRNGDKSEAQRQLEFVLTAARAVMNVAAAANAAGTDPLLKAMVDAILWRLKEAIRTFQNGDEEAETQLRFVLRAAIAVAVVAAALVLAGTDPELQEMVEQIKDLLISAFMAGEKALTQLLFVAWAAHAVAMIAAAANLAGPRLQQQVKEILEKLKEAIETFQKGDEEQAFRQLAEVLAEAALVALRAALTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title De novo design of energy transfer proteins housing excitonically coupled chlorophyll special pairs
rcsb
molecule keywords C3-comp_O32-15, polyalanine model
molecule tags De novo protein
source organism Synthetic construct
total genus 79
structure length 234
sequence length 242
chains with identical sequence 3, 5, 7, 9, B, BA, BB, BC, BD, BE, BF, D, F, H, J, L, N, P, R, T, V, X, Z
ec nomenclature
pdb deposition date 2023-03-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...